4GG6A

Protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
180
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSAIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Biased T Cell Receptor Usage Directed against Human Leukocyte Antigen DQ8-Restricted Gliadin Peptides Is Associated with Celiac Disease
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 180
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gg6A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gg6A01
4FQHB 2NY5H 4HGWB 5FCSH 1DBJH 3GJEB 3QWRD 3BH8A 5GJTL 5JIHA 4OZIE 1D5MB 4YHKH 3UCRA 3BZFA 3HR5B 3O8XB 5I8CA 3PGFH 4OZFB 1MWAL 2HN7A 1SHMA 2OL3A 4UB0H 2XQYG 4GXVL 4NP4L 5TDPB 2ZOKA 5FCUL 5HYJE 1FZMB 4JRYD 3HC3H 1VKXA 3V6OE 1ZKAA 5EU5A 1KF9B 1MF2H 3CFEB 3W39A 2XNAB 1PY9A 5EFIA 2HFEB 2EDXA 4PJCA 5IG7B 2H45A 1OLLA 5BV7H 1J05B 1UG9A 4JM2A 4BK4A 4Z5RB 4RA3A 4PJGA 4Y19E 4HPOL 1AQDB 1CLOL 4U0QB 5T3ZD 1KN2L 3QFDB 4KK9D 3DI2B 2YD3A 4F57H 3DNKA 3RWEB 1OAZH 2ZKHH 1HHHA 4YGVB 5KAQF 3F7YB 5E6ZA 1F11A 3ARVA 5SWQA 3TA3D 4RISH 2NY2D 2XQYK 3DBXA 3SGJA 2AXFB 4OLXL 5JHLL 2HJLB 2VKXA 2VJXA 3C5SA 1R5WB 3T04D 1CGUA 2JTDA 3BZ4A 2QL1A 1A7NH 3EDKA 3G08B 5EUKA 4ZOEA 4KHTH 1H0DB 5KZCB 2AJSH 1OSZB 4J1UA 4BKLB 3HI1B 1AHWA 5D6CB 4U33A 4G9FA 3PWUB 2XICA 3CU1A 3U30B 4LCWD 1BAFL 1BPVA 2I07A 3RNQB 4NNPH 1DR9A 1S7TA 2PR4L 3SDAA 4EBQH 4FQQB 4FHBD 3B83A 3WXWH 1X9QA 4XXCA 4NN7B 4Q7DA 3AMLA 5DWUH 4BYHA 4C55A 3SDDC 2VXTL 5DZLA 3O3DB 2UZYB 4OTXL 3GSQA 1S7XA 3BKML 4QRPA 1O5DT 1P4LB 2AXGB 3GMQB 4P2RE 3C09B 4X98A 3MRCA 5HHOD 3WKNA 1KTKE 2C4FU 2JIXD 4U1KA 4JDTL 3MUY1 1WZLA 2EDKA 3QUXC 4ZFFB 1TXKA 5GGRA 4DW2L 5IMLB 4XNZC 1YY9C 4KJPD 1ZTXH 5BS0E 1DN0B 4RNRA 4IHOA 3S36L 5I17A 3S96A 1QSEB 5IFJA 5DR5H 5D72H 4DCQA 2E3VA 3AY4C 4YH6A 3W5NA 3QG7L 2RJMA 1E6JH 3QCVH 4Y5XA 5DI8B 5FIEA 3TF7C 3KPPA 3EO1B 3MYJA 1OTSD 2VXVH 1R24A 1VADB 2L7JA 4KDTA 5CBAB 3U83A 4X8JB 1GGYA 1CGVA 1MJUL 4FZ8L 1ACYL 2QQLH 5JOEA 4MJ4A 3P9MA 4X7SH 1A22B 5IVNA 5DFWH 4G5ZH 4EI5B 1KBGL 3B9KD 5GZND 2ZSWA 4RA0C 1KNOA 2ARWA 5SWSE 3SCMD 3PWPA 1RIVH 5FM8A 4DVBA 5C0EA 3MXWH 4N1EA 4C56D 5JDJA 5F1SA 3PL6C 5HGDB 2NZIA 4PS4H 3C2SA 3QUKA 3V4VH 4HT1L 1G6RH 1LEIA 1AO7A 2AJVL 2Z0BA 3MNWB 1ZVHA 1KCRL 4Q0XL 1T1XB 4TNWF 5DLMH 5IB2A 4PJHA 2C3WA 4OT1H 5HHMB 4HCRH 4OGXL 1LO4H 4J7RA 2CK0H 3GNMH 3NCJH 2DB8A 3VXMB 2V7HA 3IJHA 4CRPA 3KWWA 3LQMA 3N50A 3RNKB 1I3RA 4WI4A 5DMIL 2CRZA 1ZS8A 4PY8J 1EHLL 4JCLA 1BFOB 4MMZC 2BNUB 4OM1H 1LDPL 3V4UH 2CDFA 4XPFH 4R0LA 1TENA 1RUPH 5C09A 2ZCLL 5C0CA 5DYOB 3GJFK 4XVJL 1NL0L 3MRQB 4YZFE 5MENB 3BD3A 3DJ9A 4CADA 3VJ6B 3OMZA 3ARUA 1IGYB 5IK3A 4G80B 4PJBA 3SGDH 3IF1A 4Z7VA 2CIKA 3EYFB 4O2EB 1Q94B 2APTA 4RMRA 3QXTA 1LK3L 2Q86A 4XAKD 1ORQA 2ED7A 2PCPB 1CQYA 2B2XH 3FAXA 5AD0A 2MJWA 4O4YH 4KTDL 5I73B 3GSNL 4HUWB 5KVFH 4HUUA 7FABH 1XR9A 5LAXB 4TPRL 4KRPC 4NUGH 5FFLA 1NBVL 4AL8L 4N0UB 1T5XB 3KVQA 3QI9A 3S9DB 5C8JA 1VFMA 5E8DH 4PGEB 1VSCA 3U4EB 3HZMB 1T21A 3S5LB 2IWGA 4L5FL 1NC4A 2DN7A 4HAFA 3WS6A 4N68A 3RVWC 1ZLSH 4KQ4H 2YD8A 1UZ8A 3FKUS 3SQOH 3O3AB 4EN3A 4TNVF 5HYQB 3LQAC 3MFFA 4E5XB 3BZDA 4RWYL 3DX6A 3QXVA 1IGIH 5GGUB 3ZE0E 4O5LL 4I0PC 1XZ0B 4K94H 3CLFH 1X5JA 2JJUA 1KELH 1RHHB 1BZ7A 3K7UA 5I1HH 3PE9A 1FGVH 4MX7B 1ITCA 3LY6A 1QR4A 1JK8A 3BJ91 4URTB 1QHPA 3QDME 3WE6A 1EO8L 3BAEL 4XP6L 4MLIA 3QEGH 4QCIB 4P23C 1C08A 3TV3H 2ZP0T 4EKXA 2AI0L 5JNYA 4L9LB 1A6ZB 5FK9B 5JIKA 3HG1E 1MEXL 3OHXB 3ESVF 2R0KL 5J1SC 3WJJA 1DUZA 4WTZG 4QHNA 4L29A 3PL6D 4NRZB 5DJCA 5B8CC 4DKEL 1OY3B 1NAMH 3QIUD 1KPUB 1IBGH 5JW5B 1U8PB 4BFIA 1F4YH 5DJ8B 3GHBH 2HJFA 2AVGA 4U6TA 4TRPH 5ESVA 3UBXB 4LLVA 2JJSA 4YHOL 1JPGA 4ZNEA 2DQEH 4XMKL 1JN6A 1NSNL 1A7QL 3RTQC 4APQC 3I85A 3I84A 4YWGL 1RZ7H 1KYOJ 3BYTA 2A77L 4EDXA 4OJFH 4P59H 2DI8A 2WWKT 3ZYOA 3UPRA 1P1ZB 1TLKA 3QDJD 1OGAA 4KUCD 4CDGC 4CMMA 2QSQA 2GUOA 5DDHB 1MAKA 1R3LA 5MI0C 3WUWA 3DXAA 5L6YL 1L7TH 4P5MA 3CD4A 3B2VH 1OT1A 2VXSH 4AMKL 1YEGL 4OGYL 3IT8D 1OSPL 2A0LC 1JZ2A 1V05A 4IIQA 3SOBH 4MD4B 5EZLB 4KRLB 1FO0A 5IESL 5CGMA 5L8LB 2XI9A 3O9WB 4E41D 1B0GA 1BBJB 1S5HB 5GGTH 5CSZA 4CJ1A 3S3PA 4KRPD 4JM2C 3I75A 4PBVC 2R0ZH 3PWLA 3ZKSD 3K74B 1F3JB 2IFGA 1MFAH 4BQ6A 3ETBF 5EO9A 3REWA 1LE5A 2CLRB 1FVEA 4KZEL 3A67H 4B7LA 3DX9A 4M48L 4S1RH 1OM3L 3SGJC 5EUOA 3QQ4B 2DQCL 4WFHD 5F97E 5GGQH 5E9DD 2YWZA 1K5NA 4WGVB 2BMKA 1RU9H 2X4OA 3LIZL 3TN0B 1E4KA 5KS9B 5DFTA 1TQBB 3NAAH 4DUWA 2BHUA 2FIRT 3WL9A 1AHWC 1IAII 4M8QA 3T0WA 2AKRA 3UJIL 5CZKA 5T1MA 4ODXA 4YFLI 5I1AA 2ADFH 1JV5B 3ULUL 1QA9A 4UAOB 1WZ1L 5C08A 5DRWB 3SDAC 4HD9A 3CFCH 4Z0BH 3GJFH 5JLZA 1JTTA 3VGHA 4XXCC 2Z4QB 1E4WL 2W0FB 3O6ML 1JWMA 5H35A 1AE6L 5IBLC 5ITBH 4ISVA 1I7UB 2QBWA 4QOKD 3ZDYE 1IL1A 3LKRA 4PRNB 1YJDL 5B3JE 4QGTA 1HKLL 4YBHA 3PNWB 5GRZA 5I8EB 1GC1C 3RZCB 5INDA 4X80H 3DSNA 3C6LA 4RIRA 2VLKA 1ZHBA 2VZTA 3UYRH 5EULV 1XF3B 3KXFB 4MJ5B 3JUZA 1CT8A 1IC7H 2L4OA 1YMMD 4NNYB 4L8CB 1UWGL 4NHCL 5E1AA 3GSOB 1UC6A 4LPVA 2GJ6E 3C6SA 1TCRA 5EIIA 1G0DA 1HQ4B 4MJID 1FL5A 4KDTC 2VDPH 5TFSL 4MLSA 3I3BA 4OZHA 1IQDA 1S7WA 2VN4A 1PQZB 4OF8A 4WFED 1T22B 2Y5EA 2Y6SC 4RGMB 2EE2A 3QZWB 1UB6B 4UQ2B 2CMRL 4ELMA 3ZHKA 5LCVL 3KYOB 3L3OB 3X13A 2YZ1A 5C07A 3MFGB 4HJ0D 3WDIA 1NAKH 3WBDA 5CINH 1KENH 1JFQH 1WAAA 1KSRA 1JWSA 3O6KL 1NCDH 3GEWB 3Q5YA 1D5ZA 3O2DH 4YQXL 4U1JA 4LASL 5KSAB 3D3VD 3GIZH 4FQCL 4XWGL 5DXWA 1EXUB 5E4EC 5SX4I 5IB3A 1FNSH 5D7SL 1LQSR 1RJYB 5E2TL 3PWNB 4H1LG 1U58B 3TBSA 5JO5B 4N9GA 5FA4A 3C8KB 4FP8L 4M1GL 2NY4B 4GKNA 3M8OH 5L9DL 1PY4A 4P9HH 5E1HB 6FABL 3FQWB 2XTJD 3RWCB 3FFCB 4JFOB 3BMVA 5DHYB 4D9RD 2APVA 5MHSD 5F9JB 1QBML 4HH9A 1LNUA 4H88L 4Y19A 1KJ2B 1BVKB 3TO2A 4YPGA 1IEBA 1MJ7H 1Z2KA 2DWEB 3IDXH 2EIZB 1INEL 1MAML 3DECA 1KEGH 3E2HC 5AG8A 4B5EA 5E03A 2AEPH 4I1NB 3WNLA 2BRRH 4ZYKA 3O6FC 2IANB 1XT5A 4WU7A 5DO2C 3QIBA 4NRXA 1UACL 3TIEA 2OSLA 4G8GE 3ZDXF 3P73A 1SMOA 4CNIA 1KEMH 4X7TA 1A4JA 4LQ1A 4MAUL 2V9TA 3D25A 5IBLD 1QZ1A 4YHIB 4OZGB 4YDIL 2X4SA 4O51B 5BRZB 5ACMA 5E5MB 3L5HA 5CJOL 2HT3D 4KGLA 2NW3B 1U8QA 5GGSB 4K23H 3P40A 4W6WB 3K8KA 3QI9C 5JA8B 1PG7L 5KS9F 1WBYB 1NLDH 2ZSVA 5I1EH 2WWMC 4J6RH 5HGHA 4PP2B 4YJZL 1Q38A 3WS6C 4MCZA 3QEQD 5EG6C 1H5BA 1LVEA 3GHEL 2YA2A 1AR2A 2ZUWA 4LRNL 4NQXA 5FDYA 3JV6A 4EN3C 4ELKA 2R1YA 1T0MB 5DFVC 4GW1B 5C0IA 3GSWB 3REVB 1UVQB 3U6RB 5FO8B 3TBYA 4LVHC 2XPGB 1AGCB 2IPKB 4JKKA 4Y89A 2FGWH 3F5WA 1U95B 2Y6SD 4J4PA 3CC5B 1I8MA 1WZMA 4PJ8A 1QRNA 1R3HB 5KSBE 1DQDH 1MQKH 4BQCA 4L1DA 4X99B 2CUHA 4D0DB 3IDJB 4PLKD 2EYRA 2MQ0A 3JVGA 4FQ1H 3TBTB 3QIWD 4JPKH 2Y06L 5J13C 3PUCA 3MJGX 1JUFB 4N1HB 1PX4A 2C4FT 4K3EL 4L4TB 5MEOA 4BQBA 2FIKA 2DQHL 4MD0A 4JRYB 3MV8E 1P69B 1MCDA 2A6IB 3L7EB 3WEXB 4IOFD 5DQJA 2IQ9H 1NUFA 4ALAL 3R06B 4WNQB 2VUOA 5JQHC 1GHFH 2IH3A 3MR9A 1Y6NR 3WFHA 4OCMC 4A2MA 5ISZE 5JR1H 1A7PL 3INUL 3P4MB 1BF2A 3RVTC 3T0EC 4PLJC 1NMBL 2PYFB 5T1DL 3MTRA 1CFSB 1K8DA 2A73A 1BVLB 1IVLA 4OFYA 1U91B 3X3GL 5KTEH 1JZ7A 2AJ3A 2ADGA 3CDFA 4X7EC 3F62A 4Y16A 4X5WB 4QKXB 4Z77B 2A6JB 3SJVD 3PG2A 5FOJA 3P4NB 4JB9L 3UTPD 5DQ9B 3L7FA 1G7MA 3O6FD 5I15H 3Q6FB 5FYLL 3CX2A 5ILTH 2NW2A 1IEAA 4TTGA 3SY0B 3LN9A 1MCKA 4Y5VB 4QTHA 4Z76B 2WUBL 4WVRA 4G9DB 4OQ1A 4IIQC 5E7FA 4H0GA 3KPOB 8CGTA 4OIIH 1A1MA 3OR7A 5L7XL 4LCWB 4WY7H 4PJ5D 3E1F1 4OQTH 4MCYA 4Y2DC 1OAUL 2HVJA 5IB4A 1LP9E 1BD2D 4JZJA 4LNVA 1D5XB 3AXLB 5LQBH 2G60H 4NQEB 3RUGB 3ZKMC 1W8OA 5I2IA 5DK3A 5HHOB 4YR6B 1XF5A 2QJDA 4XC3H 1MCNA 2JIXB 1RZ8B 4BSWB 2OR8A 4AT6A 4PJAF 5D70H 1P84K 5EU7C 4LVNB 2DYPD 1MWAA 4LAJH 3ZTNL 1FRGL 1X3DA 2IALB 4GOSA 3FO1B 4NQCE 1T2XA 3UTSD 3BGMB 1NFIB 1S7RA 1ZT4B 4BZ2L 5D7IB 1CD9B 1SVZA 3WDJA 4Y5YC 1E4KC 1A21A 3BUYB 1UCBL 2J5LC 1NGXB 2HMID 1FZOB 1RSFA 2ZUXA 4JRWA 2OQJB 4OZGF 1V3KA 4LSVL 1MCHA 3FCTA 2GK2A 1ZVSB 2P5WD 4K7PX 1FORH 2L7UA 2EDYA 5C9KA 5J9PA 4UNTA 5T5NF 3O81A 4GS7C 5KG9A 4N1CA 1S8DB 1P4IL 3WN5B 2X4UB 2GFBB 2C3VA 2FLRT 1F00I 4H1LH 3VGBA 4C4KT 1LILA 5TE7H 1S3KL 3L9RB 1MOEA 5TDOA 4RWHA 1CU4L 1KN4H 5IP4A 2LTQB 3OX8A 2NZ9C 1YZZA 3B9KB 4ZS6C 4P46D 4Q97A 1SEQH 3MLVL 2XZZA 3SCMB 4PUBH 2VWEC 3DROA 2W9EH 4OI8A 4C56B 5CJ8A 2ZUQC 2UWEF 3HCVA 2X4RA 4I3RL 4UQ3B 3S8WA 5IB5B 5FYJU 4DOHE 1A7RL 5DJXA 2YPLE 2YSSA 4WCYL 3NN8A 3T0ED 5JPNB 1XF2B 3EYVB 3TNNA 1AXTH 4WW1A 1O7VA 2DJ4A 4NO0A 2H26A 5HI4D 2NX5D 4FA8A 3HI6H 2H6PA 4QHUA 3T2QA 4Z7OE 4R7NB 5L0QB 1CIUA 3FB8A 1HEZA 1D6EB 3BGAA 5E8NA 4U7MA 4ZUVB 1NDMA 2FD6L 3EJZC 5IKCB 2XA8H 4TUKH 2BY2A 1KLUA 3OZ9L 5DSCA 4JO1L 1MHPH 1NCBH 2M1KA 3QA3B 3LKOA 4QEGA 4CU8A 4HUVB 5TDNA 2AJYL 4DK6A 1A6WL 4KXZH 5EORH 4XHQA 4UDUA 1E4JA 5HD8D 3SKNB 2K1MA 1N5AB 4YGAB 3PWJB 2PW1A 2DS4A 4NJAL 2X44D 5CSBA 5CZXD 1EZVY 4HBCH 2G2RB 4X9IA 1XGPB 4M4RA 5DZNA 1YEJH 1J86A 4A6YL 3SE9L 1X4YA 1MELA 1OP9A 2NR6D 3I9GL 5GJSL 2I9TA 1CTOA 4IM8A 2HVKA 4HUKB 3MA9L 2I9LA 1CK0H 2VC2H 1G9NC 5E94A 3GUTB 4FQXB 4XWOC 5IGXL 4JAMB 5EU6D 3D9AH 5CUSH 2CIIA 3MGTA 2IPTL 4YNYA 2GITB 5EBMA 3DVNA 1Z5LB 4ZOBA 5F9OH 1FNHA 3U1SL 5IBUB 4F8QA 3RUGF 2NY1C 3OJMB 3JWOH 1IM3A 1JGDB 3CGTA 1RJZB 1ZT7B 3SO3B 3ZO0A 2WWKO 2R69H 2ZJSL 2ITDB 3OGCA 4S1SL 2FR4A 3A6CH 4YC2B 3VI3F 3IU4H 4G7VH 2A83A 4M43L 5F1NA 1M4KA 3L3DA 1F4HA 2H2PD 3BN3B 2NZ9D 5D93C 4TTDC 3I3EA 2PO6D 2D7TH 1IGTA 3VDCA 2Y36L 2YA1A 5JHDE 1EMTL 3RKDC 5D7IF 4AG4H 1K85A 1YYMH 4Y4FC 3CH8A 4YHMH 3PGCB 1W72L 4Y8DC 4CVZB 1NGPH 3PL6B 3IFPB 3P0GB 3QUZD 4JCMA 3QRGL 1EFXA 3KPRE 3QIUB 2X1PA 3MLWL 2VIRB 1H5BC 3Q5OA 4PB9L 1MJ8L 4YBLB 3ILPA 2WINA 4ZFOB 2AGJL 3EKCA 4QYOA 3FL7A 5DUBA 4U1LB 1MLBA 5EOQL 1U8IA 3QQ9D 4LBEB 1HK6A 4PD4K 4J8RB 1E6OH 3GSNA 4L3EE 3X3FH 3TVMD 1N59B 2H8PB 4U1NA 3VXSD 5EO0A 5E24E 1OP5H 4KMTH 1AP2B 4X6CE 1W0WA 3IXAA 3FONB 4PJ8C 2GK0B 4ZO8A 2F5BL 1PZUB 5KSVA 3VXNB 3S3JA 2PW2A 1SEBA 3JVGC 2EH7H 1P4BH 2VZ1A 4H8WC 1FFPA 1NCUA 2WQRA 4NNXA 3N1PC 3TBWB 3N0PB 4KKLC 3SKOA 3QHZH 5JW3L 5LBSL 5FEBA 1WZKA 4UUJA 1OQOA 3WDHA 1MSPA 4P9MH 3E3QC 2DD8H 3TEUA 4NQSB 1YEDB 1WC7A 1XGYH 2MHAA 2Z8SA 1T20A 1YEKH 3AB0C 5DMGC 4WI5A 4E41B 3U0WL 5B38A 2DIAA 5ALCL 3MBEA 1VGEL 4G8IA 3VFTB 1MUJA 3GSRA 1F45A 1PYWA 4HXAH 4GRLC 2MSPA 4KQ3H 1IMHC 4GSDL 4KI1A 2YRLA 4XPTL 2C4XA 5E70A 2BNRE 1F90L 1BZQK 3B5HA 1QRKA 4PP1D 5CEZE 3ARFA 2ITCA 4O02L 3VRJB 1G7QA 4JY6A 1M7XA 2I60H 1IRAY 1GPOL 1TPXB 3BGFC 4I3SH 4JO2L 1FLTX 5I1IH 1RZFL 5E9DB 2B1AH 2J4WH 4QWWC 2MWCA 4JKMA 4CN1A 2FJGB 5IV2B 4PG9B 5J1AA 4X6EB 2VISA 4OCRL 5TF1L 4M62L 1BJ1J 3GRWH 5IT2H 3QDGE 4KJWC 2O61A 2WBWB 1OB1B 3GKWL 2VO5A 3HE7D 4GAJH 5CJQH 1JZ8A 3P4LA 4NPYA 3B9DA 1Y0LB 2ADJB 4UINH 5IWLA 3D2UA 4R7DA 2FH6A 3OPZL 3HNVH 1XF4B 4XH2B 3ZHLA 3IRZA 5F70A 1JTOA 3QUMA 4JPIA 2WMPA 4FTVE 1IKFL 2XKNA 3VFRA 1WEJH 4QOKB 2KPNA 2DM7A 4Z7NE 3RRQA 4OAWB 1FJ1A 1KCUH 5ACZA 3ZT6A 3L6FB 3OAUH 1U8LA 1QBLL 4HJJH 4Z18A 4P2RD 2G5RA 5LKNA 1FG2B 5ERWA 1E4XL 1MCJA 2NNAB 4I5BB 4TSAL 5LWYL 4ONHA 3T3PF 4JFYB 4QTIL 2R23A 5BV7B 1UXWA 4JR9L 5BS0D 1YMMB 4Z7WA 3AS2A 4MNHB 4XC1H 4IDJH 3IGAB 4I18B 5E4IA 2CR3A 2HT4C 3NFNB 2GTWA 4MJIB 4OGAC 5D2NE 4XCEB 1IFHH 2FJHA 2CXGA 1MIEL 1AQKL 2W59A 3L5JA 43CAB 3KR3L 3CMOL 3KYNA 1MCPL 4LARH 1F4WH 4R8WL 1HYSC 1EBPA 2XA3A 1UH2A 4HKBB 3T0AA 2VDNH 3LSOA 3Q1SH 5IR1A 2CQVA 5KSBA 3IXTB 4BQ9A 1EHAA 2YD1A 1AFVH 2BSTA 4JFFE 3FB5B 5AZ2H 3D3VB 2VKWA 4GRLD 4D94A 3KHOA 4D0BB 5SWSD 5MEQA 1EAPB 3OB8A 4KUCF 2FX9H 4JFDE 1ED3B 3DSFH 4HJGB 3SE8H 1WWBX 3F58H 1G9MH 1MRFH 2EXWC 1U3HD 4NO2B 1QNZL 2N7AA 3LPWA 3S7GA 3ZYIA 5DVLA 2I25N 3LMJL 1ND0B 5H8DA 2XTJB 5IVXA 3F12B 1IC1A 5DTFB 3OL2A 2W92A 2WSKA 2X9WA 5ISZA 2GCYB 4QWWD 1G7LB 1CE1L 1OCWL 1S9XA 1DL7L 3KS0H 4YIQB 1MI5E 5HDOA 1P5VA 3IDMA 2ERJC 2X7LB 3OJDB 2QKIA 4KJWD 1HSBB 2VXUH 2Z8RA 4FMFA 4AEFA 4QRRA 1SBSH 4B53A 2XY1A 3BKCH 5TE4H 2VLJA 1N8ZA 4GBXD 4XNQA 4L4JA 4Q74A 5D71H 5ESAB 3RI5F 3BPLC 5I6XC 1X6NA 3RJDA 1DQML 1ZHKA 3PJSB 2UY6A 2OL3H 3IFOB 4N9OB 4WUKL 1KCVL 1QD0A 1CFTB 1JGLH 2HLFD 1D6VL 2CJUL 4WUUE 3VRIA 2OR9H 3H9YA 1B4RA 3QCUL 2OJZL 4PGJA 1AC0A 2CO6B 3QG6B 3RVXC 1CF8L 3EFFB 4UTAH 5HGAA 4QXGL 3WFCL 1YEFH 5GGVY 3CPLA 2V7NA 4EUPG 3IU3A 1T1YA 1RIUL 1YNKH 4XVSL 4JREC 3QEQB 4YHLH 5T33H 5DA0B 3V5KA 3H9HA 2Z35B 5A40E 1MNUH 5L2JB 3ARED 3TP4A 1ZSDB 1S7VA 4U7KA 4MQTB 1A9EB 2R4RH 3IS0X 3GMPB 4G42A 3L1OH 4TVPE 4KJQD 5JUEH 4NQCA 1Y6MR 3D39E 4YHYC 1ZGLB 2Z31A 2JELL 2VH5L 5FYJH 1Q0XH 5FECB 3OJ2C 4UZGA 1JP5A 1QSFA 3BP5B 5B3NA 4R96A 1I8IA 1KIQB 1ZHLB 1KC5L 2VLRE 3I02A 2C1OB 3QIWB 3NFSH 3MNZA 3FT2A 3KJ4C 1BZ9B 3C5ZA 1U8JA 2WLYA 3OKDA 4HPYL 1S7UA 3HG1D 4DQOH 5E2UL 5E4EB 1IC4H 2DAVA 3GK8H 1FN4A 5E2JA 3RIAK 3QCTH 3G9AB 1K2DA 1I9JH 3UAJD 1MCBA 1GZQB 2Z93B 4HMCA 5E8OA 3BIBX 1UB5B 1SJHA 4BQ8A 3H7BB 3UXFA 2FX7L 1F97A 1GC1H 1FV1A 1YQVL 1Z6JT 4P2OA 3MOAL 5KOMC 3O0RL 1FZJB 5T3XH 3UO1H 4C83A 3L3KB 1NCWL 1KFAL 4PRDB 3X11B 4ENED 4DGIL 3LS4L 4NCDA 1UGNA 5CGYD 3B3IB 1RJCA 4FXKB 2V2WA 1BFVH 4X7CC 3PHOA 1LO5B 3SJVB 5C9JB 1UM6L 2DQGH 1X5FA 2JB5H 1YEHH 1QFPA 4M3JA 4GW4A 1I7TA 1GGIL 1LMKA 3FQXA 4J3WA 1CFNB 4YDLC 5KN5A 1R3KA 4ONGL 1TVHA 5JOFA 1A9BA 4HWEL 2FL5A 2J8UA 1A6UH 4PJ5B 3MBEC 2F9BT 1FE8L 3QJFB 1F6AA 3U9PL 3HE6C 1IGJA 2E27L 4H5SB 3U4AA 4HX1A 3ARFC 2IADB 5IIEA 5EOCH 3EDJA 3ULVH 3GGWA 1ZAGA 2IG2L 4XP5H 3U7YH 4ZS7L 2DYPB 1XGUA 1NAMB 1DSFL 1SJVA 2PTVA 3UTSB 4X9FA 5IJKA 2P49B 4M1CD 1J5OL 1OGTB 4OCSL 1QR1B 1CE6B 2NYYC 3JTSA 4OLVL 3VRLE 4RFEB 4LVHB 4POZC 2DQFB 3U36B 1T80A 4MDJB 1DVFC 3PDOA 1SYVB 5BO1L 1QSEE 3D69A 5GGVL 3E8UH 4WFGE 2G9HA 5F3HA 1Q9KB 4N5ED 3X14A 3ALWA 4EVNA 3MV9A 3UTTA 2AAVA 3MROB 5DS8A 1NBZA 3FN0H 3V6FB 3RDTC 2EYTA 2A74B 5C0BA 4WWKA 1BJ1H 4ZTOH 1UJ3B 4ZXBA 2HLAA 4LSTL 1DQJB 4LLUB 2WBJA 1MIMH 5ID1A 2EDWA 4JQXA 4JQIL 3VXTB 4P46B 3GSXA 4NKOB 2YS4A 4UV7H 4U6HA 3UJJL 2ATPA 3OF6A 1J0HA 1KB5B 5F96L 1N4XH 3QNXA 1I3GL 1WCBA 3VFPA 4P4KC 5KAQG 3PHQB 3VFWA 2H9GA 3T08A 5ELIA 2ZG1A 3P9LA 3VXUE 5HHVL 1AGBB 2QEJA 3GO1H 1E28A 4D9LL 5CJXC 3OKMB 3LV3A 3B6SA 1RURH 2GJ6D 1PLGH 3U9UB 5IHUH 5D1ZD 5E2WL 4G6JL 4PY7A 3PXHA 2EKJA 3OKOA 2OXHA 1XGTB 1LEKB 4XVUC 2O5ZH 3VXME 1UYWL 2JK5A 1T7VA 2R4SH 1DUYA 4L3EA 2BNQA 4LEXL 5HDBF 3DUSA 1RULH 3MRJB 4X6CA 5DD3H 4RMTA 1LD9A 1SMAA 4L4VE 1NDGB 4OCWL 5F8QC 4ZSOE 2X4QA 3LRGA 5T1LA 5B39G 2KZWA 5GRYA 3WIHL 4M02A 4EUPH 2Z91B 2GY7B 2YUVA 3TFKC 3NGBB 4EDWH 3L3HA 4K71B 4C57C 3GJFB 4X4ZA 1G7IA 2P5ED 2Q20A 5MENE 3ULUC 1MLCA 3THML 1JNLH 3DHMA 1DBMH 1RZGA 4D8PB 2YEZA 3LH2L 4CVWA 5AWNL 3MCG1 4HBQA 4YO0B 1A47A 3RPIB 1HHIA 5I30L 4RQQA 4PRBB 1GCFA 3TPUB 3QWOA 1MCCA 5D8JH 1A3RH 5C0AE 3NIDF 4RFNB 5DUMH 1Q1JL 3N9GL 2L0DA 4TSCL 4JZNA 4N0UE 2DWDB 3CSYA 4KJYB 3MLSL 1T66C 1RZJH 2AEIT 2P8PA 4POZD 2O26U 5EU6B 5EZOH 1DVFD 1D5BA 2BOCA 3QJHB 2B8OT 1QLFA 2CRIA 4Y1AD 1PKQA 2VOTA 4Z6AT 5L2KA 1F3RB 1BBDL 3IAPA 5GISL 2AJUL 2YD4A 3VG9C 3FQTA 4GG6B 4ETYA 3LS5H 5ESQA 3VG0H 2GJZA 5HPMA 5D7LD 4M6NH 4NJ9L 1UH4A 4LNRB 4G8GD 1FO0H 4ZPTB 4RRPA 1MFBL 1TVBB 4BH8A 2W1NA 1N2RA 1DBAH 2PO6B 3DETD 4WJ5B 5I1GH 3DWTA 1I1CA 3CUPA 3EGSB 1NEZB 1A6VL 2QTEA 3CZFB 1G84A 3T0VA 5ICZA 4XNUL 3QUZB 4IBLT 1MFCH 3KPSA 4FTVA 3C87A 4HHAA 3DTXA 1QSVA 4R3SA 3WCYA 2IQAB 1JCKA 4Z7UB 4FS0A 5I0ZA 2JLLA 4HFWA 2PXYA 5AZEH 1SYSA 4ZQKA 3M17B 3Q6GH 2ZUTA 1TJGH 5BXFA 3SE3A 3TVMB 3VXSB 3FFDA 2Z31C 4LDOB 1X5KA 3NBNA 3UTQA 4N8VG 4LKXA 4MHHI 4XNYL 3K4DA 2VLLB 4A6YA 5BJTA 4P0DA 1TETH 1K4DB 2QQKH 3BEVB 1R5IB 5GRXG 1MFDL 4KZDL 4K8RL 3WSQH 4GMTH 1I9RH 4GRWH 1T03H 1JHKH 3LHPL 1A7OH 4XB7A 6CGTA 4WU5B 5A3ID 2IFFH 3ZTJG 3QRFM 3LRSA 3MV8D 4H20H 2Q7YB 2HKHH 1TJHL 3QNYB 1MH5A 3LN4A 5GS0C 4P2OC 8FABB 1CBVL 4NKDB 1CN4A 1QFWH 4HC1L 4XP9H 4ONFL 3MJ8B 1KB9K 3QQNA 3TO4D 4XBPA 3HPJA 1AXIB 4TULL 3D5OF 2DBLH 5EIQA 3G6AA 3U2SA 1W72A 3ARWA 3P3YA 3ZDXE 1RJLB 3EYUH 4GRMA 5TH2B 1NMAH 5JIPA 1FBIL 4PJIB 1AI1H 5SWZE 3LD8C 3HZKA 5IM7A 2DI9A 4ZFZA 5F7KC 3HE7B 1P2CA 4OLEA 5AYQA 5DJ0A 2ESVA 1MI5A 5I74B 1RUKH 3PDDA 1K6QH 4AENA 3U0TA 4UT9H 2GSIB 2NTFA 5FYJD 5IW6A 3VFUA 2YKLH 4YDVA 1OWRM 4WHTA 1CDJA 3G5XA 1R5VB 4P5TC 4HIIA 1QBBA 1UWEL 3MLRL 3R8BB 3T09A 2R2EB 4JDVA 3TJEL 1DFBL 1RMFH 3RWHB 3RVVC 2MCPH 4PGCA 1CZ8H 1ZA3A 5JORA 4L8DB 4DTGH 2I27N 2VQ1B 4DKDC 4GW5A 4ORZC 4WDIA 1T4KB 4QF1B 2MCG1 4R97C 2R29L 4PJ9A 5I66B 3BXNB 1CL7H 1Z9MA 1FCCA 4QGYA 5IJKC 4M7JH 2PETA 1NBYB 1MVUB 3KYMA 3RWJB 4GG6F 4G6MH 3HMXL 2CKNA 2YD6A 5T3ZL 1DLFL 5BS0B 3HLAB 5DA4A 1I8LC 3JWNC 2RIKA 4DK3A 5T3XD 2MKWA 4U2YA 5E08L 3BWAB 2M26A 2EXYC 3LKQB 2AEQH 4JFQA 4OFVA 1YECH 3MZGB 12E8L 3VFSB 4UDTB 4GAYB 4MXWL 3DX7A 1BWMA 3HNTH 3RPKA 3V9FA 4OF6A 1WBZA 3CJJA 1ETZA 3HRZA 4UU9A 1CD8A 2WBJC 1MY5A 3WLBB 1UCTA 4JQXC 5HYFA 3FMGL 1U93A 4Z7UF 1O7SA 2R1XB 5DRZB 4NRYB 3SHSA 2BK8A 1HINL 3MSPA 5GS3A 1RI8A 3OXSB 3V2AR 5DMKB 4JKPL 2VAAB 3E6FA 2AK4D 2VLRA 1RAMA 2YN5A 1OAKH 1AD0B 4M61B 5GS0D 5IUSA 2IBBA 3QUYD 5EO1B 2ADIB 3BT2H 2KDGA 2UVEA 1B90A 1U8NB 4NUJB 4FNLH 3M1BA 1OAQH 1UENA 4PTUA 5HTSA 3TYGH 2Q8BH 4HGWA 1U3HB 4G8FB 5ALBH 3V0WH 3GJEA 4R6UA 2C9AA 4P2CG 4I4WA 1D5MA 4XCYB 1MFEH 3HR5A 3O8XA 2YPLD 4GKZA 1OAXH 4OZFA 4F7CB 5H2BB 2YPKB 1C1EL 5TDPA 2CDEB 2ED8A 3ULVD 4KV5F 1FZMA 3J8F7 3DIFB 3RFZC 2XN9A 3FAWA 1OHQA 4DUVA 2FHFA 2XIDA 4OD1L 4ODVL 2XNAA 2HFEA 1F13A 5IG7A 4PJ7A 1J05A 4Z5RA 3QSKB 4LLQB 4GBXB 1M7IA 2P46B 1NPUA 1NMCC 5GSVB 1NLBL 5CILL 3QFDA 2Y1VA 1CFVL 1TNNA 3RWEA 4YGVA 2VERN 5JTWA 3F7YA 4BH7A 4P5TD 4GT7A 4PJAE 1TZIB 1J0IA 5MERB 5GRJH 2IANE 2YRPA 4H1LB 3RVVD 2HJLA 3HZYB 1R5WA 4NDMA 4L9DA 5LJYH 3GSUB 3V7AE 1DBBL 3G08A 4F37K 2VDLH 2GIYA 4PJIF 1H0DA 5JQ6L 1C12B 4OZGE 1OSZA 2FX8L 1QQDB 3HI1A 5D6CA 4YE4H 1FAIH 4MMXC 1FGNL 2NY7H 3GM8A 3VW3H 3S3SA 3PWUA 3EOTL 1NANI 4N90E 1LGVA 3RNQA 2NXYD 2N7BA 2C7UB 1GAFH 1MCOH 1FLRL 3AREB 3PP4H 4UIKH 5J0BA 2EXYD 4NHUA 4OLUH 4XHJD 3O3DA 1P4LA 3O3BB 3GMQA 2BSSA 3QPQC 1KJMB 3OG6B 4RAHA 1FG9C 5IFAL 3MO1A 3MRMB 5HHXH 4XBGB 1A3LH 3H0TB 1JRHL 1Z3GH 5IMLA 3N85H 3BUTA 4ODHL 4OUOA 1AY1L 3MZTA 3UBXG 3D18A 2UWEE 3CVHL 4MXQC 5IEKB 3C08H 3FJTA 4KI5C 3BP4B 2IGFH 4U6VH 1T89A 5GZOC 4S1QH 3TT1L 4GAGH 5DI8A 3HG1B 5JHDD 3EO1A 4ZDHB 4R26L 1FYTE 3F8UB 5FUZL 3NACL 1DQLH 4UV4L 4AIZB 1SY6H 4X8JA 3AC0A 4L4TE 5GJTH 3KPRD 4JRYE 5IQ7L 2BFVL 2H2SC 4X5XA 1DQTA 2H3NB 1MWAH 4O2FB 4GXVH 4NP4H 5FCUH 3MLPA 5K93A 3G5YA 3BYYA 1KXQE 2R56L 2XZAL 1KPVB 4CW1B 1QLEL 4LCCC 5D1QA 2V5RA 3TPKA 1B6UA 4I48B 2OK0L 5HGDA 4MNQE 4HPOH 1CLOH 1OGAD 4MA3B 1KN2H 3MNWA 4HQQL 3EYOB 3O3EB 4EQ2A 1T1XA 5EU4B 5CCKH 4N0CD 2J1KA 5F7NC 1U8MB 3FO2B 3HC4L 3DXAD 4FMKA 4XZUA 4HWNA 2FO4A 1WF5A 1A4KB 4NO5B 4OLXH 1TZHB 3RNKA 2DQDL 1BQHG 4LGRB 1RFDH 1EH9A 5ID0B 1GVIA 4JFZL 1BFOA 5DD6B 4LDEB 4LCWE 4F15C 4LOUD 3G04B 2FJFA 4ZUSB 4PJFE 5DYOA 2XTLA 1SJXA 1BAFH 2BNRD 4OCLC 3MRNB 3MRQA 4NQEE 5MENA 1AGFB 4PGZA 2FLBT 5CEZD 2PR4H 3VJ6A 5BVPL 1IGYA 5I9QB 5FGSA 1IC5L 1VB9A 3EYFA 4O2EA 3VI3E 2VXTH 1Q94A 4OTXH 2HRLA 2PCPA 1RUML 2DDQL 1FL6B 3HAEA 1V5JA 2H41A 4HUWA 5LAXA 1A3QA 3QPQD 4JDTH 1C8PA 1ZE3C 4N0UA 1T5XA 4DW2H 3U4BL 4LQFH 3FT3A 2NY3C 3O2VL 3OGOE 5D7IE 3QDGD 4M4PA 3NA4A 1VFOA 4I2XA 4OLWL 3U4EA 3HZMA 2Z92B 3S5LA 1VHPA 4MXQD 1NFKA 1LO2L 4MAYA 4LCIL 5FGBA 1N3NA 5I8OL 4P5KB 3QG7H 2R8SL 2EECA 5GZOD 4FFWD 3O3AA 1HDMB 4KK6C 1INQB 2VTFA 4E5XA 4OLYL 4YFEA 3WHE0 3AAZB 1HILB 5BVJB 5GGUA 4J23A 3LDBB 1MJUH 5C3TA 4FZ8H 5HPOA 4PJ9C 1RHHA 4KAQL 2BHYA 3ARRA 4MX7A 1IGFL 1FSKC 3IB4A 1X4ZA 2DJSA 4QCIA 1KBGH 3FO0H 1BEYH 2ZPKL 4HUMB 1BJ8A 4HWBL 4M7ZB 5EZIL 3C6LD 2NY6D 4NKIL 4L9LA 1A6ZA 5FK9A 4LSRH 2IAMD 3DVFA 2B5IC 5HGBB 3UBXI 2CRYA 2GJ6B 5C0GB 1HOCA 3LQAL 4QRQB 5DEGB 5D1ZB 1QUNA 4HT1H 4JGMA 2AJVH 2G5BB 2HT2C 4Q0XH 1KPUA 2Q1EA 5JW5A 1U8PA 5E8PB 5BZDB 3MLTA 3ULSB 3G5VB 3G6JE 5DJ8A 3ILQC 3ALXA 4KTEL 2E7CA 1V7ML 4PYGA 1WBXA 1JVKA 5DMIH 2R2BB 1C7SA 1EHLH 1I1FB 1U8OB 2CKBL 3CZJA 1P1ZA 2BOBB 1MRDH 4MVBC 25C8L 4U1GB 2A9ML 2P5EB 4JFFD 5DDHA 2ZCLH 2UUDK 1YDPA 4YHKL 4NBXB 43C9A 2J6EL 4PJEE 3PGFL 4UB0L 4XVJH 1ADQL 4M03A 1H3PL 1PZ5B 3PGDA 4XAKE 5JW4Q 1PKOA 4JFDD 4L8SA 4S0TD 5TQ2L 3SKMB 3MJ9H 3EDEA 2OJEB 3V7AG 1LK3H 1NGYB 3RVUC 2B7DT 5E8EA 3V8CA 2X5PA 2OMNA 1KCKA 4KTDH 5IROA 1BBJA 3GSNH 1S5HA 2YUWA 3VXRB 5J6HB 4TPRH 1EIBA 1NBVH 4AL8H 2B4CC 4JM4L 1FNLA 2YD5A 1NC2D 4WI8A 3TLRA 4CN4A 5HHNB 5T5NG 2LAGB 3C2AL 3BKYH 4AM0B 4Q9RL 1WTGT 4Y1AB 3GBML 3MXVL 2EEDA 1E0OB 3IS1X 1IGCL 4F33B 4L5FH 2VRAA 3MJ7A 4M3KB 1FVDB 3W11C 2V17L 4YBQD 2JCCE 2Y5TA 4PRIE 1CWVA 5D7LB 1L7IL 5DC9B 3BHBB 1RK0B 1E27B 3FQUB 1B0RA 4BFEA 2FATL 4RWYH 3VGFA 1KJVB 3T3PE 4XRCB 1X4XA 3QAZB 5KJRL 1OW0A 4O5LH 3TN0A 1UEMA 5CWSB 5KS9A 3BW9B 5EBLB 4YHNA 4IDLA 4UOW1 1EO8H 3BAEH 3WXWL 4XP6H 1JGUL 3U30C 5C0JA 32C2B 1JV5A 4BJLA 4KHXL 3V7MA 4HLZG 2F19L 2AI0H 3WIHA 1J9CT 1NFDB 4NN7C 1C16B 1MEXH 4G43B 2W0FA 1X6LA 3RGHA 4D3CL 1AJ7L 2R0KH 3DX8A 4IRSD 4G3YL 4CN6A 1A6TA 3KPLA 3BH9B 4RAVB 4B41A 4DKEH 1CDUA 4PRNA 4Y0GA 1CS6A 5BZWB 2HT2D 4OCXL 3PNWA 3TZVB 1FIGL 4TVPD 5I8EA 3O45B 3D39D 4D2NA 3RZCA 4YHOH 4XMKH 3ZDYF 1NUDA 2BCKB 1A7QH 4YWGH 3QCVL 3KXFA 3OKEB 4NNYA 2A77H 1TJIL 3OKNB 4EIGB 3BISA 5SX5K 5HDQH 2RB8A 4C59B 5B22A 4I13B 2I5YL 5DD5H 1BIHA 5I8CB 5DEFB 4GLRH 2OL3B 2HN7B 3VI4F 1PQZA 2ZOKB 5L6YH 3MV8B 3I50L 5JZ7D 4HKJA 1VKXB 3QZWA 1OTTD 3Q0HA 4UQ2A 2IH1B 4AMKH 1YEGH 4OGYH 4AH2A 4E41E 5C92A 3KYOA 3L3OA 4UT7L 3TO4B 1BLNA 4P3DB 4RMUA 4EI5C 1RUQL 5IESH 3IDGB 1UKQA 3MXWL 5I16B 2NLJA 3V4PL 5DJAA 5A16A 2UYLB 1GSMA 2E9BA 2WAHA 3HA0A 3NIFE 1A14L 1R6VA 3AU1B 5KSAA 5DT1L 5CLTA 5DLML 2A2QT 1EXUA 5IEHA 3EOBB 4OT1L 4HCRL 1LO4L 1RJYA 3JV4A 4U1SA 3IKKA 4IMKC 1HYRC 4LLWB 3MQIA 1U58A 2E6JA 2W0KA 4I0KA 5JO5A 5I19L 3C8KA 4P3CL 5E9DE 4DZBB 3IAQA 3VG9B 4KZEH 5KVDL 4M48H 3QBTB 1HHJA 1I8KA 3AMKA 2DQCH 1IZKA 3H9ZA 3ZYJA 4LIQL 5C6TL 3FQWA 3R0MA 3FFCA 2F74B 5DHYA 3VWJA 4J1UB 4FFZL 5F9JA 3LIZH 1UM4L 1BVKA 2EDBA 1YN6B 2EICA 4NN5B 3B2UD 2ICWI 2VXQH 2A1WH 2I07B 2DWEA 5KZCD 1JYNA 3UJIH 2V2TB 2IANA 2CSPA 1WZ1H 4ZAKD 2UUDH 1S7XB 4MYWB 4QT5B 1E4WH 4X98B 1IEHA 1DE4A 1J8HA 4U1KB 2F15A 1H15B 3O6MH 1T83A 1AE6H 5HI5C 3WXVL 3SEPA 5ADPL 5I73C 1FNAA 4O51A 1YMHA 1YJDH 5BRZA 4J2XA 1HKLH 5HI3D 3LB6C 2APBA 1KTRL 3HB3C 4DCQB 5GRUL 1WBYA 2OP4L 1CLYL 4M5YL 2VSDA 5C70A 4M7LH 4Y5XB 1QSED 3S88L 4PP2A 4WFGD 4MJIE 5FGBC 1UWGH 2LU7A 4NHCH 4OFIA 5DHVH 1RVFL 3SQBA 1HHKB 3DV6B 2GW5A 4WI2A 5I0DA 1T0MA 1NFDF 1KELL 4GW1A 1FGVL 5IMKB 3REVA 1UVQA 1N0XL 1C5CL 4RX4D 4EQ3A 1AGCA 1J0YA 2AK4B 2IPKA 5F7DB 2CMRH 1U95A 3NCYS 3CC5A 3QUYB 4W70A 3DVGA 5LCVH 3O4LA 1R3HA 3F7VA 3ZZ1A 3PWPB 2E7BA 3QT2A 4OIBA 5EN2B 2FRGP 5FHAL 3D3VE 3O6KH 3QWRA 4L9LC 4N5UA 4PRPE 3TBTA 4DOHB 1AO7B 2HTKD 4LSUL 2YPLB 1JUFA 4YQXH 2PF6A 4LASH 4XP1L 4FQCH 4XWGH 3MODL 5IB2B 3LEXB 1X5ZA 2A6IA 3L7EA 3QHFL 4TN9A 5D7SH 2MPAL 3EDFA 4OCNC 3VXUD 1PJ9A 2DQEL 4HF5L 3R06A 3SGEH 4WNQA 3KWWB 4FP8H 4BUHA 2XTJE 4M1GH 1RZ7L 5MHSE 2Y07L 3SPVB 4NKMA 2DTSA 5L9DH 4J3OC 4JY4B 3STBA 2CDFB 3VXMD 6FABH 1N64L 3HMXA 2A9NL 4R0LB 5ENWA 2YD2A 3P4MA 1J1PL 1QBMH 4P99A 4H88H 3RGVD 2ZCKL 1U92A 2DJUA 1U91A 4L4VD 4P2QD 4P5TB 4CGTA 3MRLB 1L7TL 4HLZH 3TA3A 4CADB 4X5WA 4Z77A 1INEH 1MAMH 2X4PB 2A6JA 4X83A 4HS3B 5SX5H 3MGOB 5IK3B 4K7FB 3P4NA 5DQ9A 4M7LT 4Z7VB 2CIKB 3Q6FA 1YA5A 1QFHA 3SY0A 4Y5VA 1J8KA 4G9DA 3OJVC 4CL7A 2HG5B 1KB5L 1XR9B 3KPOA 4LAQL 4XX1E 3DPBA 3O9WC 4LCWA 3UMTA 5C0AD 2R0ZL 2NXYB 1VA9A 3MRRB 1D5XA 3H3PL 3WHXB 4LGSB 3RUGA 1GYAA 1PG7H 3HB3D 3DRQB 5F88B 4FQJL 1UZ8B 1V3LA 2E9JA 2EO9A 3LEVL 4M5ZL 5HHOA 4YR6A 2JIXA 3CXDL 5GGQL 1RZ8A 3MFFB 3STLA 3GHEH 1IAIM 4LRNH 2Y23A 4G7YL 4F3FA 4XB8A 2IALA 5AYUL 3BGMA 1NFIA 5DVKA 1ZT4A 3TN0C 1JK8B 2X40A 3WE6B 1NGXA 4FFVC 1TQBC 4CVXB 1FZOA 2EDJA 2F8XC 1C08B 2OQJA 3K0WA 1WWAX 1YC8A 1HH6B 1ZVSA 4LPTA 5JHDB 3ARQA 5JNYB 2CLVB 5FUOL 4EUPB 1QHOA 1JJUA 4UAOC 2V5MA 1DUZB 3WN5A 2X4UA 2Y06H 2GFBA 4QRSA 5CAYB 3KPRB 3L9RA 4K3EH 2WUCL 2VE6A 3QXDB 2DQHH 5HDBE 1HXMB 4Z78A 3GDBA 5F6HJ 3B9KA 1JGVL 2EO1A 4ALAH 3VWKD 3SCMA 3UYRL 4KDWA 4NT6B 1JPFB 4YXHL 4C56A 3WIIL 5CD5C 3U7AA 4EXKA 1P7QD 4UQ3A 1OGAB 1A7PH 5IB5A 3INUH 4CMMB 2QQQA 1NMBH 3B4NA 5T1DH 2GUOB 3MBXH 2YMXL 4WV1B 3PQYD 1YYLL 3NZHL 1R3LB 2ICES 1XF2A 3SJVE 3VD3A 3EYVA 2E5EA 3UTPE 1IAIL 3DXAB 3WV0A 3HMWL 3QQ3B 1R3JB 3NIDE 1FNFA 2YUXA 4JB9H 4PJDB 4RZCB 3ULVF 5FYLH 5FA3B 1FO0B 4RGMC 2UZIL 4KRMB 4R7NA 2WUBH 1JFQL 2HTLC 4MJ6B 4WTWA 4ZUVA 4KVNH 5IKCA 5L7XH 3CVHA 5DUPL 4Z7OF 3O9WD 3FQRB 2EDQA 1BOGA 1I9EA 1OAUH 1Q9LA 5KSUB 4FZEL 4X7FC 5C0NC 3QA3A 5CJ5A 4HG4K 5KSAC 4HUVA 1LE5B 2IJ0C 4LP4A 4PJXA 5CP3H 3JTTA 3TJHC 4WRLA 1Z9SA 3SKNA 2COQA 2GY5A 1II4E 1N5AA 2GQHA 4G6AD 3PWJA 5DMYA 4P9HL 3BQUD 2H32B 4J3TA 3UTSE 5SWZD 1CGSL 2NY4C 2X4OB 5KW9H 4Z7VF 1A1NB 2G2RA 3ZTNH 1FRGH 1XGPA 1IGML 5CJBA 5JPMB 1R0AL 4TSBL 3CFJB 4BZ2H 1G7PB 4MSWA 1NGWB 4MB5A 1FCGA 3MC0A 1UCBH 4GKSA 3KYKL 4ODXB 5BMFL 5D2LB 3GUTA 4PBXA 2ICEB 4LSVH 4M1DH 5AEAA 4FQLL 4BM7A 5E00B 4DKAA 1XGRB 1GGUA 4WTXA 1AC6A 4XI5C 3CIQA 2DBJA 3ZT5A 1ONQB 4UT6L 3TGXA 4GRWB 5FYKE 1Z5LA 1WISA 1JWMB 5E6YA 1EK3A 1P4IH 2C1PA 4AEHL 1RJZA 1ZT7A 3LKRB 2DLFL 2ITDA 5HVGB 2ZG3A 1S3KH 2C26A 1T83C 3UPAA 2X89D 3WFBH 3GB7B 4K23L 3C6LB 2NY6B 3T8XA 3MLVH 3TYFB 1G7JB 1FDLL 4J6RL 1G9NL 3EOYG 2IAMB 1JHTA 5C6PB 5ECJE 4NQUA 4CVZA 4EI6A 5H37G 3PL6A 5CD5D 3IFPA 4I3RH 2P8LA 5IHZB 4RAUA 2J8OA 4FFYL 3I2CL 5D2NB 3QIUA 5EIIB 4HUNB 4WCYH 3H7LA 2VIRA 4LVOB 3ISWA 1I1AD 4U1LA 4ODTL 3R4DA 3KG5A 3EW3B 4LBEA 4KFZC 3MNVB 2VZOA 4AQ1B 1WT5A 2H8PA 3FO9B 1VFAB 1AP2A 3QDJA 1AGEB 2Q76B 3FONA 1JWSB 5A1AA 5GHWH 1A0QL 2O5YL 1JNNL 4JPVH 2FD6H 1EJ6A 1D7FA 1AGDB 1EV2E 3OZ9H 4JO1H 4LEOB 5IB3B 4JFDB 1EDQA 3TBWA 3DGGB 3D0VB 2AJYH 3I3DA 1FC2D 1ZT1B 3BPCB 3FOLB 4NQSA 1YEDA 4KH2A 4E41A 1H3WM 7CGTA 1IT9L 1EEZB 3DUHA 3CFDA 5JR1L 2IBZX 3VFTA 4NJAH 1GOFA 4N0RA 3VMNA 4XX1G 5FYKU 4PJDF 2NY4D 3IKCA 3TO2B 5J11B 3GSVB 2D7NA 4A6YH 3SE9H 5KTEL 4KK9C 5B39B 5HYEA 5GJSH 3I9GH 3VRJA 4HWBA 3MRBB 4NBZB 5CHNB 2BVPB 5FF6A 4H8WL 1UZ6F 5IGXH 5ILTL 1BGXH 5E5RB 3TIEB 2IPTH 4QHKI 4CNIB 4S2SB 4GG6E 4X7TB 3U1SH 2DQJL 3AVEA 4OIIL 2FECL 1YUHA 3D25B 4Y5VC 4V2BA 1X5LA 4NZRH 2ZJSH 3RWGB 1MCWM 3BDXA 4OQTL 4S1SH 1H3GA 5EUOF 1RIHL 3VXPB 1Y0LA 4XH2A 1XF4A 2W60B 3S34L 2ZSVB 2DQIL 2X1XR 2Y36H 1EMTH 2GSGB 4Z9KB 5HGHB 3MV7D 5ACLA 1W72H 4IRSB 3Q48A 4QOKA 5D2LF 4OAWA 3QRGH 4Z7UE 1ADQA 3SGKA 3L6FA 3MLWH 4LK4A 4P4RB 4OKDA 4PB9H 1MJ8H 4LVNC 4KJPC 2AGJH 3D39B 4GRWF 1FG2A 3TBYB 2ZWLT 4ZOAA 4NFCA 1HWGB 4I5BA 2NNAA 5D7JD 3IJSA 3F5WB 4JFYA 2R15A 4LHUG 1YMMA 5AUMB 4MNHA 4NC0B 5BOPA 1DDHB 3IGAA 4JE4B 3B9VA 1DZBA 3OWEA 2EYRB 3NFNA 3I6GB 1OTSC 2F5BH 2P47B 3E0GA 3Q3GB 2RAMA 3R1GL 5C86A 3HC0B 43CAA 3C5ZD 1KN4L 1KTDB 2FIKB 3WN5C 5KVMC 1FYTD 3EIFA 1TQCB 4QXUL 1S9KC 5JW3H 5LBSH 1DBKL 5TGBB 1CGTA 1XCQA 3B5GA 4L4TD 2LTQC 3B9KC 5HHQB 3ABZA 3PV6B 1L0QA 5GZNC 3U0WH 1VFUA 3IXTA 5ALCH 3SCMC 1UXSA 1VGEH 1HN1A 4N8VB 1UH3A 3FB5A 1OARH 3MREA 4GSDH 3D3VA 4KKAD 4YXKL 4XPTH 2V2XB 1D5IL 1F90H 3QNZB 1EAPA 2AJXL 4XNXH 1WAAF 3HHRB 4O02H 4Y16B 1ED3A 3O2WL 4HJGA 3QR2A 3UP1A 3IJYB 4MNQD 4NO2A 4V1DD 4YEFA 1G7MB 4PJIE 1IEAB 1ND0A 1RZFH 3HAEG 4IRZL 4QTHB 3F12A 4DZ8A 4PIRF 5DTFA 3VFVB 1ITBB 2GCYA 1G7LA 4YIQA 1IARB 2VR5A 3K2UL 4HKZB 4OCRH 3BEWB 5TF1H 4M62H 1A1MB 3OR7B 5F7FA 5L0QC 1PD6A 1CYGA 2XA8L 2X05A 3OJDA 3GKWH 1U3YA 3GMOB 2HVJB 1IAKB 1U36A 4XPBL 4JZJB 1K3IA 4QHLB 3ZYZA 4NQTA 1DLHA 3HZVB 4ZAKB 2DMCA 3OPZH 5H37H 1P53A 5ESAA 3DLQR 3PP3K 4LHJB 3ROOB 2E7HA 3EJJX 2DQTL 1XF5B 1VGKA 1D3CA 2IEPA 4NQED 4OZFH 5I1KL 1IKFH 1T04B 3EO0B 4AT6B 4HBCL 4IJ3B 3LQZA 4O58L 1CFTA 2W38A 4NSKB 1CFQB 3JWDC 3NOIA 3NVQA 1QBLH 2FEEL 4XMLL 3FTGA 5EOTB 4K3JL 1MQ8A 3SE4A 1CXFA 3QG6A 1BWWA 1E4XH 3DMMD 3EFFA 5IB1B 4TSAH 4LPWA 1PEZA 3EYSH 1T7WA 1FZKB 4QTIH 4M6AA 4RGOL 4JR9H 3QEQA 1L9MA 4N8CH 4FQXC 5C0DA 2K7PA 2Z35A 3VFOB 3L3IB 1ZSDA 2VDRL 3NH7L 2HWZL 1X5HA 3GBLA 4HCRA 1MIEH 1AQKH 3GMPA 3KR3H 3CMOH 1UM5H 2VDQL 3SO3C 1MCPH 3X12B 5EB9A 4R8WH 4YC2C 4P3WA 4NQDE 2D7TL 5FECA 3BP5A 3L95B 4AG4L 1YYML 4JANB 1KIQA 3SGDI 2C1OA 3QIWA 1WITA 1IILE 5C1MB 2YSSB 1BZ9A 2BY1A 2VDKH 4P49A 4PFEA 3VXUB 3TNNB 5C0FA 2AV7A 3QIUC 2E9WA 3FZUD 4UBDD 1OVZA 3LKPB 4P57B 4NO0B 4YBLC 2P45B 2Z93A 1QNZH 3NTCL 1UB5A 3H7BA 2RFXB 2LQRA 1PSKL 3LMJH 3MLXH 5F7YC 4C58B 1EEYB 4ZFGL 2PN5A 1U42A 1HEZB 1WT5C 5DJ2B 1CE1H 1OCWH 3L3KA 1DL7H 1AKJD 1KIUA 4PRDA 3RGVB 5EH1A 4L4VB 4P2QB 4MXVF 4ZSOB 3B3IA 3DARA 4FXKA 1NJ9A 1IQWL 3OAZK 2EH7L 1KLUB 4XMPL 2J88L 5EU3B 1MPAL 3FB6B 5JDSB 1LO5A 3SJVA 4KTYA 3O6FA 3K46A 2DLTA 5F1KC 3RWDB 1DQMH 1CXLA 1CFNA 3O11B 1G9EA 1YPZB 4WUKH 1KXTB 5C0AB 4PJ5A 2V5YA 3SDXE 1D6VH 2CJUH 4XGZB 3DV4A 4HIXL 1BD2A 3QCUH 2OJZH 3QEUA 1J12A 3QJFA 2HVKB 1Y18A 1BECA 1NEZG 1CF8H 2I9LB 4H5SA 3ZL4L 2I60L 4QXGH 3WFCH 1JTPA 5DMJB 1OD7A 4OSUL 3TM6A 4XP4L 1KCSL 1RIUH 4XVSH 1N26A 1YN7A 4YNYB 1UT9A 1Q72L 4S11A 4L3AA 1CD0A 1TPXC 2EDTA 1MREH 3IRPX 3DVNB 4RBPK 2DYPA 4HLJA 4Q6IB 4FQXD 4G6FD 3GRWL 2X1OA 1GXEA 3TH4T 1Z9OA 4PRID 3OGCB 3S37X 1F4XL 2HRPL 1OGTA 4GAJL 2BZDA 4R4ND 1CE6A 3L3DB 5CD3B 4UINL 4RFEA 2JELH 3U36A 2DQFA 2KQMA 2VH5H 1WFNA 2P5WA 1SYVA 2XQBH 1PX3A 3QXUA 1T1ZB 1CTNA 1KC5H 3D87B 3VRLF 3MROA 3V6FA 3LEYL 2A74A 15C8L 4FRWA 2NY5C 1UJ3A 5IVZA 3MA7B 2Q7NA 3OAUL 3PP3H 3AROA 5IBTL 4HPYH 1DQJA 1WIPA 2WINB 4LLUA 5E2UH 4G6KH 5I75C 2EC9T 3SGKC 4JO4L 4P46A 5DUBB 1QBAA 4ZD3L 1MLBB 3HAEH 1TZGL 4W4NA 3RWIA 3VWKB 4UI2A 1WVZA 2IF7A 4F80A 4CBPA 3GSNB 5GGTA 2FX7H 1KB5A 3SDYL 1GJIA 1YQVH 4NQVB 5IQ9B 1P7QB 4JN1L 5FM4A 2DKUA 3O0RH 5BV7C 1NCWH 1KFAH 3PQYB 5KSVB 3T0EA 5DK0A 5HJ3B 3ZE2E 4DGIH 3LS4H 2PW2B 4I18C 3P4OB 4LF3A 3QUML 4GQ9L 1AGBA 3IDYC 1U8KB 1CLZL 1L0YA 4NNXB 3X17A 3OKMA 4YUEL 2EDDA 1X5XA 2NX5A 3SKOB 3U9UA 5FYKH 1K3ZA 2FDBP 3BD5A 1M1SA 1LEKA 2MHAB 1GGIH 4K3DL 1T20B 2AK1H 3Q1SL 4I77H 1G7HB 3PABB 1U2HA 4YPJA 4HJ0C 2ICCA 1AFVL 1GIGH 4ONGH 4M9OA 4XNMB 4BUGA 5IMMB 3TNMB 2H1PL 4HWEH 3ET9F 5CEXB 3MCKA 3ARPA 4Y2DA 3P0YL 4NFBA 1FE8H 2Z91A 3DSFL 3U9PH 3NABL 1EVUA 3TIDA 2BSRB 3CXHJ 3GJFA 3L5IA 5HYSG 1QSZA 2YPVL 2D31A 3CDGB 1KT2B 5F7LB 3BQUB 5F6IB 4YO0A 1VPOH 3CLEH 4JG1L 2BSED 5SWZB 4MGXA 3RPIA 4ZS7H 1CGWA 4PRBA 1R3IL 3HNSL 3KJ6L 2XTJC 4JKWA 3BPOB 1BQHB 1BX2A 1NCTA 3IDIA 4OF3A 1J5OH 4OCSH 4MQXD 5CBEB 2HKFL 1U0QA 2DWDA 4KU1A 4Y5YA 4NPYB 4OLVH 4KJYA 4F7TA 1QO3A 1N6QL 4NC2B 1YPZF 3MACL 4F37F 3D2UB 5EU6A 4LP5A 2DLHA 5D71L 2A38A 3ES6B 1A6PA 5GGVH 3OAZH 1S7SB 2C3HA 5CFHA 4NCC2 1N0LA 3KYAA 4F7EB 2VR9A 2XKNB 1K8IB 3BKJH 3T2NL 4PG2A 3DRTB 3N1FC 1FJ1B 3QFJD 1JGLL 4GG6A 2VYRE 4HIHB 2OR9L 1KIRA 2D4DA 4LSTH 1YEEL 4ZPTA 5D1XD 5ERWB 1EUTA 2ZNWA 2J2ZA 2HT3C 2PO6A 3BE1L 4MDIA 4WJ5A 4UTAL 4K9EL 1YEFL 1TITA 5ANME 4YHZL 1NCNA 1SM3L 3UJJH 3SE4C 4U4BA 3CZFA 5F96H 2MOVA 4LRIC 4FG6C 3KGRA 2EC8A 1I3GH 3QUZA 4HGMA 4KK5C 3T4AB 2OMBA 3VI4E 3BRFA 4ESKA 2LFGA 1OTUD 2R4RL 4JZOB 2WM0A 1JNHB 3GMMA 3QPXL 5HHVH 1I1AB 2OS7A 3KYNB 2AW2A 4MA1B 3RX5A 2WP3O 4RDQG 5I1CL 4RBPH 3M17A 3TT3H 5LGHL 3WFDL 1KYOK 1Q0XL 3BWUC 4QY8B 1V3JA 5E2WH 4XBEH 4G6JH 3TVMA 1EUUA 3VXSA 1UADC 1QG3A 1UYWH 4LLAA 4HV8B 1HH9B 1OAYL 4LEXH 1P5UA 3LKNB 4PY8I 4H0HB 4PLKC 2F53E 2DM2A 3MMEB 4OCWH 3QIWC 2DIJA 1K4DA 3BEVA 4JRXD 1R5IA 2OTWA 2ENSA 3WIHH 4E0RB 2J3SA 2P5EE 1I7RA 3ARDD 3OKKA 4D0CB 3T1WA 3QCTL 4WTZA 5D5ME 3SKJL 5SV3A 4HULB 1CICD 4PRPD 2BVEA 2FWOB 1IAOA 1B2WL 4OZIA 4IOFC 4WU5A 3LH2H 4RFOL 2XKUA 5AWNH 5HYJA 4Y4KD 2Q7YA 3V6OA 5I30H 3QNYA 3MRIA 3T1FA 3UJTL 2MNUA 4C54A 4NKDA 3O6LL 3PWVB 2YXMA 3VXRE 3N9GH 4WHCA 4TSCH 4GJTB 3HFMH 3FN9A 5I18L 3GMLB 2DQGL 2KBGA 2JB5L 2CH8A 4JFXB 3ZKXC 2VLJB 2FSEB 4XNQB 3MLSH 3DVIA 4Y1AE 2YC1A 4FQIL 2NXZD 3MPCA 4GKOA 1RJLA 1T6VN 5DHVB 4WEBL 5TH2A 4PJAB 2YHGA 5J6GB 3BO8B 2RCSL 3JSSA 3FOMB 3CH1B 5D7LE 2ICWB 1NBQA 1A6UL 2D2OA 3HE7A 3L3GB 5MEPB 4GQPH 5GS0L 4K94C 4NJ9H 5A2FA 2GSIA 1JF6A 2LABA 2R1WB 1MFBH 5J89A 4E42A 1FH5L 2VL5A 2Z9TA 1RK1B 4CVUA 1KLGB 2V7NB 3CPLB 3MV7B 3VFNA 1R5VA 5F44A 2BY0A 1HNFA 1A6VH 4RMWA 5EOCL 4Y4FA 5FKAA 1FFNA 1F6LL 4J3VA 4XP5L 4FG6D 1NFDE 4L8DA 3S35L 3WS3B 1S7VB 2A6DA 3ARGD 4KK5D 3CVIL 2VQ1A 5ITFA 1ZEAL 4P2RA 4TUJB 4IOIB 4ONOA 4DGYH 1T4KA 4QF1A 3ZMRA 4CUCA 2WLZA 3BXNA 5I66A 5D7JB 2VR4A 4XPGL 4X9BA 1NBYA 5E2VL 5HVWA 5I1LB 1I1RA 3RIFK 5BS0A 2HMIC 3HLAA 2BDNL 3KLAB 1QSFB 4OFKA 5F21B 2UWEB 4R96B 4S1DD 4NM8L 1CFBA 2FBJH 3BWAA 4XNYH 3RY6C 4ZTOL 2YZ8A 3VFSA 4I3GA 4UDTA 3C5ZB 4FABL 1U8JB 4GAYA 3OKDB 1FYTB 1HHGB 1MHEB 5C0RL 1ES0B 4KZDH 3JZ7A 4K8RH 1FN4B 1UJ3C 2JE8A 3ARBD 3OXRB 5CIPH 2Q3AA 3WLBA 2YWYA 5E8OB 3LHPH 3C60D 1SJHB 4P46C 2RBLA 4DAGL 2R1XA 5DRZA 4NRYA 1WQVT 4ODSL 4GG8B 4OI9A 1Q9WA 2B0SL 3OXSA 5DMKA 3CSPA 1TJHH 2VAAA 2ZUYA 1QLRB 4GRLA 4JHAL 4OQTA 5CMAB 1CBVH 1AD0A 4M61A 1BFTA 5SWSA 4HC1H 3EBAA 5EO1A 1GOHA 2ADIA 4HMEA 1DEDA 5C2UB 1U8NA 4LHUD 4NUJA 3W0WD 2ZZUT 3GO1L 3PHOB 5C2BH 1F2XK 1VCAA 3ZKNC 4ZUWB 4KRNA 1U3HA 4MNQB 4V1DB 2F58L 3FRUA 4XCYA 1T2QL 3QH3B 4F7CA 2YPKA 1BQLL 1PG7X 5HI4C 2CDEA 1U41A 1WLHA 3ALPA 1FBIH 4TQEL 2HFGL 4NOFA 5CP7B 4KKBD 5JOFB 1LDSA 3QO0B 1A9BB 5DD3L 2FL5B 1ZA6B 1ZWIA 3FHAA 3K80A 3KPQB 5FYJE 1D9KC 2DM3A 1S5IL 2APXA 4NM4L 5IVXF 5J8OA 4GBXA 4G9FE 1IGJB 5GSVA 3BDYL 4HX1B 4PJFB 4QXTA 3NGBC 2OCFD 5IIEB 3MLRH 1AXSA 1FNGB 4K71C 5E99L 1GGCL 3TJEH 2WANA 3GGWB 3S4SG 1DFBH 5HD8C 1MCRA 5IMOB 3KLHC 1GH7A 4H1LA 3MJ6A 5E6ID 5J56B 3IVKB 5F7WC 4QRPE 4YHPB 4KPHL 4HFUL 3HZYA 1UA6L 5CZXC 2VLME 3MUZ1 2VNCA 3LZFL 3W9EB 2R29H 2B1HL 3BN9D 3DMMB 5AAMA 4RFNC 1QQDA 2NR6C 1RZJL 1OP5K 3VMOA 3HMXH 4Z0XA 3W9DB 5T3XE 1K4CB 1DLFH 1KG0A 3WKML 1HI6B 3D69B 1MJJB 1HSAB 3X14B 5GRVK 3UTTB 3V0VB 3UZEA 5E08H 5ICXA 3AREA 2IBZY 4QHKJ 5C0BB 4WWKB 4MAYD 4M6OH 4M7KL 4ZXBB 4MXWH 1QOKA 4PG2C 1KJMA 2EDEA 3IYLW 1EX0A 2JJWA 5FYKD 4XBGA 3H0TA 4LDLB 4PV9B 3FRPG 1H8NA 2H2PC 4UILL 1Q8MA 1F58L 1LO0L 3A6OA 2AK4E 2PO6C 3E6HB 4LLDB 3QDMA 1HINH 3BP4A 5IHLB 1FC1A 5CEZL 3QNXB 4KXZI 1IKNA 2CXKA 2OZ4L 4GUPA 3UYPA 3PWPE 2GT9B 4KK8D 3U46B 2VB5A 4NWTH 3B43A 3HG1A 3QUZC 3RL2A 4PV8A 4YLQT 3TCLA 4ZDHA 4DVRL 5K9KB 2V5SA 5HVFB 4Z95L 5AZEL 3W2DH 1AO7E 2WZPD 4NWUH 3OBAA 1B4JH 4AIZA 3ULVE 3ZKND 5DK2A 3G9VA 4PJHE 3K8LA 2AQ2A 4N0FA 4O2FA 3QQ9C 2FCBA 2HA1A 1EAJA 3G6JB 3KLSA 1DUYB 1INDL 5DJYA 3TVMC 5AAWA 4BFGA 1AKJB 3MRKA 1I3VA 3P77B 4P9HC 4OD1H 2ZOLB 4ODVH 4UOJA 4CW1A 1YNTB 1EGJL 1ZXQA 2DTML 4ORGB 2QQKL 5T1LB 1M7DB 4U3XA 3FT4B 4I48A 1D9KD 1I9RL 5F1OB 1W2KT 3QXAB 4MA3A 1NLBH 1JRHI 5CILH 5I1JH 1CFVH 1WUNT 3EYOA 4PJEB 4Q9QH 1RZGB 2IFFL 1U8MA 3D6GA 4WFFE 3FO2A 4HUXB 2EZ0D 4W68A 4Z7VE 2DL9A 1FFOB 4RQQB 5BW7A 1QKZL 4NO5A 5FHBL 5F1IB 1EHNA 1T3FA 3KLHD 1H3UA 3T77B 4HEME 1TZHA 3V6OC 2NY0D 4MQ7B 5DD6A 1KGCD 5JQ6H 4PP1C 4W81A 3JBG7 2FX8H 2DMBA 1P6AB 2B39A 3G04A 3CX5J 1FGNH 2WIMA 3EOTH 1H3VA 1D5BB 3MRNA 3KNBB 5E0QA 1AGFA 5TPWH 3BIKB 3IDNB 3VGAB 2F54D 1FLRH 4G6FB 3BSZH 5CSGA 1HCVA 2JCCB 4PJFF 4PRIB 3SDCD 2LVEA 4X0KA 5ESQB 5JIIA 1MCLA 4U1MB 3ZE1F 3U48A 5IFAH 3V5DB 3HE7C 4BH8B 2YOCA 1N2RB 1JRHH 2YKLL 5I74C 4AEIL 4M00A 2OTUB 5FO9B 4ODHH 1JIBA 1DEEA 3IETA 1L9NA 1AY1H 1U6AL 4TYUA 1MRCL 4MB4A 3CVHH 1P7HL 2XZQH 5EBWB 2Z92A 1RMFL 2XRAL 2X4TB 3KPSB 5DRXA 5K59E 1FL3B 4EXPX 4P5KA 1RQ5A 3RWFA 3TT1H 1RUAL 1HDMA 4R26H 5GRWA 3SO5A 4K2UL 2MFNA 2MKLC 5FUZH 4OIAA 4ZQKB 1HILA 5BVJA 3D48R 4M7JL 3NACH 4UV4H 4MZ3A 2W0LA 5IQ7H 2BFVH 3UC0L 3D85D 1HIML 4ZNEE 4XVTL 4GMSH 2Y7QA 4F2MA 2R56H 2XZAH 2XFXB 4A6YB 1QLEH 3P30L 2P24B 5BJTB 3UTZB 1OGAE 4Z8FL 3T2PA 3WNOA 4IRJD 2OK0H 1S7QB 2GJ6A 1I7ZB 5C0GA 2PYED 4QRQA 5D1ZA 5DEGA 1ZANL 2G5BA 1TCMA 1HQRB 2HYMA 3DXAE 1XIWD 4HQQH 1LE9B 1T7XA 2I24N 3ZLQC 4ZUTA 5E8PA 5BZDA 4LSSH 4F7MB 3ULSA 3LRSB 3HC4H 3GRWA 1VACB 4PJDE 5A43C 1NCCL 4MD5B 2DQDH 1FNEB 2R2BA 4UIMA 2HJKA 4JFZH 3G6JF 4EZMA 4QRUB 3TYGL 5J7CC 2BOBA 4QNPF 3WIFA 3HE6A 1UZ6E 4DEPB 2P5EA 5D96B 3U2SB 2LE9A 2IMNA 1U3HC 3DO7B 4U3CA 4F9LA 2QQNL 2D7OA 4XCCL 5DJZB 4TVPL 1I9IL 5BVPH 3SKMA 1CDHA 1IC5H 5IM7B 3GI8H 1BM3L 4LSQL 4PJEF 5EUOE 4KKNA 2AXJA 2OJEA 2W9DL 1NGYA 1OF2B 4X6BB 1NCAL 1RUMH 3V52L 3VE0B 5DJ0B 3JXAA 4QRTA 5J6HA 2NTFB 3QYCA 5IW6B 4KY1H 1DVFA 1PVHA 3U4BH 1LK2B 3O2VH 3NFPA 1KULA 1PEWA 4U6XA 4GBXC 2EEAA 4Y1AA 2D3VA 4OLWH 5D2LE 2QADD 3STZB 4X8XA 3AFLA 1PAMA 1FVDA 1LO2H 3QFJB 4LCIH 3V8OA 3RDTA 5I8OH 2R8SH 3RA7L 5D7LA 4GRWE 3BHBA 2VDLL 3DOSA 1RK0A 1E27A 2HLFC 3FQUA 4G8GA 4JVUA 4K8RD 5D1XB 1QFUL 4NZUL 4OLYH 4XTRC 4F7PB 5I75B 1KJVA 1J8HD 4XRCA 1HZHL 2JCCF 1JZ3A 5EBLA 2B4CL 3AS0A 4HS6A 1IGFH 4Q2ZB 1MCOL 2W0PA 1BIIB 32C2A 2ZPKH 4P4KA 1EHXA 4HWBH 5EZIH 4NKIH 4U6YB 1W8NA 1C16A 3AREC 4G43A 3RY4A 3U0PA 3IDYB 3MLUL 5CJXA 5FO7A 1A3LL 4KJQC 3HRZB 3LQAH 3BH9A 4UU9B 3N85L 5CEYA 2G75B 2OXGA 1ZMYA 3V6ZB 1U93B 1REIA 4MWFA 4EJ1C 4JO3L 1B9ZA 3O45A 4ELME 4O2CA 2PTTB 4U6VL 1MCWW 4KTEH 2BCKA 5C07E 1GGTA 1V7MH 4NQDD 4ZODA 4ZO6A 4JRXB 5C71A 1WAAE 3OKEA 1PW3A 1IKNC 5F3BA 4PRAB 1M6OB 2E7LC 2HFFB 3RY5A 3ARDB 2CKBH 3M1BB 3TBVB 4P2YA 4PTUB 1CICB 2FZ3A 4PRPB 4L8BB 1DQLL 4O9HH 25C8H 5T1KD 1SY6L 1J88A 2A9MH 1FHGA 4I4WB 3GIVB 5I1DB 5JXED 5IF0B 3WUZA 5DURD 5DEFA 2J6EH 4GKZB 4DJMA 3UAJC 1ADQH 2GTZB 4Y4KB 1H3PH 3MV8A 4JFED 3LKSB 5MP6L 2XN9B 2QHRL 2IH1A 5TQ2H 4XAWL 3F7PC 3VXQB 3H3KA 2QR0B 4P3DA 3TO4A 4ENEC 4PJ7B 3IDGA 5I16A 2FEDD 3PV7A 5CGYC 3CCHB 2UYLA 1UWXK 1M7IB 3GI9L 4JM4H 3BPNB 3AU1A 2NXZB 1NGZB 5CCKL 4DFHA 2BVOB 3C2AH 4Q9RH 3EUUA 5FB8B 1CGYA 3GBMH 4BH7B 3EOBA 3MXVH 5J12C 3TH2T 1F8TL 4LLWA 1CI5A 1IGCH 1ROWA 3NIFF 2V17H 5D9SB 3RHWF 4DZBA 1DN2A 3CFKB 4OUUB 4NDMB 4WO4D 3JWOC 1JF1A 1L7IH 1RFDL 5BW7C 3NZ8B 4LKCB 4IMLB 2D7PA 4O00A 2F74A 1SJEB 2FATH 4HK3J 4OI7A 2YRZA 5F89B 5KJRH 4XTRD 4PRHD 2NQCA 1YN6A 1RZIA 2R2HB 1U8HB 1N5YL 4H25B 1LP9A 4MNGB 1J87A 4HIEB 1JGUH 5D7KD 2V2TA 5F93C 3ARGB 4KHXH 4NHUB 2F19H 3QB7C 1G6RB 4QT5A 2BSSB 1S78C 1WFTA 4HWZB 5I9QC 4D3CH 4U0RB 1AJ7H 1NUNB 3MO1B 1H15A 4M1CC 4G3YH 3B8SA 5M95B 2N56A 4LQFL 2YK1L 3BP7A 2CDGB 5FOBB 3D18B 4HXBL 4EOWL 1X5YA 4OCXH 4PGDB 1FIGH 3S97C 1QRNE 4N5EC 4TOYL 4JHWL 2ARJA 4ERSL 5JXAL 4XPHL 4LLMB 1B0WA 3VH8A 3FB7B 1TJIH 3H9SD 3ARBB 3HRPA 4OD3L 1Q9OA 1A1OB 1HHKA 3DV6A 3WUWG 4WW2B 4X4YB 2WIIB 5DVOA 5FKPB 3C60B 2I5YH 3E3QE 4X9HA 4X5XB 5IMKA 3VCLB 3LDBC 3G5YB 3C8HA 4HWUA 5DVMA 4OKVB 1UQSB 3I50H 1FVCB 5ETUB 4MQSB 5HDLA 2P1YA 2AK4A 5F7DA 3FO0L 1BEYL 4MXVE 1JWUB 3QUYA 1QEWA 5D1QB 5J1TC 4LHUB 4UT7H 4LSRL 3W0WB 1RUQH 3CK0L 5EN2A 2WV3A 4M7ZC 2JJVA 2E8ZA 1XMWA 3V4PH 4JJ5B 1YEIL 2DQUL 1H3TA 3VFGL 1CG9A 1A64A 4L1HA 3S37L 3ZKXB 2YPLA 4PR5A 1A14H 1DQQB 5DT1H 5AG9A 4OLZL 3LEXA 4X4XA 5D1ZC 1FPTL 1M71B 4XZUB 2FO4B 1TNMA 1IAMA 5I19H 4P3CH 4X5LA 5JOPD 2GAZB 3HUJB 4OBSA 5EC2B 5KVDH 4JLRB 4KVCL 2CUMA 2XWJB 3SPVA 5C6TH 1A6AB 4LIQH 4JY4A 1KJ3H 2CRMA 2RGSA 2LU3A 1MRDL 3HS0B 1IM9D 4FFZH 2VUYA 4PREB 1CD1B 2FJFB 1UM4H 1QP1A 2JB6B 4NO3B 4P5TA 3QXWA 4C4KO 4PJ7F 3MRLA 4U1GC 2IBGA 3HI5L 3DI3B 3CMGA 1BREA 1T0NB 4CMHB 2X4PA 5E6IB 1A5FL 3BOVA 3MGOA 4HS3A 4K7FA 5GS1B 3MJ9L 5F9WB 3KPNA 4F9LC 3SDDD 2PTUA 4JPWH 2AABH 2NTSP 3CU7A 4U05A 1X5IA 3HAEB 4M6MH 1S78D 2HG5A 4X7DC 1G1YA 3V5HA 3WXVH 5ADPH 2IC2A 2ORBL 3FT3B 1OWWA 4JGUA 3QUXD 3ZHDA 5DGQA 1YY8B 4QO1A 1YY9D 3BKYL 3MRRA 4I2XB 1I8LA 4PGBB 4ZUUB 2XKSA 1UWXH 3WHXA 3P11L 4MAYB 1N3NB 5GRUH 2OP4H 1CLYH 4M5YH 3DRQA 5F88A 3HN3A 3WO4B 3KDMB 3TWCL 3C5JB 3S88H 4R4BB 2Y72A 2X4NB 3QO1B 1RVFH 4L3CA 4PTTB 4JVWA 4YDJA 2YA0A 1QFOA 1RY7B 3RL1B 4Y4HC 1MVFA 5GPRA 1KIPB 3O41B 2ENYA 3DETC 3QAZC 5EPMB 1N0XH 1CXHA 1C5CH 4CVXA 4B7IA 1W0YT 5EWIL 1YC7A 1SVCP 1HH6A 5JHDA 2CLVA 4EUPA 1JPTL 4KC3B 4YK4B 4RGNB 1P9MC 2QSVA 1F5WA 3H3BC 5FHAH 3RKPA 1HOCB 1URLA 3KPRA 4U1IA 4JG0L 3GBNL 3M07A 4LSUH 1G9MC 1P7KA 1G0XA 4AIXA 4XP1H 3L3JB 3MODH 3QXDA 4ETQB 1HXMA 2FBOJ 3MLTB 4POUB 2Q8AL 3QHFH 2MPAH 3PHSA 1UJTA 5JA9A 4WW2F 1S9WB 5BQ7B 5ICYB 4HF5H 3IFLL 3D1MC 3TZVC 3BP6B 1WBXB 2R0WL 4NT6A 1JPFA 5TE6L 1ZHNA 4KDVA 5GGSY 2Y07H 1D9KB 4R90L 4LU5L 1N64H 2A9NH 1VEMA 4P2QE 2KH2B 5HDQL 2A6KA 3Q2CA 1OPGH 1J1PH 2D0GA 4WV1A 2ATKA 3ECBB 1YDPB 5DD5L 1FFRA 2VABB 43C9B 2ZCKH 2F53D 2AJZA 5GSRB 1KOAA 4J3XA 5FV2A 2NCMA 3WJLA 1ZV5A 3PGDB 4DKFL 2AV1B 4L8SB 3QQ3A 5A3IC 1R3JA 4LSPL 5F9DC 4PJDA 4RZCA 2NY0B 3MX0A 4MA8L 1WTLA 3OKLA 3S6CA 5FA3A 4A2LA 3BJLA 4HK0B 4NGHL 5E8EB 5KVEL 1YPZE 5DEZA 1NH6A 1KB5H 2ZCHL 4MJ6A 4LAQH 3TO4C 2VMFA 3MRDA 4YXLL 3HUJF 1A2YB 2BNRA 4K9EC 4IS6A 1LO3H 2R0LL 3F7QA 3FQRA 3VFMA 3VXRD 1OLZA 2SEBB 2F54B 1AD9B 4UMGA 5KSUA 2BVTA 2OZ4A 5DD1L 3NIGF 3H3PH 1B88A 2BVQB 5DD0L 2EDOA 3GKZA 3MJ7B 3H42L 5I8KL 3SDCB 2Y5TB 1WIOA 4FQJH 4M5ZH 3LEVH 3RVWD 5LG1A 3CXDH 1B0RB 1XH3B 2H32A 2N1KA 4JGJA 5CKAA 3OSKA 2GI7A 5SV4A 5IFHL 5HHPB 4G7YH 1A1NA 3MOBL 3QDGA 5JPMA 4I0PD 3VDAA 2GKIA 3CFJA 5AYUH 2VXQL 2A1WL 1IZJA 4YHNB 4Y4HD 3EZJB 1G7PA 3R0NA 3PIQA 1NGWA 3T4YB 3DGCR 4NN5C 1EGJA 5C0JB 4ZPVB 5D2LA 4OZ4A 2ICEA 5K9OB 1HXYB 4P23D 5E00A 1XGRA 5J06A 4M93B 5FUOH 2EKSB 3QULB 1ONQA 4KUZL 5HGGS 3DX8B 4H0IA 1QFWI 1A6TB 2FYYB 3KPLB 3VXOB 2JJTA 2RQ8A 4JHZA 3D85B 2WUCH 2OI9B 3GB7A 4TUOB 2LVCA 4R2GC 1I85A 2XG4A 4OD2B 3MRFB 1JGVH 5CZVL 3QEHA 4XCNB 3QWQB 4NYLB 1KJ2L 2X70A 4NIKB 3TYFA 1G7JA 4LCCA 3RTQD 4M7LL 4APQD 3TZVD 2IAMA 4IRJB 4FN0A 4LCYB 4DGVL 4YXHH 2APFA 4ODWB 3WIIH 1FYHB 1J11A 3PQYE 3NPZB 1T5WB 2PYEB 4Y5XC 5IHZA 5ABDE 1OD9A 3O4OB 5D2NA 1EEUA 1XIWB 3MRHA 2YMXH 1YYLH 3NZHH 2QLVB 5ADOL 2DM4A 1UKSA 4PB0L 1CGXA 1IAIH 1U9KA 3WFEL 3HMWH 2FB4L 4HKJB