4GG6B

Protein complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
186
structure length
163
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSLLVCSVTDFYPAQIKVRWFETTGVVSTPLIRNGDWTFQILVMLETCHVEHPSLQNPIIVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Biased T Cell Receptor Usage Directed against Human Leukocyte Antigen DQ8-Restricted Gliadin Peptides Is Associated with Celiac Disease
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 163
sequence length 186
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gg6B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gg6B01
3PUCA 3KPMA 5FUZL 1ZSDB 4JRXE 1T7VA 3UPCA 2LTQB 4BK5A 3D9AL 4BELD 4RIRA 4A6YL 2J2ZA 4DK6A 4R7NB 1Q9KA 3MRPB 1LE9B 1YMHB 5DGQA 4NQCD 3WEXA 4Y4HD 2ADIA 4C57C 2O5XH 3TIDB 1BFTA 5DXWA 2D9QB 5IEKB 2W65B 3ZYZA 1IAOA 4D0DB 5FGSA 4X6CB 1FNSH 1PY9A 4H1LB 3MC0A 1GGIL 4ZS6D 4JPIA 1C5BH 3UCRA 9CGTA 4LLAA 4V2BA 1IBGL 4LSDA 4PV8A 2GJZB 1JPGB 3V5KB 3MREA 5IQ7L 3WNPA 3P77A 2NTFB 1U8LA 5C6TH 4BK4A 3BD4A 1KTRL 5DHVB 1X7QA 2X1WL 4QF1A 4JFHE 1AXTH 3MBEC 2JJVA 1CXLA 1I9IL 2ESVE 2NPLX 2YD4A 5TDPA 5K9OA 5F7DB 4Y4FD 3HMXA 3NCJH 4PD4J 1Z3GH 4KVNL 2WUBH 4QRQA 1UGNA 3IDMA 4ODWA 5J06A 1IT9L 2QQQA 4YHIA 3CFDA 1FFOA 3CPLB 3JV6A 3SGEI 3BQUA 5HI5D 4HGMA 5DJAB 4K2UH 3WJLC 3IS1X 1JN6A 3MXVL 5CILL 4NQVB 1JGEA 4LIQL 1LP9F 1S8DB 3DSNA 1TZHB 3CLFH 4MD0B 3LZFL 2YPVH 1DVFA 3PHQA 2BVTA 2ORBL 4RISL 3BE1H 3F7QA 4QNPF 2W9DH 7FABH 3Q6GL 2DWEA 4NWUL 4LP5A 3VMPA 3QO1B 4JQXA 3VA6A 1MCLA 3EOTH 4JDTH 2C7UB 2W0PA 2AEQH 4GAJH 4UQ3A 3SY0A 3O6KH 1FQ9C 2YZ8A 2FO4A 3FQUB 4JRYA 1P7QB 1X44A 4MQ7B 3G5YB 1YC8A 2X70B 3RUGF 3X12A 2J6EL 3VH8G 2A6DA 3T0WA 3NABH 4KTYA 2QLVB 3BVNA 4BKLB 4MDJB 3DETD 5I1EH 5DI8A 5HI3C 4NO2A 1Z0MA 2HRLA 2FEEL 5DWUH 3LMJL 1A7QL 1WBYA 5BO1L 3HZVB 3IVKB 4LCIH 1UZ6F 1NDMB 3ARVA 3CFIC 4OGYL 3O6LH 4XI5C 3BT2H 3V52L 1NUNB 3U6RB 1G6RL 4YQXH 4G6FD 3QPQD 3M8OL 5CHNB 5CD5D 4U33A 2ADJB 1CGYA 1RV6X 4HEPG 4KDTA 1JHTA 3OV6A 1RJYB 3K1KC 3AXLA 2BVQA 3JBG7 3ZDYF 1KACB 2Z93B 8FABA 4MNQD 4O58L 5IQ9B 4QRRE 5HHPA 1R3IH 4HC1H 4JKMA 4JZNB 3VXSA 3W0WA 6CGTA 1ZA6A 1X5HA 2IPKA 4P5TD 3RWJB 3ARGA 5BVPH 5F93C 4EDXA 4P0DA 4OB5L 1VSCA 2IF7A 3TJHC 1G9EA 2W9EL 4XHQA 4F8TA 1YMMA 4X0KB 5MI0B 2A83B 4JVUA 5HI4D 5D2LE 1RZGB 2VLJB 4Z0BL 5JIPA 5I1IH 5DQ9B 1KT2A 4UBDD 4Q9CA 2L0DA 3G6JF 5BXFB 1M71B 4QY8A 1JGUH 1I75A 2ATKB 4JFXA 4I77L 3QCVL 4O00A 2FJGA 1XGRB 4F80A 3ARBC 4W4OC 5F6IC 3BYTA 5FV1L 5C92A 2C5DC 3HI5L 4HKXA 3GSOA 4BFEA 2GSGA 3W2DL 2H32H 4LVOB 3PL6A 3EDJA 5H35B 1P9MC 1UCBH 1B0RA 5IIEB 3R1GL 4XWOC 3X3FH 1J0HA 3U83A 2R8SL 1GZPA 4L4VD 4ZFZB 2NLJA 1XGQA 3IT8D 2APBA 4KUZL 4YC2B 3UZEA 4YBQD 1FORH 12E8H 4PIRF 3RVVC 1DE4B 2MNUA 1P4IH 4PJFB 3LKRA 5CFHA 4CBPA 3KYNB 4UTAH 4MX7B 3PDGA 4YHKH 4PTTA 1F6AB 1CGVA 5DEFA 4RX4A 1M05B 1C8PA 1FCGA 4KMTL 1FGNL 5CSGA 2YPLD 4GKZB 1ZLSL 4TSAH 2X1QA 4B7IA 4E42A 4XCYB 2EIBA 3GJFB 1OWRM 3VE0B 1AC0A 1QFWL 3UTOA 1GIGH 4UIKL 3O6MH 1F4AA 3Q3GB 1FIGH 4JO1L 3RIAK 2Y4SA 4NQXA 3QDGE 1G9NH 5IB2B 3MODH 3FO0H 3MRMA 1EXUA 3U4BL 2ATPB 1NJ9B 2HWZL 2BCKA 2X9YA 3CZJA 1W0VA 1ACYL 2VXTH 5T1LD 4PRHB 4HK0A 5D1ZB 5CSBA 4I0PB 1LVEA 3V4PH 4CU6A 1N8ZB 2XN9A 5DJ8B 1C1EL 1KFAH 2FO1A 1DLFH 3GMMA 5FDYA 2R1XB 3BKYL 3QZWB 3PQYE 1XGUB 5L9DH 1KJ2H 3QNYA 4OIAA 4HZLA 2GEEA 3F62A 3BP4B 4FZEL 2RB8A 2FJHA 4GRLA 4Q0XL 4LSVL 1AR2A 1FG9C 1E27A 3FO1B 5DR5L 1PZUB 3QQNA 4N8CH 5AAMA 3BIKA 5FAAA 2FWOA 1DBBL 1FYHB 2UUDK 3QFJD 5I30L 3F7YA 5GGTA 2ED7A 1YNTA 3GSQA 5DMJB 3LRSA 1UZ8A 4WWKB 5DYOA 1E4KC 5C0IA 1YJDC 3ZDZE 4JFOA 3THMH 3GK8L 3CSBA 1U8MA 3RWFA 1INDL 5DT1H 4XCEA 4PRAA 3T2NH 4P23A 3R06B 3HS0B 3K80A 3GMLB 3EYVB 1S78D 1WZLA 1B2WH 2NNAA 3BRFA 5HHVH 1A9EA 5T3ZD 4PRIE 1TNNA 3B9EA 3CDCA 3OF6D 5D2NC 5TQ0H 4UB0H 3QIBB 5I17B 4O2EB 5BS0D 3RHWF 3ZE2E 4OM0H 4WUUA 3T77B 3IDNA 5L2KD 4HK3J 4NC0B 4WI3A 3B9KD 1G1YA 1LO0H 1YEJL 4N0YH 3UTSB 2D4FA 3OXRB 3HC0A 4U6YA 2AJSL 4AEIH 5C0AD 3ZL4L 5I75C 2DDQH 4PS4L 5D7KD 5JW4M 2J8UB 3QUYB 1OY3B 1AGEB 4QXUH 4I18C 4PJXE 3NPZB 2DQIH 5C0NC 4G6JH 4EBQH 4WI4A 3QCTL 5C9KA 2FD6H 2YBRA 1N59B 4MQTB 5EO9A 2DQCH 3U9UA 2C3GA 3WO4B 3FT2A 1EFQA 3B3IA 2BSED 4YXKH 4Z78B 3NFNB 1IMHC 3CXDL 4GKNA 4C56E 1QRKA 2BSRA 1WCQA 2PO6B 4MJ5A 4TNVF 1N5YH 4KJWC 1MFEL 5GSRA 4ZS7H 1WSST 1JFQH 4TVSa 5INDA 2VDOH 4LCCA 4QTHA 3TH3T 4KU1A 1NMBL 3ZSSA 3SKMA 5IMKB 4ZPTA 1T2JA 5FUZH 2B2XH 5C86A 1JHTB 1QR1A 1BBDH 5LCVL 5IHBA 3D9AH 1EEYA 5GJSL 4A6YH 4D9QD 1HHKA 2ITCB 2ITDA 3OKMB 1NDGA 1D6VL 4LIQE 1IM3B 4Y2DD 3AFLA 2W0FB 4P2RB 1A6AB 3BKJL 4KJQC 1MCRA 4M6OL 2MKLC 4R4ND 3OAYK 4OJFL 3EIFA 4OD2A 2B1AL 3VXRB 3VXTB 2R39A 3GO1H 2CKBL 4XBGB 4F37F 1TENA 4TOYL 4G43A 1SBBA 1I8MA 3BW9B 4GW1B 3RVXC 1IBGH 1G6VK 5SWQA 4DAGL 4M00A 4XCNB 4YZFF 5IQ7H 3H3KA 5FO9B 2PR4L 2WAHA 2V7NA 5T33H 2FEDD 5IF0B 4X7TB 4AJ0A 4L8DA 1FNGB 1KENH 2A2QT 4G5ZH 4M8QA 2MMXA 4YDIL 5J3HD 1JHLH 5L88L 4X80H 4HGWB 4KV5F 4U2YA 5IB3B 1QA9A 1HYSC 2DD8H 2WZPD 3SJVA 5IMOB 2CLZB 2R1YB 4JN1H 5BW7C 4QOKE 4U31A 2DLEA 3D0LA 5T1KA 5HHOA 3MXVH 3NCMA 3S5LG 4KZDH 3LPGA 3ABZA 2L4OA 4U3CA 4OZGB 4QTIL 1FFPA 3MX0A 5E7BA 2I60L 2HT4D 2WBJA 3STBA 1AO7E 3CSPA 3IF1B 1U58A 2ORBH 4YH6A 4RISH 4R2GD 3HR5A 3Q6GH 2JCCF 1XGYL 1A64A 3CVHB 4NWUH 5HGDB 5SX5H 2X1PA 3WS3B 2YK1L 3NH7L 2MHAA 3CAFA 4FQHA 4M02A 4N8PA 5DA0B 5SWSD 5C0EA 5L7XH 1NAML 4JEGB 2R2HA 5CZKA 1YQVL 5DHYA 5DSCB 4NO0B 3PXHA 4PBXA 3ARZA 3RKPA 3FB5B 3KWWB 4LSQH 4RQQA 5A2JH 4MD5B 1T2QH 4Z0XA 3KPQA 1P2CB 4Z7NF 3LMJH 1A7QH 4XNMA 1WAAE 4WTZA 1VACA 4ZS6C 4XP5L 2XQYG 2F5AH 3G5ZA 3SBWC 3UPRB 5ANMB 3TA3A 2RFXB 3QJHB 2X05A 1F8TH 3M8OH 4OGAD 1GHFL 4GLRI 2XXCB 1E4WH 4M62L 2D2OA 4L8CB 2Q87A 4NQDD 3GSWB 5FYKU 2F19H 2J8HA 4LOUD 4XRCA 1C5DA 4O9HH 4Z7UF 3TNNA 4FFYL 3KS0H 3GSUB 2BY1A 4P46A 4UDTB 1K85A 3OAUL 2VZ3A 2HTKD 1RK0B 4L8SA 5ITBL 2DQDL 4Y4FC 3UJJH 5F96L 4DVBA 1CK0H 5EN2A 1G7MB 3MLYH 4OB5H 1CU4H 3QFDA 1WK0A 4IOIA 5I0ZA 3BP7B 5HI5C 3QUZD 3SGDI 3MBEB 4Z0BH 1LWRA 5EOCJ 3ARXA 2PW1A 3VJ6A 5GSVA 4OZIA 4N1CA 4UIMA 1OT2A 3OKNB 4HXBL 3VFGL 4U1NB 4R6UA 4Y16D 4JFDA 2P5WA 4M48L 4WFGE 4CMHC 4PRIB 1FO0A 3UBXG 3MR9B 3OG6B 4D3CL 3UDWC 1QYGL 3R0MA 5BRZE 5E70A 2CPCA 1EH9A 1UWEH 5KS9B 1D3CA 5FO7A 3WCYA 3HI5H 4QRTA 3WDIA 3DX6B 4KQ3L 3BSZL 4XMLL 4HSQA 1I1YB 4GRWE 1FG2A 2NNAB 2VAAA 4DZ8A 1IEBB 5DURB 5I8EA 4PJ8D 5C07E 4P49A 3H9SB 3V6FA 2R8SH 3DETC 3VFSB 1KUMA 1FYTB 3RIFF 3FAXA 4KUZH 4F3FA 3MJ6A 1KNOA 1QKZL 1Z6JT 5I66B 2Z0BA 3BZ4B 1VFBA 3HUJF 4YE4L 5DRZB 1BZ9A 4FRWA 4GOSA 3GIVB 5EBWB 4RGMC 1VEPA 1MAJA 3QPQC 5CD5C 4TSCH 1S7SB 1FGNH 3G5VA 1Y0LB 4JKWA 1CVSC 4ODHL 1KV3A 1DJSA 5INCA 4UIKH 3S88L 2GAZB 3QIUD 1OB1A 2N4IA 3O4LD 4NRXA 1LEIB 1G7PA 5CKGA 3LQZA 5DVLA 4WI7A 4JO1H 1ZLVH 4P5TC 3SKOA 3WFHA 3ARFA 5EU6E 4MA3B 5F7EL 5FYLD 1T0PB 4ORZC 4YHNB 3VWKB 1MPAH 1BGXH 5ESVB 4JG1H 2HWZH 3E6HB 4PJIA 1QHPA 1QR4A 1YNKH 2P24B 1LEKB 5HI4C 2HG5A 2E7LC 1R5VA 2IADB 1KJVB 4R26L 5EU7C 3MYZA 4OT1H 4XPAL 4LLMA 4HBQA 4GXVH 4Y5VA 4NQSB 4HFWA 1C1EH 1WBXA 4GG6E 2YPKA 1YUHA 4H1LG 4I4WA 1AGBB 1MCIA 3BKYH 3DUSA 4C59B 2NY4D 5ISZD 5DJDB 2GKIA 5HYJE 1KIRB 2WWMC 4U7KA 3W5NA 5CEYB 1BVKB 1MSPA 3W9EB 4FZEH 3KGRA 1MCKA 4FQ2L 1I9JH 4Q0XH 4LSVH 2IQ9L 2D7NA 5DUMH 4F7EB 1R3KB 5KVGL 2FH8A 4JG0L 4IDJL 2VLLB 4TYUA 1G7IA 1HSAA 1W0YT 4JPVL 4OCLC 4NT6B 5I30H 3ARBB 5F6IB 4LKCB 3AS2A 4LBEA 5ILTL 2A6JA 1OF2A 3V4VL 5JO5B 1AGCB 3RHWK 5ITFB 2BERA 3T0ED 2O93L 4TUKH 1IC7L 4JDZB 3GIZL 4GH7B 1HH9B 4OCRH 3C2AL 4P5MB 4UI2A 3O8XC 3D39A 1P53A 1YPZE 3GK8H 5E2VL 5IG7B 5EDXA 5CGTA 5FO8A 3WL9A 4M61A 4DK3A 1T80A 2OTPA 2R2BB 5HBBA 1D5XB 1SVZA 4K8RL 4ZO6A 4I2XA 4P3CH 4GLRH 1OAUL 2HJLA 5D1XD 1HE7A 4E5XB 3BMWA 5TE6H 4RMRA 4Q6YA 5HYSB 1JGVL 1AXIB 2O26U 1M1SA 4JKPL 4D8PB 3GBML 4WENB 1EEZB 1YEJH 1KJMA 2V9TA 3GJEB 1SJEB 5LXGL 2AJSH 1I3UA 1IZKA 2IQAA 4PS4H 3ZO0A 3G9AB 3S34L 3GRWL 4Y4HA 4WUKH 4NRZA 5BOPA 1CDCA 2BHYA 3ZT5A 3MV9E 3SGDH 2IAND 4G42A 3STLB 3NZHL 4LHUB 5CJQL 4UMGA 3B5HA 3JV4A 3LHPL 2F5BL 5IW1A 1U9KA 2X89D 4JPWH 4BQ9A 4XB8A 3WO3B 3EO1A 4MJID 3I9GL 3S3SA 3X11B 1H3WM 2FYYB 2ZP0T 2A0LD 5DK2A 4XXDB 2EIZA 4KK6D 1E6OL 2BVEA 2X09A 1JWMB 2H8PA 4E41E 4TTGA 4NO3B 4P3DB 1CQKA 4F37K 2D0GA 4GAGH 2HJKA 3PP3K 2VSDA 2X9WA 2AEWA 3LEYH 3V7AG 4JLRA 5LCVH 1DQDL 4X6DE 4ODSL 5KVDL 1OP5H 5J1SC 4DZBA 4OFYD 4EZMA 4J2XA 4PRDA 4I0KA 1A6WH 4HX1B 5IT2L 4YFEA 1DLHA 1N64L 2HA1A 5EPMB 2FX8L 3EYFA 3T2QA 1U91B 4M6OH 4YHLH 4F8QA 4ISVA 4OJFH 2A1WL 5GRWA 3ULUH 1RZFH 3HMXL 4NNXB 3QUMB 1S78C 4ZFFA 1WCBA 3E0GA 5DRWB 3C9NA 1NLBH 3IXTA 4WDIB 4DAGH 3V6OE 5DDHB 3RX7A 3ZHLA 4C54A 5KVFL 4JFFE 3T0VA 2XRAH 5C8JA 3H42L 4PJCF 4HIIB 4MXQD 2HP4A 2DQTL 4FA8A 2P8LA 4N68A 3SCMA 1BZ7B 3B9KC 1UH3A 1T1WB 2Z35B 4P59L 5J9PA 3T09A 2A73A 1YEFH 4U49A 1KIQA 4LEXL 1PZ5A 4I3RH 5IVXA 4G8GD 1IEAA 3GUTB 1QFOA 1J10A 3MLZH 3O9WD 3L3IA 2VOTA 1E4XI 3X3GH 1QO3B 5D2NB 2FR4A 4UT6H 3GMPA 4QXGL 1PKQB 4PJBA 1P84K 5FYJU 4I1NB 3HRZB 5EBLA 1HHGA 3ARQA 5B21A 4QTIH 4PTUB 2NQCA 5I75B 2I60H 5T3XD 2I9LA 1PQZB 4I18B 2GFBB 2O5YH 4YK4C 1DEEA 3MLTA 3NAAL 3VFPB 2EDLA 1U93A 3CFBA 4MA7H 4MNQA 5IBTL 4POZD 4NKOB 1UENA 1W8NA 1NAMH 4HLZG 2VDRH 5IOPA 4E0RB 3WHXB 2XNAB 5BMFL 4JKKA 1HQRB 1W0WB 3DROB 2X44D 2OR9L 3Q6FB 5D7SH 4EXKA 5IB1A 1HZHL 2HN7B 1KB5B 4L4JA 1ZLUK 1CBVH 2GTWB 4WI2A 4Y2DC 5C09B 3H9HB 4V1DB 5F9WC 1U36A 2E27L 2JKXA 3OKDA 5DD6A 2IPUG 4R4NC 1LMKA 4JQIL 5B22A 2IFGA 4PGEA 4M3KB 3TNMA 5HYJB 4GKSB 2IAMA 3PV6A 1B9ZA 3BAEL 3VRIB 4N8VA 3MRKB 3BPLC 4M7LL 4Y19D 1KG0B 4H1LH 4DGVL 1WC7B 3E8UL 3QEHA 3QZWG 5F9OH 4FFWD 2Q7YB 5D93C 2FLRT 1A6PA 4FFYH 2FEDC 4X5WA 3RTQA 5C2BL 4O2CB 3OAUH 2HJFB 5J3HC 4JFZL 3B2UC 4NUGH 5KSBB 4M7KL 2DQDH 1E0OB 4KRPC 3QDME 2Q20A 1BZQK 1WWAX 3AC0A 1A6VL 5DHVH 5B38A 1MFCL 3WUWA 2BY2A 3IS0X 1I3GL 5JLZB 5EB9A 3D3VE 2VLRD 4F9PA 2W1NA 4I5BA 4L4VA 2D7QA 2W38A 2A9MH 1BHGA 1OTTD 2NXYC 4ENED 5JW5B 5SWZA 3SOBH 4KDTC 3BHBB 3IDGB 4G6AD 3VFGH 2GJ6B 5C08A 5EU5B 3OKEA 4M48H 3RIFK 2IJ0C 1A7NL 4R2GC 1LNUA 1N5AA 4MZ2A 1NGQH 3L3HA 4D3CH 1QYGH 4K3DL 3RPKA 1MCPL 3F7VB 4OZFA 1QFWM 2D7TL 1WIOA 1S3KH 4KQ3H 5F1NA 5EZLB 4XMLH 1MCQA 4XPFH 5GGQH 1CG9A 2DTML 4NRYB 5IB4B 4KPHH 4KHTH 1T7WA 2J7LA 3VXUE 2DL9A 4XNZC 3IETA 3DBXA 3MV9B 3MNWA 4WHTB 4CL7A 4JN2B 1B88A 3QWQB 4JB9L 3NFPB 2CIKA 3FL7A 4ERSH 3MROA 4XH2A 3U2SB 4NO5B 4XX1G 4PYGA 1KSRA 1QKZH 2BNRA 4MNHA 3EKCA 3TH4T 3AY4A 5CLTA 1CXHA 2C1OA 4YE4H 1QLEH 4PJDE 1P84J 4NQCB 1D5ZB 1T1ZA 4OGAC 4EN3A 3ZKQD 5FIEA 5CMAB 1QFPA 4HIHA 3HNTL 3LKPA 4LOUC 5GRVL 4N0FA 2DF3A 3KPSD 5AG9A 2HTKC 2QSVA 3I6KB 3IFPA 2Q76B 3T1WA 3RY5A 3RWIA 2H9GB 4HKZB 1NCCH 5E99L 2Y06L 5GZND 2FBJH 3QUXD 3BYYA 4K7FA 1N2RA 4FOMA 5IVZB 1BFVL 3QA3A 4WJ5B 5GS2H 2DQGH 4MAYD 4HDIB 4WU7A 1R24B 1KLGA 4UQ2B 3NPSC 1NBZA 2VDKL 2VH5H 5FCSH 4ELMF 3VXMD 4LVNC 1AY1L 2KH2B 1IKFH 1JL8A 1XZ0A 1LO3L 4Y4FB 3I84A 2BVOA 1CN4A 2EYSA 2HKFL 2K7PA 5DJ2A 3D69A 3KNBB 4YAQA 4PJ5D 4DZBB 3T2PA 4Y16C 2ZOLB 4KHXH 5E0QA 3TV3L 1I3RB 5GGTL 5AYQA 4ODXB 3FN0L 4KQ4H 1UT9A 3P9LA 4OUUA 3JTSA 2DQEL 2I5YL 3JV5A 1BM3H 4OLZH 2AJZA 5EUOE 4PJAB 2YEZA 4FQ2H 3OF6A 2YD6A 1NFDE 2IQ9H 3T8XA 4CMHB 1MWAB 1K3IA 4LGPB 3C9NB 1C12A 3U36B 3MRHB 5KVGH 3OJDB 4JG0H 4IDJH 3KPRE 5C0CD 4PREB 4PJ8C 4DW2L 5DVMA 3PWPD 5DS8B 5CP3H 2F54E 4P57A 3HC3L 5ILTH 1D5MB 3IRPX 4X7SL 2AXFB 5IFAH 1IC7H 1IM9A 1BECA 3GIZH 1T83A 1QLFB 5D7JA 3CK0H 5J8OA 4LKXB 2YC1B 3HC4L 5E2VH 2VO5A 3EGSB 4KZEL 2VSCA 4IIQC 3HG1A 1HILA 2PYED 4BH7B 3OTTA 5ESAB 1HWHB 4LCWD 3HNSL 4BSVB 1F4XL 3ZMRA 3HTLX 3K7UA 5CEXB 3TO4D 5HDOA 3K3QA 5E9DA 3QIUC 4QEGA 2VLMD 4HEME 1S5HA 4M6ML 4HJGB 1VFAA 3CMGA 4RGMB 3ROLB 1FJ1A 1ROWA 1KTKE 4G6FB 4LGSB 5I19H 1JGVH 4S0SD 4JKPH 3GBMH 3CFKB 1S7UA 3F58H 3DX7A 3SGKA 1KXQE 1S9YB 4HLZH 5I15L 5HXMA 2J4WL 1B0GA 3LIZL 5DTFA 4HS8H 3GBNL 1CFSB 3H8NA 3HMWL 3JWDC 3LB6C 2E9BA 5TDOB 4YHZL 4NP4H 4M7LT 5MENB 2AK4D 1EBAA 3CLEL 3L9RA 2HRPH 4WY7L 2VRAA 1UXWA 1A3RH 1A1OA 2VIRA 4P5TB 4XC1L 4OKVB 4AY0A 1JE6A 3BGMA 4JANB 4HKJA 1JYWA 4EUPB 3L95A 2E6PA 3HNVL 2YXMA 2F5BH 1CE1L 1G7QA 2NY4C 1SEQL 4ZQKA 3VWJD 5FKAB 3OGCA 2NX5A 2WBWB 4ZMAT 1A7PH 5I9QC 4YHOH 4U1IA 3ARDA 3LS4L 1Y18B 3AROA 4G9FD 3I6GA 2IH3B 2OL3A 4Z7QF 4UOJA 4H25B 5CAYB 3T3MF 3IJYA 1CICD 1DQDH 1MHEB 4XCCH 3SE4A 2DJUA 1VERA 4RFOL 1XR9B 3EO9L 2Z91B 3T0EC 4DOHE 2PXYA 3L5WB 1I7RB 3ULVF 4KGLA 4JRYE 5L8KB 4PRBB 1NGZB 5GS0H 5EC1A 1TCRA 5E5MB 3LN4A 2VDLH 5BOZG 4X83A 3H9ZA 4Y4KA 5JPMB 4F9LC 4L3CB 3QDHA 4PJGF 1JF5A 2HT3D 4YNYA 4HIJA 5IHUH 3VCLA 1SMAA 5JOPE 5D1XC 4HJJL 4G9DB 3V4UH 4DKFL 1U95A 3O8XB 3QCUL 4QHUA 2Y36H 1FPTH 1UM5L 1FZKB 4F57L 5JOEA 3Q5TA 3IRZA 2XACC 4PRPD 2EC9U 4X4ZA 2YPLB 4PJHB 4OFPA 2BMKA 4AIZA 5BV7C 5GGVL 1OAKL 3GMRB 1QSFA 2ARJB 4LEXH 1Q9OB 3OAZK 4NM4L 4R3SA 2LAGB 2WWKO 4XNYH 5GRUL 1EAJA 5KN5A 4ZO8A 1QFUL 3I02A 2GJJA 3PDDA 3VXSE 2GITA 3W0WE 1A14L 2E7BA 3RWHB 2KUTA 4EKXA 2UWEB 2GUOB 2VWEC 3U1SH 1X5GA 5T1LB 2VITB 1OAQL 1YMME 1PSKL 1HCFX 5FYKL 3WNNA 4NHCL 5DFVD 2A0LC 3HCVA 2R56H 4KK6C 1YY8B 5EC2A 4OD1H 5F7LB 1QNZH 4JQVC 4L5FL 4RWHA 4CAGA 4LU5H 1FL6B 1RK1B 2WBKA 1M7IA 1XH3A 4FN0A 5B39B 3CD4A 1PD6A 1K9TA 1A6ZA 4KXZI 3AM8A 2OR9H 4WCYH 3KR3L 1HZHH 5J0BA 1EIBA 2ZCHH 5HHNA 4TVPD 1R3HB 2PN5A 2ZUQC 1RZKC 5CBEB 4FQLL 1HCVA 2E27H 4I9WE 4PYHA 3QFJB 4LSPL 3KHQA 3WIHA 1G7LA 5C0JA 1BLNA 1T0NA 3D25A 1U8IB 2XG5A 1WT5A 4BZ1L 1F97A 3FHAA 3BEWA 1P4LA 3O2WL 3B4NA 3TBSB 3QAZC 1P7HL 4MAUH 2XA8L 4G3YH 4MXQC 4XBEH 4OUOA 1IFHH 4JM4L 2OMBA 5C2BH 3WD5L 1TTGA 3RNQA 5HY9B 1EJ6A 2V2XB 4M7KH 5FKPA 2J1KA 1FO0L 1ZGLB 1Q72L 2CMRL 2F53A 2ICWA 3P0GB 4RWYL 1MFCH 3O9WC 5JW4Q 5KSVA 2UZYB 3UTZA 3V6BR 35C8L 3VXNB 2AK1L 1NC4A 3IXAA 3LS5H 4G7YL 5BS0B 4H26B 4PY7B 4LLWB 4O02L 3GHEH 5L2KB 4Y1AD 2FJFA 3B9KB 2XKSA 4DEPC 1KTDB 3PHSA 4N5ED 1C5CH 1H15B 5C0AB 2AV1A 2GQHA 4WTWA 4ZFGL 1EHLL 2N1KA 4I48A 3VFRB 1CDBA 1CDHA 3C5SB 3JWOC 4MWFB 2R1WB 1PEWA 4L8SC 2B39A 4K3DH 4PLJD 3MFFA 4O2FA 3QEQD 1OGTA 3Q5YA 1WFTA 1N0XH 1NFIA 2AXHA 1AD9B 2E8ZA 1MLCB 1J5OH 1CLYL 1FL3B 1OAYH 3DV6B 5HYSG 2DTMH 5KTEL 3I85A 1MFDL 4J12A 1HNFA 5IBUB 1QHOA 4OCSL 3ZHKA 4YK4B 4CU8A 1DP0A 4NGHL 4HAFA 1DBJL 2IC2A 3SE3A 3MMEB 5D72L 2NW2B 5D2LF 4ZUTA 3UYOD 2ZSVA 1RHFA 5E6ID 5K9QG 1LDPL 2DLFL 1T6VN 1DUYB 2DICA 1U3HD 3ALXA 3T4YA 1AKJA 1CGSL 3INUL 3MBXL 2XOTA 3CIQA 1JNNH 3MRNA 1I4FA 3TWCL 3JVGC 1WISA 2NY5H 3BRGC 1IGTB 2AP2A 2YKLH 1E28B 3BX7C 4Y2DB 5GS3A 4FFWC 3P0YL 3FB6B 5F9WB 4YWGH 3ES6A 3HNTH 1OP3H 4ODUA 3HLAB 4WTZG 3DRTB 3GGWB 4GBXD 2X40A 4L4TA 2VDNL 3F7PC 4X6EA 4YDJA 5IV2B 1S9WB 4XWGL 5E99H 2Y06H 1PGRB 3N85H 2E7MA 1N6QH 3OR6B 1Q9LA 2HH0L 3DVFA 2PNDA 2H2SD 2FATL 2ZCLL 1BFVH 3N1PC 4DTGL 5D93B 3RNKB 3QWRA 2KQMA 3F5WA 4U0QB 4WUUE 1OTTC 1XF3B 4OZHB 4ENEC 3NBNA 3GSRB 1BIHA 1HI6A 1AY1H 3REWA 5I18L 2X4OA 2CD0A 1J8HD 1L9MA 4KRPB 1VADA 4G6AC 5IFJA 1FN4A 4DUWA 4TRPL 4B41A 1NCAH 3QHFH 5LGJA 1RVFH 1AQDA 3W9DA 4M1GL 5KSAA 1GGBL 2YD5A 2NXYB 1J88A 2DQEH 1JK8A 4JY5L 3FFCD 5DJCB 2C3XA 4M3JA 1RJCA 5JR1L 1A21A 4DGYL 4OI7A 4IRZL 4J6RH 5FUOH 4IDLA 3IJHB 4LPTA 5F89B 3QEUB 4XGZA 3RL2B 4R2GB 1YEIH 3H3BC 5H2BA 4DW2H 2EDNA 3MV7D 2Y6SD 4KXZH 4P2QD 4Y5VC 1LO5A 5SWSB 5DD1H 3IDXH 4M7JH 3TVMD 4X7SH 1HQ4A 3MOAH 1CFVL 5HJ3A 1P69B 2J3SA 3U82B 2OJEA 3QXDB 4MHHG 2P5ED 3HC4H 1DZBA 2E9JA 4XNZB 5DMGD 5ICXA 3N50A 2WQ8A 4FQCH 3W39B 5F7HA 2P49B 3FQTA 2VZSA 2AJXL 3HNSH 1DBML 4ZUUB 5FDWA 4PB0H 1ZLWH 4LLUA 2BSSB 4NKMA 3V0VB 1U8OA 4JGUA 3UJIL 3MJGX 5ACZA 3EYQD 1TJGL 4OLVL 2B1HL 3CH1A 4UU9B 2NW3B 5GZNC 4WI8A 3OX8B 3QUXC 1KCLA 4NQDB 3OPZH 3HE7D 3IDUA 4Z77A 3MOQA 4MAYC 2J4WH 2XZCL 1OGAA 1H5BB 3ZDZF 1RU9H 5CJXA 2G5BB 3VG0L 3G04B 2VUOA 3X13A 4LSRL 3CLEH 1UFUA 4LGRB 3FRPG 3EYUH 3SKNA 1FHGA 2J88L 4L3ED 4XC1H 5H37H 4RBPH 4X9GA 3SJVE 1S7XB 2C4XA 2LFGA 3QISA 5E5RB 1LP9A 4UINL 3BH8B 3HNVH 4F7CA 3NPSB 4WFFE 3QUZB 4LVNB 2D3VA 2HFEA 4FNLL 1AIFA 1T7YA 4HT1L 5HHOE 3SGJA 3REVB 3PJSB 4XNXL 3ZE2F 1R3LB 4D0BB 1BMGA 4C83A 2ZG3A 5F1SA 5LG1A 4QRPA 4RGNE 3LS4H 1YQ2A 2AV7B 4Y16B 2BC4B 4JFEA 1T3FA 2ZUTA 1CFTA 4JFPB 2LU3A 4QRSB 3BO8A 3H7LA 4NKDB 4PJXF 3GJFK 4FQJL 4HAGA 3FQWB 4OIIH 3FONA 2V2TA 3VXQB 3FHQA 4RFOH 4RGOH 4HPYL 5FYJL 3D0VB 4ALAL 1V8HA 1HHHB 1S7WB 2L7UA 4LARH 1NCDL 1Q0YH 4PJ7B 5CEZL 5D7LD 5FYKE 1P1ZB 1LO2H 1D9KA 4ZTOL 4PJ8B 5F88A 5KSVB 1ACZA 4JJ5A 4R7DA 3MNVB 1NBVL 2I25N 4EDWL 2JLLA 3IDJA 1A3LH 3T2OA 5GGUA 3MRQB 1XF5B 1A02N 2JB6B 3TZVD 2R15A 1HKLL 1TMCB 3I6LE 5BZDB 1CFQA 3WS6C 5LGHL 3PGCB 1QUNA 3U7WH 3LEVH 4HJJH 3TO4C 1KPVA 4PUBH 1ZE3C 2EDOA 1YN6A 1BQHB 2NYYD 2EO1A 1UM5H 4ZAKA 4IIQB 3BJLA 3B8SA 2P8PA 3OXSA 1S7RA 3JTTB 1F3DH 4PG9A 1F58H 2IBZX 4JAMA 1I1FA 2JELH 2VL5B 1ZT1A 2SEBB 3QRFM 2R69L 4FQIH 5F9AC 2AKRA 3VRJB 3EUUA 1RZJL 4FG6D 2DJSA 3QIUB 1P6FA 2PW2B 3O4LB 5GRUH 2XTJD 5FA3A 4L9LA 2UY6A 4UZGA 5I76A 5DRNB 3DVGA 4HPOL 3RWDB 1QRNA 5CCKL 4RMTA 2ADGB 2DI8A 1G9ML 4QCIB 3RJQB 3VWJC 5D4QA 4ZO7A 1CIDA 3BDXA 2QHRH 1ZT4A 4TNWF 3WV0A 4CNIA 4X7EC 1PEZA 1XT5A 2CLVA 3FT3B 3O45A 5DC9B 2R0KL 4OZIE 2OTUB 4JRWA 4AIXA 1X4XA 4NZRL 2XG4A 1T1YA 3C8KB 3ALWA 1P4BH 2P5WE 4IRSD 4JFDE 4L5FH 5T1MB 1IGIL 1XGPA 1DQML 1J12A 5ISZB 1UVQA 2NY4B 3CFJB 2FB4L 4YR6B 1CICC 5HGBA 5MEOA 3BWAB 4ZFOB 2I07A 4H8WC 4UILL 4FTVD 4ZOAA 3SO3C 4NJ9H 3S4SA 4HCRH 5I9QB 2X1OA 3K4AA 3QIWD 5F9JB 1MJJB 4MLIA 3L5JA 1AGDB 5JNYB 1RZJC 4Z7WE 3ROOB 1JRHI 1RSFA 4HWNA 4G8IB 4PP2A 2A6IA 3SDAD 3FQRB 2VXSH 2QR0B 2LABA 2HT3C 1EFXD 3T0EB 3UEZA 1OW0A 3MRGA 1KIPA 3LEXB 2DYPD 4J3VA 1NMCC 4K3GA 4JO3L 3QI9A 4M1CD 1YZZA 3AAZA 2XA8H 3QUMH 1RI8A 2EKSB 1PJ9A 4JM4H 4AYFA 1ZHKA 3WD5H 2DJ4A 3UTQB 2VLKA 4K9EL 4F58L 3V6ZB 4HH8A 5HHME 5C0GA 2KQNA 5D1XB 1FO0H 1Q72H 3MXWL 4OD3H 4P3WA 1WAAF 3OKLB 5HDQL 35C8H 2IAMC 3DRQA 1ES0A 3SDYL 3VFVA 2BP3A 1U41A 3BRDA 2IH1A 5CD3A 2ILLA 1AXSA 1INQB 1V3MA 2FX9L 2AEIT 4XBPB 5BV7B 3LKSA 3ARTA 3U0TA 4I8DA 4PJIE 4ZFGH 3QDJD 1BFSA 3DXAA 1KBGH 2X4TA 3ARUA 4WV1C 2IANB 5JQHC 1KN2L 5J6GB 3UTTD 3KXFA 4RSVA 5AZ2H 1QBLL 1F11A 3ECBA 4K94C 3RL1A 3TO2B 1CLYH 3DVNA 4MJIB 1XF1A 3FQTB 1GC1L 1MFDH 2E6QA 4OCSH 1XR8A 5FK9A 3RWGB 5CJOL 4PRNB 1RQ5A 4Y8AA 1MHCA 4WW2F 1WWWX 5D72H 1CF8L 5I1AB 2G75A 1JV5A 3S7GA 2DLFH 2DQJL 1H8SA 2JK5B 1JGDA 1G0XA 3INUH 3IFLL 4M5YH 1KB5H 5BJTA 5JHDD 1KPRA 1C7SA 3TWCH 5M7QA 4S1SH 4APQA 4YO0B 3MRBA 3SDXA 2HYMA 1QEWA 1AC6A 4X9HA 3WLWC 1UKSA 2ZUQB 2XWBB 4GQ9L 4GRWF 3VFNB 5IHZB 4LSSH 1MJUL 3K0WA 3SDDA 1LP9B 1CD9B 2D9CA 2EDKA 5E2WH 5GXBB 1LILA 3O2VL 3QPXL 4JO4H 1U2CA 2E7HA 1QG3A 2R2EA 4U05A 3AREA 4I2XE 4DGIL 32C2B 1M6OB 1NC2D 2Z4QB 1F6FB 3SN6N 2FATH 3QAZB 5D70L 4DTGH 2BVPA 1WGOA 4GG8B 4FQ1L 2QQNL 5FB8A 1YYLL 2AJYL 4DWHA 3BO8B 2FGWH 2EC8A 3V95A 3ZSTA 4G8GB 1YEDA 1IGYA 3RUGB 5B38G 1KJ2A 3I3BA 3O9WB 4TRPH 3QUKA 4O51B 5I16B 1WWBX 2WINA 1YEGH 3VI4E 4XCFL 3VFTA 5F7YC 4PLJC 2VYRE 4M1GH 4DEPB 4XPGL 4YDLC 1T5XA 4NNPH 1JZ3A 2ZG1A 5JR1H 4DGYH 3MCLL 4K07A 3CVIH 4HLJA 5BVJA 3OQ3B 3SKJH 2R23A 1XF2B 1YEHH 4LCYB 5EFIB 4NJAH 5E6IC 3C60D 2JIXD 3FMGL 1XCTB 2CDFA 1K4DA 1JNLH 1I7TB 3PWJB 1I8KA 1IAKB 1RULL 1IC4H 2IFFL 5A40E 4GG6F 3GI9H 4U1SA 5D96C 5SX4I 3GSNB 3QO0A 3UO1L 5L6YL 2XWTA 5E94A 4OLYL 2EYTA 3M07A 1JRHH 2BHZA 4P5KB 4YIQA 1BEYL 1BAFH 3H2WA 1AJ7L 4U1LA 4LCUA 4IMKA 1K4CB 4HHAB 2XI9A 3GMNB 2AJXH 2OS7A 3W82A 5FOBB 1DQQA 2H45A 1IGCH 3G6JB 3BXNB 3BEVB 2EH7H 2AABH 3IFNH 4G9FA 3KPLB 4Y19B 3V79C 4HH9B 5FYJE 2XKNB 2H2SC 1DQLH 4I13B 4Z7WB 5CEZE 4KVCH 5ESQB 4AM0A 1YPZF 3RRQA 4ESKA 1HXMB 1I8IA 1QSED 4ZUVA 5MEOB 3LQAL 3ULVD 2P47B 1BVLB 3KLDA 2J88H 4EJ1C 5IVXE 4N0CD 3EFFA 3VXPA 5ENWA 2OL3L 4GW4A 4EIGB 5EZJA 2X4RA 4OAWB 4HS6A 2VLRB 5TFSH 3AS1A 4FQQB 2WANA 4PJBE 3FOLB 3QG6B 3W81A 3WIFA 2UZIH 4JJHA 4FNLH 4HT1H 5HYEA 2D7PA 2JCCA 4XNXH 3RZCD 5ID1A 5E1HB 5D5ME 3BH9B 2OXGA 3ZKXC 2MCG1 5CP7B 3DTXB 4U6XA 1B6UA 1QVOB 4JFQA 5MHSE 1JNHB 3MRGB 4ZSOA 4PRPA 3CMOH 3UX9B 2GK0B 4Z7VA 1MIEH 2BNQA 2Y6SC 1AFVH 2VISA 2DQHL 2BSTA 1MCWW 4WHCA 3TVMC 5IMMB 4NN5C 1I9RL 4POYA 3TN0A 1NCDH 3QJFB 1DFBL 5CEZH 4NNYA 3LV3A 3SQOL 5DMGC 1HEZA 4F7PA 5EO1B 4XMKL 2GCYB 3D2UD 3MRFB 1HKLH 4PGDA 4M6NL 5LGHH 1EV2E 1Q1JL 1NGWB 3DGGA 4JFHD 4BH8B 1MCBA 2ESVD 3SE4C 4BFIA 4X4XA 3TBYB 4ZG1A 4X6DF 5C2UB 3QHZL 1HHJA 2JE8A 1XGTA 5E4IA 4TNWK 1S5IL 4KKAD 2R69H 3HE7C 3L3DA 4YHPB 5D8JL 3T0BA 4NYLA 4EI5D 3PGFH 3SDCD 3G08B 1YNLL 3KPSB 1ZAGA 3L3JB 4IS6A 4W68A 4ODTH 3DUUA 3N06B 1VHPA 1YY9D 2AI0H 1FC2D 3U48A 3L3GB 4WWKD 2OX5A 5KSUA 4RA0C 4JKLA 5DQJA 3QUXB 3DMMD 2HVKA 2WIMA 5DJZA 5L8LB 1LD9B 3VG9C 4MAYB 1G9MH 4Y7MA 5E1AA 5AWNH 5E8NA 5C9JA 2FIKA 4L4VE 4WO4C 1HHIB 3VXMB 1VGEL 1EX0A 5A16A 5SWZE 3VMOA 4P9HL 1BOGB 4EUPH 4NKIH 4PJ5B 4GW5B 3D6GA 5C08E 2H6PB 3C5ZD 1FFNB 4MCZA 2AXGB 5FF6A 1R5IB 1IGIH 4P9ML 3UZVB 5AD0B 5KZCD 1DQMH 2YN3A 3WIHL 1QQDB 4CDHA 3NN8A 4HIEB 1F6LL 5J7CC 3GKZA 5FGBC 3TP4A 2W60B 5FHAL 1RHHA 1CFNA 4R0LA 2F58L 3A67H 2FL5A 4U6HA 4CUCA 2BY0A 2OP4L 2DOCA 1MI5A 4MJ6B 5C0CB 2GSIA 1XIWA 3PHOB 1URLA 3PWPB 1HOCA 3PWUA 2Q8BL 4GAYA 3MOBL 1ZHLA 3TZVC 4RAHA 5IM7A 4HWZA 2EDJA 4X4YB 1A7RH 1CGTA 3MACL 5GGRA 2BNRE 4QRRD 2CR6A 3ZTNL 2BJML 1MCOL 4JO3H 3O3UN 2F74A 4ONHA 1U8PA 2HLAA 5IROA 2EYRA 4DN4L 4JO2L 2DTSA 5CSZA 2PYEB 4P9HC 5JA9A 4PLOB 5JOFB 1K6QH 4J3UA 3WMSA 4LCWB 5ALCH 3RGVD 5IWLC 1I7ZA 4S2SA 2J8OA 1J05A 3TO4B 4IRJD 3MXWH 1ZS8B 3KYOB 1Q9WB 1U6AL 4EVNA 4QXTB 2ENSA 4K55A 2XTJC 4QHMB 3RKDD 3SDYH 1V5JA 3OZ9L 5DQDH 5GISL 5AYUL 1KPUA 3MZTA 1BIIB 5GGSY 5EUKB 5BZWA 3FT4A 2RQ8A 2X4QB 4XXCA 2V5MA 1WVZA 1MEXL 1IGML 2AK4B 1YN7A 3VDAA 1VDGA 5E2TH 1A47A 1TZGH 3LD8C 1MAKA 1UWXK 1WWCA 1KN2H 2X6MA 3S3JA 5DZLA 5D1QA 4NN6C 1FVEA 2VKWA 1QBLH 3LKQB 1TJIL 3B9DA 5F3BB 1OHQA 1IL1A 4TTDD 1FLTX 3VWJB 4LHJB 5K9KA 4OLWH 4NKQB 5JUEL 1A0QH 2ICEA 4X5LA 2A74B 3DX9B 3MRRA 5C7XL 1KELH 1CF8H 4LVHC 1A4JB 5B8CC 3WLBA 1RUMH 1JPSH 4F33A 3H0TB 3MLPA 1CICB 5EOTB 3DHJA 4BQBA 2HTLC 3M17A 3SO3B 2EC9T 4DUXA 1CT8A 1RIHH 3MRLA 5D6CA 1U8KA 1AQKH 1Z9SA 4X5XA 3U4AA 4NFDA 3P9WB 4G8FB 5F6HI 1I85A 4IHOA 4M1CC 4GQ9H 4WU5B 1D7FA 3HG1E 3QDGD 3O2VH 3QPXH 4LFHD 4X98A 3SE3C 4JM2F 1J1OL 2EDFA 1KGCE 3MRCA 1FZJB 4KUCF 1L6XA 3G5XB 4BFBD 1YEKL 2H26B 5DFTA 2I9TA 3MRDB 5D7IA 5E9DE 1NMCB 1PAMA 2QBWA 3DNKA 5GRZA 2GIYA 4LLVA 1OP9A 3C08H 5SV4A 4AEFA 1CE6B 2X42A 2QQNH 5B3JE 4PJDF 5HPMB 3BPCA 2AJYH 2UYLA 3PWNA 3NACH 5E8DH 5GRJL 3PQYD 3P4OB 1MHPL 5T5FH 4Q6IC 4TUOA 5DJYB 2X9XA 4CVZA 4ORGB 3P4NA 3DSFH 4S11A 4NQEA 3KJ6L 1AE6L 4XPGH 4H5SA 5IJKC 3WFDL 1NCUA 1PY4A 3L6FB 4U7SA 2Z31D 4D9RE 4PJ9A 2XY1A 4K7PL 2NX5E 1J0YA 3T4AB 5TH2A 1EJOH 4WV1B 3ZYOA 3DO7A 5E4EC 3EZJB 4Z7UB 3FMGH 1A3QA 4PJEB 2Q6WB 2FECI 1M7DA 3GI8L 1GOHA 4FQXD 5DC4B 4ELKB 3BZEA 1LEGB 2IFFH 1GGUA 3P9MB 3U7AA 1GSMA 2EDEA 5E8PB 3S5LA 3K81A 5KSAC 4NSKA 2HFFA 3HPLB 3WKML 4RAVB 3CUPB 1MIML 2DQFB 1FZMB 1ZVSA 4R96B 2W59A 4IMLA 4Q9QH 5IGXL 1BEYH 3TPUA 1FAIL 2G9HB 4OTXH 5EUOF 1AJ7H 2DMCA 1F90L 4PRID 1JYVA 1EAPA 3G6AB 4MA1C 4LNRA 2NY7L 4LSTL 1NFDF 3MRJA 2XXMB 3WNLA 4AK1A 2CQVA 2B20A 5FM5O 5JIKA 3CFCH 4RNRA 3BDYL 4YX2H 4XPTL 3TCXA 3D18A 5JHLL 5L2JB 1EHAA 43CAB 4HWEL 4CJ1A 5DMIL 1RZ7L 2BRQA 3BP6A 1SVCP 1CL7L 1MRDL 1IQWH 3GB7B 4N0UB 1BQSA 3LQAH 2CXKA 5I8CB 1MVFA 1QSFE 4OV5A 3QULB 1TLKA 4C56D 1QBML 4U1HB 3IU4H 5JA8B 4HG4J 4X9IA 4FZ8L 5FM8A 4LLQB 1AGFB 4JZJA 2YA1A 2DIJA 2O5XL 2XZAL 3DWTA 5EBGA 2ZOKB 4PGJA 4Y1AB 4ZNEA 1RJZB 1W72B 5C0BA 1XCQB 1FLRH 5CWSA 4LRIC 3QWOA 1FNSL 4G8EA 4LEOB 5KG9B 5KVEH 3HUJB 5HGHA 3BESR 3S96B 3BDBA 2XY2A 4ZD3L 4F15C 5CJXC 3J7HA 3TCLA 2X4SB 3C60C 5DRXB 3QEQB 2DQHH 4HUMB 4LQFH 4K7PX 2O5ZH 4FFVD 4KH2A 1ONQB 4XC3H 4KK8D 1AXTL 3UMTA 2XWJB 5C0DA 2K3TA 3NCJL 3N0PB 3MV8A 4DCQA 1Z3GL 4U1MA 1VFOA 2ARJQ 3O11B 5KOVC 5E6IB 3GSNL 4MNGB 4XMKH 1EDQA 1CD1A 1U3HB 1L9NA 2GT9B 3CC5B 3HZKB 2OQJA 2OTWA 1Q1JH 4K2UL 5D96B 4F7MA 1NANI 3E1F1 3O3AB 4LLDB 5E8OB 1G7HB 4P2YA 4JGJA 4HUVB 2BNUB 5C0RL 2DIBA 4IRSA 4GRMB 3QHZH 4ZXBA 4OFDA 2MJWA 3BE1L 4DQOL 7FABL 5D8JH 5FXCH 4QOKD 3JV0A 2DKUA 3OGOE 1I7UA 3EOTL 4JDTL 5JQ6H 4GBXB 1JWSB 3FO2B 3LY6A 4PGCB 1NGXA 4GAJL 1VPOH 1U8JA 1HK6A 3ULVC 3O6KL 1JNJA 4N0CC 1AO7D 1B90A 1IZJA 3QQ3B 2F53E 1A6UL 1DN0B 4Q2ZA 1JWUB 3FFDA 2V5TA 1SMOA 4XWOD 5MERB 2BRRL 4QWWC 1NSNL 3QQ9D 5JTWA 1FVCB 4EI6B 5I1EL 2VXUH 4Y2OA 4YBHA 3RZCC 1J8HB 4NBXB 3T65B 2HVJA 3HZYA 4WTXA 1NAMA 1Z5LB 3TLRA 4PFEA 1C16B 4LCIL 5LAXB 2ZNWA 3ILPB 4P9MH 4YQXL 3D1MC 3STZA 3U46B 3WIHH 3BUYB 2EH8L 4RZCB 1ZSDA 3BISA 1UXSB 3FFCB 1TZIB 4R7NA 3MRPA 3B43A 3ZKXB 1LE9A 1YMHA 2R0ZH 3UAJC 3TIDA 2B4CC 4HS3B 4XNQB 1FE8H 1MJ7H 5IEKA 2W65A 3ZDXE 5KW9H 3QH3B 1KTLB 3QT2A 4WW1B 4D0DA 4GMTH 5BVPL 3MV7B 4X6CA 2Q8BH 4P2QB 2CO6B 4H1LA 1U8NB 3RPIB 2X4PB 2WUCH 2X1XR 5JORB 3TVMB 1RMFH 4NN5B 4AENB 4F7TB 5I1IL 2GJZA 2P5EB 1JPGA 3V5KA 1FDLH 1L4IA 4K23H 4D2NA 4UV7H 2NTFA 1FZOB 4DN4H 4JO2H 3JUZA 4JZOB 1V7NL 3WJJA 1CR9H 3O3DB 5DHVA 1JGUL 4KKAC 3QEGL 4EI5C 4HQQL 1WQVT 3SDCC 2CUIA 1WZMA 5F7DA 4Y5YC 4L4TE 3MJ7B 2YMXH 1U6AH 4ETQB 4HWBL 5DC0A 1K2DB 3OZ9H 3DMMC 3TBWB 3VD7A 4WFGD 1HKFA 3CPLA 2P48B 3HE7B 5DJAA 5JHDA 5IJVB 4NQVA 3X3FL 5F7NC 1S8DA 5BRZD 1TZHA 2AAVA 2FH6A 1MEXH 4MD0A 4P4KD 1RIVL 4PGBB 3UXFA 1FORL 12E8L 1IAMA 3MNZB 1P4IL 4L3EB 4JHAH 5L0QC 3C5ZC 3QO1A 1BJ1J 4BUGA 4UTAL 3K8MA 2C7UA 1S7QB 5IR1B 4KC3B 3O81A 4WO4B 5IW6B 2C1PB 5C07D 3C6LD 2R9HD 3FQUA 3GZKA 2CRMA 1P7QA 4MQ7A 1GIGL 3G5YA 2X70A 4PJCB 1OLZA 5E95B 2DM3A 4BKLA 2UUDH 2W91A 2JTDA 4MDJA 4HUWB 4MDIB 1G9NL 3KPOB 3MODL 4ODBD 3HZVA 2H41A 3IVKA 2A6KB 4CADB 2VXTL 4KKBD 1NDMA 1ZHBB 1PG7W 1T89A 3U6RA 2BFVH 5CHNA 3B5GA 3P73B 2ADJA 5D7LB 2MQ3A 3V4PL 1T03H 5EU3B 1RJYA 3RQ3A 5EU6D 2Z93A 1J1OH 2AVGA 3DURB 4LF3B 4JZJB 5IQ9A 3RWCB 3TZVB 3WNOA 3RGVC 3TESA 1KJ2L 1YEKH 4JZNA 2B0SL 4IRJC 4LAJH 4ZUSB 3RWJA 2YZ1A 4NC1E 1U8QB 4FXKB 5D6DA 3RKDC 1J18A 4APQC 4N1HB 3KPNB 4LRNH 4X0KA 2A83A 5DJ6B 4LDEB 1RZGA 2VLJA 43C9B 3KLSA 5DQ9A 2RCSL 1OGAE 5HYJD 4NM8H 5F1IB 4FQPA 1VB9A 5BXFA 1M71A 2XTJB 3KPTA 5EH1A 2ATKA 3K2UH 1U92B 2D7OA 5ELIA 5J1AB 1XGRA 1A5FL 4KJQD 3THML 1IAII 3DVIA 5AZEH 3VFMB 4NN7C 1NAKL 5CP3A 3BP5B 1KC5H 5HHVL 2VNCA 3RA7L 5H35A 5KBNC 3LD8B 3L3OB 4QRPE 3S9DB 2VN7A 2BXYA 5IIEA 3O6FC 1TETH 2E7CA 2VQTA 4JFEE 5DMYA 4NHUB 4NN6B 4UB0L 1CI5A 2H1PL 1KYOK 4ZFZA 5FGCB 2NTSP 4QYOB 2CUMA 3DV4B 1TQCC 3RU8H 1LO0L 1OLLA 4N0YL 1DE4A 4PJFA 2IALB 4FTVB 1C08B 1MIMH 3HN3A 3KYNA 2DDQL 3QIWB 4J4PD 5IGXH 4IBLT 1FAIH 3AVEA 4MX7A 1PG7L 1F6AA 4HUXB 1MCJA 1M05A 3F8UB 2DQIL 1D6EB 3HZMB 4LVHB 3OAYH 4GKZA 5B8CB 3PWVB 3BKML 4D9LH 3EDEA 2DQCL 4XCYA 3SDAB 4MXVE 3GJFA 3RVUD 3VE0A 2OZ4L 2X7LB 3HE6D 4R97C 3Q3GA 1RZKH 2FHBA 1EFXB 2BOBB 1KCVH 5JHLH 2AEPH 3S8WA 3MLWH 4RMWA 2DYPB 4HWEH 2Q3AA 2YA2A 5IB2A 1N5YL 3VD9A 5J13C 4ZS7L 3MV9D 2ATPA 3GM0A 4U6TA 1FSKC 1JFQL 1EUUA 1NJ9A 1NGPL 4PRHA 3TYFB 1MRDH 2B2XL 5D1ZA 1BBDL 2IPTL 1OQXA 4I0PA 2YD7A 1OAXL 1N8ZA 4LPXA 1QBMH 5DJ8A 4QT5B 4FZ8H 2VC2L 1WFOA 3QXWA 3PNWB 3PE9A 1S7VB 2R1XA 2VDPL 2XZAH 2GYSA 3QZWA 5EOQH 4E41D 4LLYB 1XGUA 3TT3H 1FL5B 3RAJH 2OYPA 1QRNE 3BP4A 3P11H 3U4EB 3I3EA 1HN1A 2YRPA 4LMQE 3QDJB 4XP1H 4Q6IB 2Z31C 4ZD3H 3GO1L 3NZ8B 3FO1A 5LQBH 3WNKA 2ED9A 1ORSB 2P1YA 2VQ1B 3FTGB 4NQTA 5JXEA 5LBSL 3UTTB 1JZ2A 3PGDB 1P7KB 5T33L 3MA9L 3JWOH 4FQXC 4WI9A 2VZOA 3VGEA 1KENL 4G5ZL 4MJ2A 4AEEA 1ND0B 2M26A 1JHLL 4WWKA 4X80L 3O2DH 3OHXB 3IDYB 3T08A 2P43B 2DD8L 1I1AC 3D85D 4FFZH 4M4PA 2DLTA 5E4EB 3ZE0E 1EVTC 1PYWA 3GSNH 4JFFD 4JN1L 4ELMB 5IKCB 3R06A 3HS0A 3TBTB 3GMLA 4OGZA 3EYVA 3EZ8A 5JHDB 1PG7X 4KZDL 3ZYJA 4TVPL 3EOYG 5C0RH 5I74C 3IKCB 3QIBA 4IOFD 5I17A 4O2EA 1A9BB 1XF4B 5HSFA 1P5UA 4OGXL 4MA1B 1QFHA 5EBMB 3T77A 4DQOH 1YYMH 2X4UB 4MGXA 3UTSA 1MRFH 3OXRA 2WLZA 1QP1A 2B8OT 5DMKB 1MCWM 4JPKH 2J8UA 1DUZB 3QUYA 5L7XL 1AGEA 3K8LA 2VLKE 2HLFD 4X6FB 1N59A 1NC2B 1A6UH 1CLCA 1KYOJ 1T7XA 4LSQL 3RDTD 3MV11 4MZ3A 1A4KB 3MCKB 1T2QL 4J1UA 2BRRH 1NSNH 4Z78A 1HH6B 1A6TB 3NFNA 3DLQR 1H3XA 3ZT6A 2PO6A 3EAKA 5KVMC 2F5AL 3BIAX 3DXAE 4TPRL 4EEEA 2OXHA 1F8TL 5IMKA 5ACLA 1E4WL 2EH8H 4WNQB 1ZHNB 2F19L 3KXFE 1L7IH 3WXVH 1WBZB 4O9HL 4FFVC 1F5WA 3B2VH 2ICES 4KK8C 1MCEA 3WSQH 2ITCA 5MEND 6FABL 3OKMA 4U3HA 4U3XA 1IM3A 4PG2A 2W0FA 4P2RA 3UJJL 4TULH 1A6AA 5A1AA 2BOCB 1CK0L 3GFUA 3R8BB 4RDQF 1F3JB 3C60B 2JIXB 3MLYL 3MLVH 2WK2A 1CU4L 4OZIF 2BX5A 4YGVB 3VXRA 3VXTA 3RX5A 3HAEB 4XBGA 1JGLL 2OR7A 3V0WL 3FO9B 5FECB 2YD2A 3BW9A 4GW1A 1BJMA 4CVXB 5KJRH 4XCNA 4R0LC 3VXOB 5FO9A 3QDMD 1T22B 1V7NH 5TQ2L 4CGTA 3H3PL 3SDXE 5IF0A 4X7TA 3QEGH 1FNGA 4HQQH 4YBLC 3D3VD 5CLWA 4HGWA 5IB3A 5E8EB 4KK5D 2WWMD 1BD2E 2CR3A 4GSDH 4FXGB 4JR9H 1UWEL 2JJTA 2Y9RT 4Z7WF 4S10A 1ERNA 3L7FB 5IMOA 2DWDB 4HWBH 2CLZA 2R1YA 2WIIB 3EFDL 1LDSA 2JJSA 4WGVB 4HV8B 2ZPKL 4EOWL 4FHBD 4O5LH 3KPPB 5ABDE 1UB6B 4OZGA 3QQ9C 4WEMB 5J12C 1RIVH 1MUJB 1UJ3C 1QSEB 5GRVK 4U1GC 3IF1A 3CU1A 3ILQD 2QJDA 5GS2D 1SEBB 3CVHA 5GZOD 3O8XD 5HGDA 4KJYA 2PTVA 2ZUYA 4RFEB 3WS3A 3RX8A 5CGYD 3VXUD 4JM2D 4J3OC 4PJGB 2DS4A 4WFHE 1ZTXH 4TSCL 4PR5B 4KUCD 3FJTA 1NKRA 1OSZB 2FZ3B 1RIUL 1ZK9A 1EK3A 2CRZA 4WFEE 1N3NB 2DLIA 2P7TB 3RZCB 5DSCA 1HSBB 4JRXB 4NO0A 5C70A 3FB5A 3KWWA 3VFUB 4L29B 4OQTL 2I24N 4MD5A 4PJIF 2QL1A 1P2CA 2QHLA 2VE6B 2Q8AH 3NCFB 3VU2A 1MPAL 1BGXL 1KJ3H 4JG1L 2OSLB 1YNKL 3UPRA 5ANMA 2PYFB 2RFXA 3V8CA 3QJHA 2H3NB 2LVEA 4P4RB 4L8CA 1DBKH 3B6SB 3EJYD 3GSWA 4FABH 4OT1L 3SGEH 3BWUC 4GXVL 1EERB 1A2YB 2MPAH 4YFLI 3GSUA 1SYSB 5B4MD 3D2UB 4UDTA 4P2OD 1NGYB 4N90E 5I2IB 5AUMB 3AUVA 1RK0A 5F6HJ 2B0SH 2NY0C 4ZDHB 1H8NA 3F12B 4NBYB 4B0MM 4WW2C 2ESVB 3EJJX 3T0DA 1G7MA 1I9JL 5GHWL 1NKOA 3LH2H 5J57B 4K8RD 1IRAY 5DUML 4CJ0A 3CZFB 3FOMA 3C5JB 4LHQB 3BP7A 3GSXB 4EI5B 4XVTL 3VFWB 3MBEA 4U0RC 3SDCB 1T1XB 2VXQL 2RCSH 1IKNC 2ZUXA 4Y5YB 4P4KC 3OKNA 4G6KH 4U1NA 4M6AA 4PRIA 3MR9A 4J8RB 4TUKL 5LWYL 4OCRL 3WN5C 3GNML 1GXEA 3DMMB 4WHDA 4MA8H 1WFUA 1A5FH 2CDGB 3MLXH 2PCPB 5TGBB 3WJLA 1PYWB 2C4FT 5KS9A 3TIEB 3KPRD 1JMZA 3DX6A 2F54D 1NAKH 3C6LC 2R9HC 1CDGA 1I1YA 4KKCC 5K33A 4P3CL 1RUAL 3RA7H 1IEBA 5TE6L 2D0HA 5D71L 3C5ZB 5L0QB 3PP3H 1ORQB 4MVBD 1HDMB 3H9SA 5KZCB 2H1PH 4RMVA 3VFSA 3C8HA 2V5RA 1FYTA 1S9VB 1K8IB 4ZSOE 4PRPE 5I8OH 3QRGH 1TTUA 4Z7VE 4GMSH 2BNQE 4ZNCD 3VI4F 3LKNB 4I0CC 5I66A 3BZ4A 3PWLB 3KLAB 4NPYB 3SE8L 5C0FB 5MEQB 1QLRB 4KKBC 5DRZA 5EBWA 3GIVA 1FFQA 4C4KO 1PG7H 4WUKL 4F2MB 1S7SA 1R3JB 4CN1A 5CIPB 1SJHB 1Y0LA 1SM3L 3BKMH 3EDDA 5IFHH 2OZ4H 3MLSL 4J1UB 1NBQA 2GAZA 3MUZ1 4YDVB 2H32B 1CTOA 4JPWL 3LKOB 4X8JB 1LEIA 2WSKA 1U2HA 1HXYB 4QRRB 1EHXA 3H7BB 1Q94B 1A1NB 1ZV5A 2FGZA 2V7HB 4MA3A 3L7EB 1MCCA 4YHNA 1H3PH 3VWKA 5ESVA 3E6HA 5IVNA 4OCWL 3ESVF 1NGPH 4GAGL 2P24A 4Z7OE 2EE6A 1LEKA 4HFUL 4Y5XC 3RGVB 3LEYL 5DGRA 1WUNT 2IADA 1KJVA 1MFAH 2IPTH 1G7JB 1OAXH 3C6SB 4IRJB 3BQUD 5D2LB 4NQSA 2VC2H 1A6WL 4AL8H 1AHWC 1AGBA 4YPGB 1QD0A 4MSWB 2WW8A 2VDPH 3X14B 1HWGB 5DJDA 5ADOL 4NUJB 5DHXB 1KIRA 1OTSD 5CEYA 1BVKA 4YHMH 1WJ3A 3W9EA 4YHLL 5I1KL 1NEZB 1QSZA 3ULUL 1BD2B 3LN5B 1OSPL 1RZFL 2G2RB 5E5UB 3JXAA 1VKXB 4F7EA 3O3BB 3QQ4B 1R3KA 4DKDC 1DDHB 1FRGH 1NLBL 2VLLA 3Q48A 5LBSH 4NT6A 2XRAL 1AI1H 4JRYD 1SYVB 3MA9H 3ARBA 4W4OA 5IVXF 4LKCA 3BJ91 5I1HL 5DEGB 1MFNA 5JO5A 1AGCA 4NN7B 5ITFA 1UYWL 3N1QC 3B2UD 4JDZA 4OM1L 1HH9A 1SJXA 4P5MA 1YEFL 4PJBF 1ZLUH 4KRPD 4I3RL 4OCNC 3I75B 4J4PC 5JOPD 1P9MA 4K94H 5IG7A 3MLZL 2Y5TB 3X3GL 5D5MF 4JFYB 4UT6L 2R2BA 4GQPH 1D5XA 3WKNA 1MI5E 1UC6A 2NXYD 1TQCB 4MLSA 3RVUC 3AU1B 4TVPH 4E5XA 3HE6C 2CH8A 5J56B 2LE9A 4U6VL 5HYSA 3U9PL 2Z92B 4X6BB 4OGXH 2O5YL 3T1FB 3MA7B 4D8PA 1EEZA 2CGRH 3GJEA 3VXSD 4KJYB 2V5SA 3W0WD 1SJEA 3WNMA 5LGKA 3QDGB 4ONGH 1BOYA 3ARGD 4MA7L 1EMTH 1WAAA 5ICYB 2ZSWB 4XVJH 1BP3B 2FSEB 4AMKL 2VDRL 5DLMH 3NCYS 1YMMD 1S9XB 4QGTA 1NCWL 4ODVL 3STLA 4U1JB 1KCSH 5D7SL 4LHUA 1LE5B 1CBVL 3GMOB 1FSKB 5IK3B 1NBYB 1MCHA 1EZVX 1AR1D 3X11A 2FYYA 2BK8A 4KROD 3BKCH 3PQYB 2F9BT 4XXDA 1JWMA 3B9AA 1W72H 4NO3A 1LO4H 4TPRH 5GS1C 1ODAA 1UQSB 4P3DA 4HCRA 5F9OL 2XTLA 2KKQA 3NFSH 2YN5A 3SE9H 2YRZA 1TDQA 3PL6D 1OD7A 1FFRA 5KANI 3KDMB 4I9WD 2O61B 4KAQH 4PJEF 5BQ7B 3VH8B 6FABH 2Z31B 1HINH 4AEHH 4MS8C 3DGCR 1IQDB 4NUGL 5T1DH 4HX1A 1VFUA 1RZ8B 4MB3A 1RZIB 5EPMA 1AP2B 1MNUH 4UV4H 4XPBH 1U91A 3V6OC 1CLZH 5EWIH 5DJXB 4RMUA 2EO9A 4FQXB 4JY6B 3HRPA 3FOMB 4NNXA 2A9ML 1JGLH 2QSCH 3QUMA 4RX4D 3V0WH 5DRWA 5EA0L 1JPFB 3M45A 3EOBB 3SOBL 3S37H 1E4KA 4DVRL 4WDIA 2KL6A 4YFLF 5DDHA 3EOAB 1K5NB 2IG2H 2Y23A 1I1AB 1EEQA 3AB0C 4IOFC 5TQ2H 3H3PH 3L1OL 4HIIA 1NGQL 1BZ7A 1T1WA 2F15A 4A6YB 2Z35A 5C71A 3OBAA 4M1DH 5GGSB 1CZ8H 3MYJB 5GIRB 3GUTA 1S3KL 2UVFA 4LDOB 1QO3A 4XPFL 5D2NA 5GGQL 1PKQA 3EFDH 1WIPA 5J11C 4KPHL 2HLFC 4KHTL 1JTOA 1OPGH 2P46B 1DQTA 1KCUH 2ZPKH 3GSVB 4KI5E 4PJXB 5D7IE 4XHJD 3ZTJH 4EOWH 1JPTH 4GKOA 3RDTC 2IBGA 3HRZA 2MKWA 4PTUA 4ERSL 2VTFA 2FRGP 2WMPA 4LPCA 1T2XA 1GZQB 1PQZA 4B50A 5HHQB 4I18A 3OKYA 2GFBA 3VFPA 3CSYB 4C56B 3OSKA 3O3EB 5TPWH 3LRGA 1QLEL 2OLDA 5C3LD 5F7MC 2VAJA 4GRLD 4B53A 1S7TB 4NKOA 5LKNA 1MCNA 1RIUH 3KLHD 4E0RA 4NQEE 3WHXA 3QXAB 2XNAA 5EU4B 3TGXA 1HQRA 1W0WA 3DROA 2LU4A 3Q6FA 3CDGB 2HN7A 1KB5A 2GTWA 5F8RC 4OQTH 4PLNC 3N9GL 5C09A 3FRPA 3OKOB 4LSUH 5GGVY 1NCCL 3H9HA 4V1DA 4PP1D 2FBJL 3CCHB 4UAOC 1YECH 4XVUD 2DQGL 3BFOA 5ICZB 5J6HB 2CLRB 5HYJA 4GKSA 1Z0NA 1TXKA 2VH5L 4MMXC 1H3UA 4HMCA 1E4XL 3LB6D 3VRIA 3MRKA 4NZTH 1KG0A 1IKFL 5EG6C 4P23D 4BZYA 1WC7A 4XZUB 2PUQT 2Q7YA 2MCPH 1W2KT 3U0PB 1BREA 4KHXL 2M2DA 4JREC 1IGJB 4O2CA 2HJFA 2Y7QB 3TC9A 4KQ4L 3NA9H 4Z8FH 4KK5C 5KSBA 4WUUD 2ERJC 4OLZL 1BM3L 4KRMB 4TUJB 2YSSB 2CUHA 4J3XA 5GHWH 5JLZA 4M5ZH 1YPZA 5KOMC 1GGYA 3IFOB 4XVTH 3HA0A 4YBLB 5JW5A 4QOKB 5DO2C 2VXQH 4HWUA 1T04B 4OLUH 3BHBA 3IDGA 3I3DA 5K93A 1G6RB 1ZEAL 2GJ6A 1ZMYA 1CXFA 5EU5A 5DUBB 2YD3A 5CBAB 2HMID 5IFAL 2EE3A 3ILQC 5LWYH 5BW7A 1AO7B 3GNMH 1T5WB 5GZOC 3CK0L 5CGYC 5E00B 4JM2C 1UB5B 4XT1C 2UVEA 3F7VA 3IAPA 3IJSB 5ETUB 2QQKH 4X99B 1KLFA 5J12B 1EO8L 3TBVB 5EZLA 4KY1H 2V5YA 1FGVH 1DBAL 4ZNEE 3N1GC 1NH6A 5IMLB 1UJ3B 3SEPA 4NRYA 5IB4A 3FRUB 4U1GB 5C0BE 1RUAH 5B3JF 3TYGH 2BHUA 3IDIB 4ZYKB 3M1BB 5D71H 3MV9A 4WHTA 4JN2A 3NFPA 1OAZH 5I19L 1OT1A 3LDBC 3U2SA 4NO5A 3N1FC 5IB5B 3F58L 4TNVK 3PP4L 3JZ7A 3SE8H 2P8MB 3EHBD 4HS8L 1CXEA 2G60H 4CMMB 2PKDA 5JW4R 5E24E 4NQCA 4NP4L 3LSOB 1D5ZA 1RJLB 2HRPL 2CKNA 3ULUE 3EJYC 3SPVB 5CMAA 1SM3H 1A3RL 4Z76B 5IESH 1DSFH 2XQBH 3MV8E 5B4MC 3MLSH 1D5BB 4P2OC 3I6KA 1T20B 2Q76A 1IARB 3SBWA 2CSPA 5MP6H 1EPFA 2H9GA 4HKZA 1G0DA 4Z18A 2RIKA 4JY4B 2VKXA 1A7PL 4YHOL 5IVZA 4WJ5A 1FNEB 4HDIA 4K8RC 2CK0H 3SJVD 1R24A 4OCWH 4UQ2A 3VDBA 2BY3A 3IYLW 3L5HA 2WP3O 1X5JA 2V2WB 4HFUH 5JPNB 3OAZH 3GBLA 3JWNC 5I1LB 4WFFD 4Y4FA 4CN6A 2NY0B 4HUNB 4M03A 4XCCL 5T1KD 3KNBA 2XYCA 4WW2B 5HHOD 3LPWA 1P5VA 4N9GB 2ZOLA 4RGND 1I3RA 3Q1SH 2WBJD 1ZWIB 4ODXA 5ADOH 4M9PA 5GS0L 4U0RB 2VDLL 5I6XC 5I1KH 4PJAA 3MGTB 4X7FC 5BRZB 2APXA 2CJUH 4D0CB 4L8BB 1K8DB 4P4KB 3SHSA 1OSPH 4GUPB 3MO1B 5IHUL 1OVZA 4H88L 1MWAA 3U36A 3MRHA 2CK2A 3OJDA 3V4UL 4GRWB 3WN5B 5D1ZC 4PREA 3UDWA 2RHEA 2Y36L 1FPTL 4MVBC 1Z9OA 3AS3A 5DS8A 2HKHH 5FYKD 5I1HH 4QHNB 1GYAA 1NEUA 1D5MA 4QHKJ 5C07B 2EDQA 3C6LB 2AXFA 3WXWH 1UYWH 3ARWA 4OFVA 3DX8B 4OM1H 5ADPH 1QLFA 5F97E 3I6LD 4LKXA 2YC1A 3X17A 2NXZD 3EGSA 1TVHB 4X7CC 1QZ1A 4Z5RB 4G80B 4XNYL 4BH7A 5ESAA 4HBCH 1TVBB 4R4BB 3TA3D 1KCRH 3FQNB 3ISWA 4MD4B 1WV7T 1RAMA 3CDFA 3UTPE 4X6CE 4BSVA 5CEXA 1GGTA 3U1SL 4XAKE 3EBAA 5H8DA 4U6VH 4X9FA 4HJGA 4KK9D 3ROLA 2MQ0A 3U9PH 4P46D 3FQXB 1MOEA 2GW5A 2R56L 4XB7A 2GTZB 5GPRA 1GRWA 3CFKA 3ELAT 4OD1L 1S9YA 3J8F7 1QNZL 2AJ3B 1RD6A 5EU6B 4LU5L 1JF1B 1CFSA 1UKTA 3KYAA 5TDOA 5MENA 1ED3B 4AMKH 2XPGB 2BXZA 2PTTB 1NCWH 3BQUC 4KMLB 3VI3E 4P5TA 3P40A 4ODVH 4OKVA 4JANA 3QNZB 4LPWA 4WCYL 2Y25A 2R4SH 4EUPA 2ZCHL 3HI1B 1TJHH 4GG6B 1DVFC 5IVOA 4JFDD 5FKAA 1OTSC 4Y5XB 4I3SH 1CXKA 3ZLQC 4YUEL 4JQXC 3L3KA 1P6AB 1LK3L 1Y18A 2NZ9D 1AD0B 1T4KB 3MUHL 5T5NG 1BF8A 1AHWB 2R29H 2IH3A 5IEHA 5DFWH 2IBZY 4H25A 1D5IH 3PV7A 4MAUL 4G3YL 5ERWB 1MHEA 4XP4H 5I71C 4XBEL 1XR9A 1IFHL 3QBTB 5TDNB 4CW1B 2Z91A 4NDMB 3GMQB 4LQ1A 2Z8WC 1JUFB 3L5WA 1I7RA 1NL0H 5DJ0B 3DIFB 2NY3D 4PRBA 1NGZA 4RA3A 5E5MA 5JPMA 1QBBA 4L3CA 1U3YA 1YPZB 3LS5L 2ZG2A 4Q9RH 3GHEL 5EA0H 5ID0B 1JTPA 4LMQI 3DO3A 4DVRH 4G9DA 3O8XA 1C5CL 3CFEB 2DLHA 4XVSL 5C6WH 4HKBB 5HHMD 1NFKA 1FZKA 4HUUB 2HFGL 3W5MA 3L1OH 2C3VB 3QNXB 3S35H 2YPLA 2F8VA 4PJHA 2QSTA 2X4NB 3GMRA 2ARJA 3ARGC 3ARFD 5JIHA 1Q9OA 1Z2KA 3ZDXF 1N0XL 1U3ZA 4OZ4B 3HE6B 2D31B 1DQJB 3CVHL 1J5OL 3V7AE 1OAYL 5HVGB 4PBWD 1FH5H 3IAQA 2C9AA 3RWHA 3MJ8B 1BBJB 2C3HA 4JHWL 3PDOB 2CKBB 2UWEA 2GUOA 2VABB 1OARH 5T1LA 2VITA 4HMEA 1AR1C 3UBXB 2XT1B 4KROC 2VLJE 4XMPH 1YY8A 1JNNL 2DBLH 3WE6B 3ZKMD 2JJTC 2NY5L 3QDAA 2EE2A 2YUXA 1GPOL 2VB5A 4MQXD 2YKLL 5H94B 1FL6A 1RK1A 3LCYA 5A2FA 1T0MA 4ZPVB 5DVNA 4E41B 3BN9D 4QKXB 5B39A 4YWGL 3PL6C 4A2MA 3DYOA 4G7VL 4YEFA 1H0DB 4X6DB 3FB8B 3N9GH 5GS1B 1R3HA 3V9FA 3N85L 3MUGB 1N6QL 5CBEA 2N7BA 3QFJA 1HYRC 3RJDA 1PLGH 3K74B 3ZE1E 1YDPB 5HTSA 3KJ4C 3MRIB 1E4XH 1U8IA 1H3TA 3RZWA 2Q86B 4PJFE 4QHLB 3TBSA 3D85B 5F3HB 4AT6B 1UEYA 5MEPB 2LVCA 3NTCH 4MMZC 1NCAL 3QHFL 1BX2B 4JFFB 1RVFL 4H20H 1F13A 1VEMA 5HY9A 5FHBH 1MAMH 2V2XA 4UOW0 1ZXQA 2JJWA 1ZGLA 1ZT7B 4QRUB 1TFHA 1VGKB 4J6RL 5FUOL 3VXNA 3AB0B 4JDVB 5BS0A 4H26A 4PY7A 4LLWA 1YEIL 5L2KA 3BUTA 4XHJC 3B9KA 5D9SB 5GJTH 5EO0B 1KTDA 3EO0B 4UDUB 1RFDL 1H15A 5C0AA 1ZEAH 3NIGE 5DD1L 4PRHE 3VFRA 3IDXL 4M7JL 3C5SA 4MWFA 2R1WA 3MOAL 2RGSA 5J11B 5TE4L 3MGOB 3WDJA 3P0VH 2EICA 3VGAC 4ZUWB 1TTFA 3RDTB 3ULSB 2VXVH 4GRLC 5FA4B 3ULVH 4FQCL 1AD9A 2ZJSL 1MLCA 1EO8H 3KLHC 2Q1EA 1FL3A 1DBAH 3BGAA 3PABB 3DV6A 5LVEA 3CNKA 4PB0L 2R0WL 2B7DT 3EYOB 5ALBL 5EORH 1OM3H 3MMEA 2NW2A 1A7OH 1EGJA 4H0HB 1T7ZA 4EIZC 4LFHG 2I26N 1DUYA 4PP1C 3GJFH 1OL0A 2YRLA 3OPZL 4XVUC 1CCZA 2CDEB 3PP4H 1U8HB 2YWZA 3E3QC 1RU9L 4UUJB 1KLUB 1IGTA 3IU3B 4DKEL 1E28A 4P23C 4Y2DA 5DEZA 3EYUL 3FB6A 1MRCH 5I1DB 4UAOB 1UG9A 3HLAA 5FYJD 3DRTA 4BQCA 3GGWA 2B4CH 3O41B 5CEZD 5IV2A 4DN3H 1S9WA 1MHHB 4XP9H 1UM4L 1FIEA 3SCMD 1Q0XL 3OR6A 2OBGA 3L3KB 3OKKB 1V7ML 4GXUN 3QDMB 3RNKA 3A6OA 3RVWC 3EW3B 1OCWH 4JREB 1XF3A 4OZHA 5IEHB 3GSRA 3D3VB 4K3JL 3UTSE 1NCBL 3HKFA 4TQEH 3FZUC 2ERJB 3MUY1 1OQOA 4OIIL 1F00I 3JUYA 4RGOL 2HMIC 4ETYA 2J8UE 4XX1E 4MXVF 1WFNA 3FB7B 4BSWB 4LARL 4IJ3C 4FS0A 1Q0YL 3DOSA 1LK2B 3MTRA 1LO2L 1INEH 5MHSD 3GKWL 1UM6L 5DJCA 4Q74A 2QQLH 4W70A 1A3LL 3VWKC 3P4MB 4QGYA 2DL2A 3IJHA 4LCCC 5F89A 4CN4A 3QEUA 1A1MB 4H88H 1L7TH 3RL2A 3V5HB 2E8YA 3U7WL 3LEVL 4OF6A 5AAWA 4PUBL 1J0IA 3KYMB 3L5XL 3VXUB 4JM2B 3GM8A 4XTRD 1BFOB 5SWSA 1F58L 1ZA3B 2JELL 4OCYH 3V5DB 4FQIL 5EIIB 2XFXB 3QXDA 3EHBC 2WWKT 4AH2B 2ID5A 2IAMD 3W39A 2N7AA 3DI2B 4PJDB 1YA5A 4P2RE 3NGBC 1ITCA 3LDBB 2YD9A 1E6JH 5HYQB 4ZUUA 1R6VA 2BSSA 2ZCKL 3V0VA 3HPJB 3U7YL 3VXRE 4HK3N 5CIPH 2DBJA 1MLBB 2ED8A 3VFOB 2QHRL 1EHNA 3RTQD 4UU9A 2NW3A 4BZ2H 3OX8A 1O5DT 4IM8A 1MVUB 2AQ2A 4NQDA 15C8H 1FV1B 3QSKB 1ETZB 1J8KA 1T21B 4S1QL 1H5BA 1P4BL 5KAQG 1PX3A 2G5BA 4P2OB 3I2CL 3G04A 1T0MB 3ZE0F 1WEJL 2MOVA 1CLOL 4NJ9L 4WI6A 1S7XA 2E9IA 5SWZD 4HCRL 5F7WC 3BH8A 4RGNC 2WBJC 5H37G 5C08D 5I1JL 3QUZA 4IEFB 1MF2L 3REVA 3WHE0 3PJSA 2FX7H 1R3LA 4D0BA 2VXSL 4YUEH 4PV9B 3A6BH 4OZGE 4QO1A 1LK3H 2AV7A 4Y16A 1RUQL 5EUOB 2BC4A 5JMOC 1ADQA 3BZFB 5I73C 1MCSA 4JCMA 3NCBB 4JFPA 4RAUB 1FVDB 1NFDB 2ICCA 3E6FB 4QRSA 4NKDA 3WLWD 3PIQB 5DK0B 3QUML 5I6XB 3FQWA 3KPRB 3VXQA 2Y1VA 3D0VA 2F54B 1YJDL 2V17H 3FCTB 5JDSB 1HHHA 1S7WA 1IEHA 2QKIB 4NOFA 4PJ7A 3VW3H 1R5WB 5I1GL 3KPMB 1P1ZA 2NXZC 4ZTPL 3WFCL 4OD3L 1BWMA 2BNRD 4PJ8A 1V3LA 2AJVH 3MNVA 4OBRA 4RIRB 2D03L 1Q9KB 3TA3C 3MRQA 1XF5A 5CKAA 2JB6A 3WEXB 5CZVL 5BZDA 2ADIB 5GRYA 3PGCA 4EN3D 4NWTH 3B83A 1WIUA 1IAOB 3UJTL 2E5EA 1BQHA 3MJ9H 4XVSH 4KK9C 1REIA 5ANME 4IIQA 2HFGH 2BVYA 4P46C 1KBGL 3JTTA 4JPIB 1UACH 4LL9A 2VL5A 3ALPA 2SEBA 2XN9E 4ONOA 5E08H 1LHZA 4PV8B 2YUVA 3VRJA 5HHXH 4K3EH 1E4JA 5AZ2L 1SBSH 3MREB 3P77B 1U8LB 3QIUA 2PW2A 3CVHH 3O4LA 1X7QB 4QF1B 2FEEI 4UOW1 5DRNA 5TDPB 3OB8A 3RWDA 4JHWH 5K9OB 2ADGA 1F4HA 3S36L 4QCIA 5E2JA 5JXAL 4QRQB 3IDMB 4ODWB 2DM2A 3SDXF 4M5YL 1KB5L 4YHIB 3UROR 3CFDB 1FFOB 3FT3A 2XA3A 3JV6B 3BQUB 2OTUA 4KDVA 2NZ9C 4S1SL 1JN6B 1GPOH 1JGEB 3C8KA 4LHUG 5T1MA 3AGVA 2IMMA 5ISZA 2VZ1A 1DVFB 3OB0K 5CINL 3CFJA 3PHQB 4EQ3A 4YR6A 3BWAA 2V9QA 4ZFOA 1F45A 5DD5L 3E3QE 4LSSL 2DB8A 1X5LA 5E2WL 4G7VH 5KS9E 2DWEB 2MTPA 4JO4L 3BD3A 2PTUA 5F9JA 1MJJA 3BPLB 5F1KC 4UQ3B 3SY0B 4DOHB 1AGDA 2NY3C 5JNYA 3ROOA 1IM9D 4G8IA 2FO4B 3FQRA 4JRYB 5D7JD 2QR0A 3H9SE 5I71B 3X12B 1FYTE 3HG1D 5HVWA 2A6DB 2JB5H 4LASH 3T0EA 1YEEH 1KGCD 3BVNB 2FGWL 2ICWJ 5DI8B 3LEXA 4NO2B 4BYHA 1WBYB 2EZ0D 2EKSA 5E9DD 4JHZA 4F9LA 1YEGL 1NCTA 3UTQA 2VDQL 4AQ1B 3V6ZA 3ARFC 5D1XA 3C2SA 4NNPL 1VEOA 3E2HC 1L0YA 3AXLB 2BVQB 3OKLA 5TE7L 2ZKHL 3K4ZA 3CVIL 2FHFA 8FABB 3P3YA 4L9DA 4YEEA 5HHPB 5B3NA 3SKJL 1YEHL 1INQA 3VXSB 3W0WB 4NJAL 1ZA6B 4XBPA 5A43C 2IPKB 1RFDH 3ARGB 1JNLL 5HD8D 4EDXB 1UJTA 3K1DA 1IC4L 1GGIH 3VA2C 3GI9L 5DK3A 5F72S 1HIML 1YMMB 3S36X 1BQLL 2X41A 5TE4H 4D9RD 2QADD 4CVWA 2IANA 3ZKMC 2M8XA 5J6GA 1JRHL 2NX5D 3HFML 4MQXC 1QFWI 1BAFL 1EUTA 1KT2B 4BUHA 3ARDD 2ZJSH 2X89A 3BN9C 3TO2A 4MJIA 4QY8B 4KROB 2FLBT 4JFXB 2R0WH 3RWGA 2YD1A 5ALBH 4PRNA 1I9IH 2FJGB 3HI6L 1IGCL 4HIXL 5I1AA 1V05A 4JQVA 4PY8I 2EH7L 2AABL 3IFNL 3EDKA 4HKXB 4KVNH 3ARYA 2JK5A 3GSOB 2N56A 1IT9H 2GSGB