4OV5B

Structure of hla-dr1 with a bound peptide with non-optimal alanine in the p1 pocket
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Susceptibility to HLA-DM Protein Is Determined by a Dynamic Conformation of Major Histocompatibility Complex Class II Molecule Bound with Peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 189
sequence length 189
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ov5B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ov5B01
3K0WA 4Y2DA 4JO1H 3K1DA 2MNUA 4HLJA 5C08D 2R4SH 5IHLB 3GMPB 1N5AB 2ICCA 4M43H 5E2VL 3DX8A 1A6VH 2Z9TA 5F1NB 3SDDA 3QDGA 2F54E 3AS0A 4XPHH 1IBGH 5FGCE 3HZMB 3MACH 2OS7A 1ZVHA 4P2RA 5ACMA 5I75C 2WP3O 4X4MA 4GKNB 5IFAL 2YSSB 5FA3A 5TFSH 3UTSD 5HGBB 5IB2B 2G5BB 3QQNA 1DQML 4G8GB 2OJEB 3ZYJA 3VXME 1SEQH 1QFWM 5EBLB 2AEQL 2AXGB 3MLZL 3NA4A 3DV4A 3JWOL 4LEXH 1SJHB 2LV4A 2G2RA 3JV0A 1OGAB 5F6IC 4WVRA 3PABA 4EDXA 1G7LB 3BP4A 3P4MA 5H37G 3S36L 1A7NL 5DHVA 1OD9A 2EYTA 3PHQA 3VU2A 4PJ8D 5B8CB 2VSDA 1S9VA 2D3VA 2MPAH 2AK1L 5DVLA 3B9KA 5D7JC 5DEZA 3O8XA 2VDLL 3DMMA 4MS8D 5KW9L 4Z0XB 2ADIB 4LLWB 4C56A 3DV6A 2V5SA 3PP4L 1E4XH 4PJGB 2VN4A 3IJHB 2R0LL 4LU5L 1F11B 4XBGA 2C3HA 1M6OA 2MJWA 5GGVY 4QT5A 2BZDA 3IJYB 3S36X 3LIZH 4U1LB 2J2ZA 3IU4H 4I0CC 2AXFA 4D3CL 3T2QA 5BVPL 4FFZH 1UCBL 4U6VH 3VDBA 4RGNE 5FDWB 1BQLH 4FFVC 1KN4L 5J1AA 1HSBB 5DEFA 3IFNL 5DEGB 3OHXB 1JYXA 5TJWK 3C8KB 5I1HH 2EDEA 2AI0H 3T3MF 4ONFL 3SE3C 3DX9A 4MD4B 1FFOA 4EXKA 2HMIC 2RAMA 1CDGA 5I1DA 2VDPH 3HE6C 3V52H 2ICWI 5F9DC 3RWDB 43C9A 2EC8A 2ZUTA 1W8NA 1U3YA 3MJGX 1PW3A 2DQCH 3MBEC 1OY3B 1M7IB 3X14B 3WIHH 5CBAA 3I2CL 3ZZ1A 1XCTB 3LAFA 2E3VA 1NCBL 3C6LD 3O9WC 3RVVD 4KKLC 1PYWB 3QNZA 4U6HB 2O93L 1N7ML 2Q8BH 5EORL 4WWID 1UYWH 4N0UE 1YZZA 2K7QA 4Y4HC 4M1GL 1Y0LA 3FO2A 3HC0A 2F8XC 4OI8A 1J0YA 3F62A 1T7ZA 1NCDH 5BQ7A 3BZEB 1UM4L 3QP3A 1MNUH 3AM8A 3TA3A 3W5MA 5FYKH 4YFDB 5FF6A 2VZSA 4C83B 1P4IH 1MCPL 3L95A 3TCXA 1XF4A 2FECL 3O11B 5DMYA 4LAJH 1N4XL 2W0PA 1J1XH 1KELL 4GAJL 5ITFB 1F02I 4DKFH 3OKDB 5I0ZA 5JDJA 2VITB 1OQXA 1OP9A 3NZ8A 3VD7A 4Y19B 1KCRH 1UA6H 4KK9D 2K3TA 1G7JA 2JB5L 1CE1L 1FL6A 4G43B 2BNQA 4OB5H 4KC3B 3BAEH 2YR3A 2XG5A 4F7CB 2NW3B 1F13A 2HWZL 4XXCC 4YUEL 1RZGA 4OV5A 3J7HA 5HDQH 4G8GD 3FQRA 3QUXC 5FKAA 1J0KA 3GMRB 1NLBH 1ACYH 4KPHH 2OZ4H 4CNIA 4TVSa 3WNNA 1U8MB 5CEXB 2OP4L 5E4EB 2IALA 1EA9C 2A6KB 1OGAD 5KOMC 4K8RH 1O7VA 1F4XH 5F89B 2LU3A 1OCWL 4ZFOA 2ZCKL 4DOHE 3O2DL 4CVXA 4CRPA 3NACH 2R4RH 5AYUH 4CDGC 5HGGS 5CEYB 2YD8A 1JZ8A 5GSVB 3UZEA 2NY6C 3MFFB 2W9DH 4DKEH 1KLUB 5E2UH 5ACLA 4CN6A 1YN6A 1JUFB 4RFEB 2LQRA 5C07E 1YEEH 1KTLA 4UILL 4KZEH 2XICA 4JFFE 4LHQB 4ORGA 1ZVSB 4LBEB 4POYA 3DX6A 3GMMB 4L8SB 1ZLVK 5H35A 3PF2A 3Q5OA 3CX5K 1LO0H 4UMGA 2QSCL 4Y1AA 1U91B 5IBUG 2E7LA 4RMQA 3DGCR 3OKOA 1I3VA 3IRPX 4XC1H 4NZTL 4HEME 1NLDL 1Q38A 3P4NB 4PRHE 2J8OA 4X9FA 1JYNA 5I1LA 1JGDB 5ADOL 3QCVH 4JG0H 4Y16D 2MKLC 1XGRA 3GEWB 2R8SL 3ZTJH 1I1FA 4NO2B 4HF5H 1TJGL 3F7YB 3AS3A 5DVNA 3JZ7A 1WCBB 3SDXE 2A74A 2CKBB 1WAAE 2XWBB 3PWPB 5INCA 2D31B 1EPFA 4OZHA 1P1ZB 1KLGA 4FHBD 4P5TB 5DMGC 4L4TE 3BRFA 4OF3A 1KIPA 4F58L 5FGBA 5KAQG 2EDRA 3H7BA 3HS0B 3I3BA 3MNWA 1F2XK 2BERA 5TGBB 4PJHB 1GZQB 1BVKA 4JPWL 5LCVL 3VRIB 1ORQB 3RL2B 1K85A 1FZKA 4NBXB 4XPTL 1KSRA 3CD4A 3QEQB 3G9VA 3LOWA 4XP5L 4E0RB 5FK9B 1N0XH 4X6DE 4JO4H 1DLFL 3SE4A 4E42A 1H5BC 2FGWL 5BV7C 5EO0A 1KPRB 5HHME 3WUWB 2O61B 4YHZL 2PXYC 3SKNB 1EEZB 1S7SB 2HTLD 4P4KA 1H15B 1KTKE 3PDOA 1HQRB 4NDMB 3WO3B 3QEGH 4O9HL 2E7BA 2CRMA 4OLUL 5D8JL 1QEWA 4JGJA 2C1PB 5DLML 5GGRY 1X5LA 4KQ4H 5HHQB 3VXSE 1YC8A 1UJ3C 4PJDE 3L3KB 5FYLH 4QO1A 3BSZL 1DBJL 5FUOH 2NTFA 2WBJC 1JZ6A 5FCSH 3SDAB 2ITDB 4HQQL 4A6YL 4OCWL 4PS4H 4F15B 3KPNA 4ONHB 3U6RB 4WTXA 2D2OA 1ZEAL 3NIGE 1T21B 4NCC2 1DR9A 1RJZB 4Z7QF 5EO9B 1QRKA 4X8JB 4JFOB 4JRYB 1QYGH 3UDWC 1JK8B 5DUBB 1FFPB 1Z0NA 3T0EC 1TCMA 5KVEH 1RUKL 3GJFK 3CXDH 1PLGH 2VWEE 4OD3L 5D71H 1HDMA 3PWLA 5DFWH 3QFJB 1OOAA 4YE4H 2DWDB 2HLFC 3HI1B 4XHJD 2Y07L 4AK1A 3G04A 1CICC 1VFUA 3P0YH 5EU6E 5CZVL 4A2MA 1MEXH 5DHYA 1XAUA 1YYLH 5J06A 5GZNC 3WL9A 1XCQA 2P24B 1BZQK 3MLYL 1MCQA 3ARQA 3TIDA 5DMKA 4AIOA 3BYTA 3ULVD 1CN4A 2X5PA 3NFPB 4UB0L 3NAAH 3WS3B 4E41B 5I9QB 1RY7B 1Q9KA 1JNJA 2VLRB 3G6JB 2R2BB 4TRPH 3L3GB 2BVQA 1FLRL 3KJ4B 2M8XA 5GGSY 5JW5A 3R8QA 3NABL 3AUVA 1ZHNB 2FO1A 2NY1B 1D6EB 4AG4H 4GXVL 3IDXL 2B1AL 5DUMH 3JWDL 3WN5B 2Z92A 1T20B 4JO3H 3TYGL 1Y18B 4X5WB 2R1YA 1Q0YL 3BKJL 2R0KH 4QNPF 4QRSB 5TE4L 1R0AH 5I2IA 2BY2A 1A3RL 3UTTE 2XIDA 4HEPG 4LMQE 2C4XA 1L0YA 1N26A 4B7LA 2IG2H 4JQVA 4MXWH 1FNLA 3QHZL 4XPAH 3VD3A 4YDVA 4KI5E 5IHZA 1FORH 1X9QA 3MV9D 3QUZB 5F1KC 4ZFZB 3DRQB 1NCWL 3CFDA 5I0DA 4GAGL 3QI9C 1GC1C 4NZUH 4P2OB 1WEJL 1B88A 2QLVB 3TEUA 1RIVH 2H6PB 3WDIA 1CCZA 1S9YA 3QEQD 4H26A 1G6RA 4WFHE 2QQQA 1M7XA 3ZL4L 3QRFM 2IAMA 4X0KB 2JELL 3RY4A 1J8HE 1L0XA 3KYOB 3MBXL 4LLUB 4KGLA 5IMKB 4MQSB 3S4SA 3RPIA 4GRWF 5IVXB 3E6HA 3HI5L 3C6SB 2CDFB 1UWGH 5EBMA 4PJ9B 4V1DD 5C0GB 1WBXB 3EJZD 2DDQH 1DBAH 5C70A 5F97E 5DK2A 3U0PB 3EJYD 3OXSA 2Y5TA 3EOBB 1UB5A 1BHGA 2VQTA 1QACA 4XMPH 3MLUH 4NJAH 4KVCH 3U4BL 2C4FT 4NN7B 3NZHL 4WUKL 3WFHA 4I77L 1KCSH 3TCLB 4HK3N 2Y5EA 3SDAD 1CBVL 4YHNB 3D3VB 1RJYA 4G7YH 4OLVL 4KZDL 4Q6IC 1J5OH 3CSGA 1ROWA 2WIMA 5IVZB 2J8UE 4TSCH 4ZAKB 4PP1C 3IDYC 4JRYD 2X09A 3RPKA 1FBIL 3ZO0A 3OTTA 4Y4FC 4PUBL 3CX2A 4XXDB 4BFBD 5GHWH 1X5JA 4U31A 3MODH 5HVGB 4OFDA 3ARPA 1IGCH 3TPUA 4JJHA 3EYFA 4FQ1L 4UUJA 3NCJH 2I07A 5GIRB 3Q6FB 2AKRB 4LPYA 1EMTH 2GTZB 4XP4H 3SDCC 3DX8B 4LSQL 1GYAA 2AXJA 4HFWA 1A7RL 1FNGA 5BW7A 4AEFA 4P2RB 1WFUA 3IXTB 5EOQH 3ZYZA 3UJIL 4K9EH 1NFIA 4W6YB 3CIQA 2FD6H 3Q5YA 1IKNC 4E41D 4ZSOB 4M6AA 5F3BA 4NNPH 4I3SL 5CSGA 3DV4B 1FL5A 1AC6A 2IJ0C 2G2RB 4JY4B 1T3FA 5LWYH 1IM9B 4XNYL 3HNSL 3BP4B 3O41A 3P4MB 4LSVL 1SBSH 1U8OB 5DHVB 2EYTB 3PHQB 1IM3A 3RY5A 3NCFB 3LKQA 4K23L 4P0DA 4H25A 1AO7B 2VXUL 2NXYB 2EDDA 3C60B 2NYYD 4J2XA 1ZMYA 1AIFB 1TZGH 1KYOJ 1I85A 3CVHL 4LCYB 4XBPA 4NQSA 4U7SA 3U2SA 2FHBA 5F71A 5CEZE 2DM2A 1XR8A 2AERT 2RIKA 3A67H 2HFGL 2GFBA 1UZ6E 1RMFH 4HDIA 5EWIL 4BUHA 3BJ91 3UXFA 1UGNA 2E7HA 1MFEH 3QUZD 5I8CA 1AD9A 3WEXB 4FQJL 4YBLB 4KJQC 5ESQA 5BJTA 4P2OD 5B38A 1F3RB 1WF5A 4LCCC 5J1AB 1RURL 3LB6C 2HH0H 4FFWD 4LHUG 3TM6A 2GEEA 5D7KD 1KV3A 1ZHKA 1BQSA 3VWJC 4RAUB 4OLYH 4W4OC 4NRXA 2HRLA 1MWAA 2BVPB 3N1GC 3QRGH 43C9B 4N8VG 4LGPB 3O6FA 4UV7H 2VXQH 4DK3A 3OAYH 4M6NL 4HFUH 5E2TH 4PJ9D 1EEUA 3VMNA 2ZCHL 5CBAB 1GL4B 3GSXB 4RBPH 4HC1A 2DQUH 2O5XL 2ITCA 4C55A 3VW3H 2WWMD 2IGFH 3R0NA 4P3CH 3ZDXE 2XA8H 5LGKA 3WXWH 4KDVA 3MXVH 4S1SL 2LVCA 2EZ0C 3EYUL 3KPRA 1MHEB 1OF2B 3IFPA 4OIBA 1IAIL 3FO2B 1JMXA 3CCHA 4MA7L 3JXAA 1YY8A 2HTKD 3HC4L 3D3VD 5IFHH 1F3JB 3QCTL 4R4NC 3OV6A 4D9RE 4UT7L 5GS0C 5BQ7B 3KPSA 1F42A 2ICEB 3OKNB 4FP8L 4ZTOH 2K9UA 4JRXD 4KQ3L 4XB7A 2IQ9L 5DT1H 5FYKD 4GBXD 3L95B 4L9LC 4EN3A 1JNNH 1XF4B 2WIIA 4G6MH 1MIML 3FO9A 5C0RL 1T4KB 5IEKA 1C16A 4YGVA 1DBMH 4H0GA 3QDHA 2WINA 3O6ML 1CK0H 2XN9B 5D9SA 3EIFA 3TJHC 4OZIE 4CVZA 2XI9A 2I60L 4DZBA 1YEKH 1G7JB 3ARDA 2BNQB 4YDJB 3E1F1 3GIZH 5TQ0L 3DETC 2FB4L 3LPFA 3GM8A 3RWGB 3PQYA 3H42H 3X12B 5KSVA 4IOFD 4G7VH 1KC5H 3MRJA 2ICWA 4FG6C 1WV7T 3PWNB 5L7XL 4P57A 3RWFA 2P8LB 1DQDH 2X1PA 4C4KT 2QQNH 3OJDA 1EERB 1EEYB 4LAQL 4CNIB 3ILPA 5T1MA 1B4JL 5E8DH 4CU6A 1YMMA 5HSFA 3VFNA 2KZWA 3QDMA 1RAMA 1IM9D 1ED3A 1ETZB 2FEEL 5MP6H 4K8RD 1MPAH 4G6JH 5DRZA 3TH2T 1OT2A 5F1IB 2OJZH 3FQTB 2VIRA 1U8JA 4JHAL 3BE1H 4S0TD 1HQ4A 2MQCA 1W72H 4F9LC 5B4MD 1AO7D 3MJ7A 1FE8H 2F5AL 4MMXC 3C60D 1BVZA 3A6CL 2WM0A 5L0QB 2FSEA 1AH1A 4ORGB 5T3ZL 1MJ8H 4Z95H 2VJXA 3MRMA 4OFIA 3DX6B 3O0RH 4XC3H 2DI8A 3S6CA 5DRNB 1MCRA 3GMQA 4HBQA 4AIZA 1NMCB 4JY5L 3SGJA 3MRFA 4Y1AB 5I19H 2FYYB 5JIPA 3ZKXC 1WICA 5E6IC 1H0DB 2X40A 1A6TA 4MJ2A 4N9GB 3MOAH 3MJ9A 1IEAA 1YC7A 2DQGL 4MNHB 2BNRB 2EH7H 2XTJB 4UQ2A 3QEUA 1WBZA 1OAQH 3B6SA 1UB6A 4HXBL 4M3JA 2QQKH 5INCB 4X7DC 5F7YC 4UINL 2R39A 4PJIE 5JMRA 4S1DC 1F3DH 2BOBA 1KLGB 4U6YA 1S7XA 3T0VA 5T3ZE 4NP4L 3H7BB 1CFSA 5D7IF 2VDKL 2IF7A 4RGMB 5HVHC 3MO1B 1LO5A 1EV2E 5JXEC 4NN5B 4PJXF 4OQTA 3N1PC 5F7FA 4ETYA 1FZKB 2APXA 3HAEG 2P5ED 1OTTC 3TN0D 4TTDD 5DD6A 2WMPA 2G75A 4TUKL 5I73C 3VWKA 4E42B 3BGFC 1ADQA 4EZMA 4O02H 2OXHA 25C8H 3CXHK 1WITA 1RK0A 1PG7H 3W82A 3JBG7 4NQDA 3HFML 4P4KB 5KVFL 3PDOB 4KRPC 5I8OL 1VGKA 4Y5XC 2OL3A 2AEWA 2EEAA 4JZJA 1G9ML 2BHZA 4PG9A 5DSCA 2G60H 1EGJH 1OW0A 1FYTA 4OIIH 2N7AA 5KVGH 4R2GB 1DVFA 1U93B 5D6DC 3E2HB 5ILTH 1J87A 5E2VH 5FYLD 1CI5A 3GHEL 2XN9D 1A1MA 3GSQA 3SPVA 1WC7A 4PPTA 2DKUA 4H1LH 4JM2C 5D7SL 3QUMH 4BSWB 3KPNB 3GM0A 5I1GL 1HWHB 2CR3A 1IFHL 3QJHA 1BGXL 3B5HA 3ABZA 1LK3H 3GHBL 3S3JA 4DTGL 4FMKA 4F80A 3EO0A 5IFAH 2FLBT 1Q72L 2LE9A 1DQMH 4RWHA 4X4ZA 4AY0A 1NCAH 3MLZH 3NA9L 1OVZA 4Y7MA 1KIRA 5EULV 3JTTA 2YS4A 3JWOH 2BX5A 1AGBA 1LEKA 3PWLB 4WUUA 3U7WL 5LG1A 2ADGA 1V8HA 4M1DH 1CG9A 2HKFL 1A7NH 3IDJA 1T04A 3C5ZD 5DHYB 2YD1A 5EU3B 4HUKB 2Z31C 1X5GA 5FHBL 1TENA 5KW9H 4PFEA 5GGQH 1CGWA 1IEBA 2A6DA 3V9FA 3WO4C 5DMKB 3BI9X 3GSNL 4RX4A 3TLRA 1CLYH 1S7VA 3BISA 1Q9KB 5D93B 1QLFA 3CLEL 4W81A 4NO5A 4YDLC 4KJWD 5JW5B 4Y1AD 1V7MH 5C6TL 4WTZA 1XGYL 3KG5A 4D3CH 5BVPH 5CHNA 3CFJA 1UCBH 1RV6X 4YHYB 1N3NA 2GT9A 5JQ6L 5ALBL 3VFGL 4KUCD 3VXNA 1KN4H 4JFHD 2BNRD 3LRGA 4MWFA 4RMRA 3X13A 2VLLB 4Z8FL 2XTJD 2EKSA 3IFNH 1BZ9B 4X6CF 5K9QG 2ZKHL 3TH3T 3FN0H 5DVMA 1I1CA 3EOYG 3PDGA 1RULL 2X41A 1R3IH 2HN7B 4CL7A 4YDVB 4LLVA 1CDYA 5IHZB 1TIUA 2CGRL 1LE5A 5ESVB 4L29A 3I2CH 4JHWL 4IRJC 4J12A 5F8RC 3ARFA 1INEL 1HKLH 1AR1C 3WIHA 3OKLB 3P0GB 1N7MH 4Z7NE 4LFHG 1S9YB 5EORH 4H26B 1FRGL 2C4FU 5GRVL 4DWHA 2IAMB 2DWEB 3QG7L 5TE7L 3I50L 4JREB 4NUJA 2D7NA 5ERWA 3WHXA 1F6LL 1R5VB 2JCCF 3S4SB 3RPIB 4X83A 2RJMA 4YGAB 2D0GA 5EB9A 4YEFA 2ZWLT 5GXBB 3REVA 1UM4H 1L9MA 4QHLA 3KXFA 1R3HA 3HR5B 1T2QH 4LF3A 1UG9A 4J3WA 1CLOH 5EBMB 3QDJE 3OKKA 1MCPH 5E1AA 1IGJA 4G9FE 4LEOA 5EPMB 3OXSB 4EUPH 3UEZA 5IV2A 2Y5TB 2VUYA 5GGTA 4ODUA 2W60B 2YZ1A 3ZE1F 3UCRA 4DJMA 3CJJA 4R2GD 4ZD3L 1LMKA 3MRGB 1WFNA 2G9HA 3DUSA 3WFHB 3HPLA 2WBWB 4WW1A 5KS9E 5CFHA 2JB5H 1CE1H 2VLMD 3BJLA 4OLWH 4D9QE 4KK6D 2GKIA 5J1TC 2B1HL 4WWKA 3HMWH 1OTUD 2Q7NA 4P9HC 4DFIA 1RIUL 2HWZH 5DMIH 2PO6A 4YUEH 5GSRA 5D1QA 4MJIB 5IMLB 2FGZA 4U4BA 3TO2B 2X9YA 3CNKA 3ARBD 1ZSDB 3ULUL 1RUAL 5TDOA 2IFGA 3OF6A 5E7BA 3TPUB 5BOZG 1G7IB 4G42A 4U0RB 2OP4H 3VFRA 2I07B 5JOFA 1NAML 1T83C 5J89A 1MRDH 5ICYA 2NR6D 1OCWH 3HHRB 5L6YL 2VQUA 1SEBB 2ZCKH 1YJDL 4X80L 3STLA 4LNRA 4NC1E 1CGVA 5DURB 3P30H 5EFIA 5FB8A 1FNGB 3WFDH 3QXAA 3KPPB 3CSYB 4JVWA 1NFIB 1EJOL 2R69L 4UILH 3RWEB 2FH6A 3G5YA 1YNTB 5E2WH 2LTQC 4HGMA 2Y7QB 3FQXB 3KLHD 5C92A 1VACA 3QXUA 1FJ1A 1FL5B 3QAZC 3MRCA 5D7IA 2QSCH 3ULUE 4OGAD 3WLBA 1HHJA 3LDBC 1I8LA 4PJAE 2H26A 4PJXA 4IRSB 3B5GA 3GSRB 4MLSA 1NLDH 4OCLC 4JHBA 5ADOH 5F72S 1AHWA 1IC5L 2D4DA 4YBQC 1W72B 1KBGH 4H25B 1F8TH 1TJGH 1BREA 1X4YA 2Y4SA 4LK4A 3LQAC 4F7EB 2A83B 5J3HD 3IF1A 3SN6N 3DO7A 3U2SB 4JFEE 1XR8B 4EVNA 3K2UH 3KS0J 2VRAA 3BDXA 1WLHA 4HDIB 3NFSH 2DQIL 4E5XA 4TUOB 2F15A 2H2SD 4YHOL 5J1SC 3QR2A 4JPWH 2ED9A 5LCVH 5I8CB 3INUL 1ZXQA 2Y9RT 3LD8C 4WNQA 5BJTB 4QOKD 3EDDA 4XPTH 3WUWG 1ZLSL 5C0CE 1A3LH 1L6ZA 4XP5H 5IEHA 3VA6A 3DSNA 4XI5C 5ACZB 3RKDC 1KGCD 1TPXC 4TQEL 2IAMD 4F3FB 1Q9LA 1D9KB 2FGWH 5B3JE 4AQ1B 4LLMB 3K8KA 4YHZH 3OZ9L 4HXAH 1CXKA 4HLZH 1J11A 1HH9A 2X4TA 4BZ1L 2YD2A 1JFQL 2CQVA 1I7ZA 3BIKA 4LHJB 4O9HH 4G9DB 4OLUH 3OPZL 5DJ0A 2IQAA 3MV7A 4I4WB 4DVBB 1FZMB 1CL7L 2ITCB 5K9KA 1WCQA 5GISL 2QADB 3BIBX 2ZCLH 3TWCL 1FZOB 4L3EB 3BSZH 1DBJH 3VA2C 3THML 4K3DH 2Q86B 2UZIL 3IFPB 4A6YH 2OX5A 3F12A 1T1YA 3CCHB 4M5ZH 5I1IL 1UH3A 1YY8B 5CZXD 1ZEAH 4OV6F 2DMKA 4NT6A 1HILA 3H8NA 3O4LB 4OCRL 3VCLA 1JIBA 5BXFB 3NPSB 4I13B 4PP2A 2V9RA 4MJID 3VG0L 1T6VN 1Y6NR 4IRZH 1N5YL 5DJDA 1RUKH 4R97B 5HDOA 4HUXA 4OD3H 3FO9B 4ZYKA 3L3IA 3NIDE 1C16B 2PYFB 4PRDA 3LHPL 1V5JA 2WINB 4XB8A 4XTRC 3RVUC 4J4PD 2KQNA 3MV8A 5D9SB 5I18L 3QNYA 5HDBE 4CVZB 1P7HL 4H1LB 3QUMB 5FFLA 1IGML 5DURD 2M2DA 3MLYH 3WNLA 1DN0A 4MCYB 4ZPVB 2AW2A 3PQYB 2XRAH 4GQPH 1CVSC 3C9NA 2Q76A 1TXKA 5C0NC 4O2EB 4X6CA 3HZKB 3PJSB 32C2A 1T89C 5ICZA 5D7JA 3ZYIA 3JUYA 1DUYA 3RWFB 2EDHA 5F7EH 1KB9J 2FO4A 3MCKA 4QWWD 3OJDB 3SHSA 4DGVL 1FLRH 1T1ZB 3GMOB 3QZWB 2ADFL 3UMTA 1YMMB 1WWAX 5J9PA 3QDMB 2D7QA 2F74A 1ED3B 2DL2A 1HZHL 4RGNB 4IRSD 5DRZB 3S5LA 5C08E 4XPGH 5C86A 5DRXA 4Y5VA 1MREL 4Z6AT 2FECI 6CGTA 1ITBB 2BNUA 2EDWA 4Q2ZA 1U8JB 3IDXH 4M7KL 3IDIA 2Z8RA 4N5ED 1GPOH 3JWDH 3TYGH 1KB5L 3QWQB 4AEHL 2YPLD 2ILLA 3CK0L 4OFYA 3HPJA 3HKFA 4WHYG 3WXVL 2JCCA 3MRMB 4RDQF 5JHDE 3NN8A 3UTSE 4LKXA 1P2CA 3GMQB 4XCEA 3QHZH 4X99A 5CJXC 4AIZB 4OQ1A 4HJ0D 3MRFB 1WVZA 2EE9A 3HE6A 4ZUUB 1BJ8A 1NCWH 4HMCA 1A6TB 4M00A 4PV8A 1HXMA 1WEJH 2BVOA 4LGRB 4OGXH 1IEAB 3HE7B 4AQOA 1KOAA 3MBEA 4P49A 4QRTB 3MFGB 2LFGA 4UQ2B 3TC9A 4PV9B 3QEUB 3ZL4H 4JHZA 1WBZB 3EW3B 3O9WA 4NGHL 3O3EB 1D9KD 1PD6A 3G5VB 2DI7A 4GLRI 2VMFA 3VXQB 4L3CB 1A7PL 3MBXH 3OX8A 2RFXA 3CDYA 2BOBB 3F7QA 3V8OA 4ETQA 1S7XB 4Y4HA 3IKCB 5HHXH 3IRZA 3VG9B 1VFAB 5I76A 4XVSL 1TQBC 3ZTNL 1NFDF 2D7TL 1NANI 4IBLT 1LO5B 5JIIA 4P23B 4AEIH 5CSZA 2JLLA 4PR5A 3U0TA 1NBZB 3GIVA 4R96A 5GRJH 1IE5A 1Z6JT 3VI3E 2QADD 1JJUA 3U4BH 2QSTA 2L7UA 2FATH 4L3ED 3QPQD 5DD6B 1VPOL 3P9LB 5EU5A 2G75B 3RNQB 3HNTL 4WUKH 4I77H 1CBVH 4E9LA 4Q0XL 4OLVH 2OTUA 1K3IA 5DJ8A 4KZDH 1BFSA 3U36A 1VEOA 5C0AA 4B53A 3O4LD 4G8EA 4NQDB 4WHTA 4U1NB 4Q9BA 1J12A 4PJBE 5DS8A 1FBIH 1VGKB 1BOGA 2OL3B 2ZOLA 3ORJA 4ODXA 2Z8WC 1S9XB 4YHML 4WI7A 3OAYK 4XXCA 3TNNA 3L3OA 4FQ1H 4XNQB 5JA8B 1FNFA 1DVFB 2DB8A 2IANE 1CGUA 3HTLX 4JKKA 3TBSB 3O3BA 3MA7A 1A7RH 2BC4B 3RZWA 4BFGA 3QJHB 3WFBL 1CIUA 3TH4T 3W5NA 4OLXL 4EI5D 4PRAB 4PGDA 2UVEA 2AK4A 2FR4A 1AQKL 1N64H 5E6YA 3TNMA 3UJIH 3EO0B 1DE4A 3T4YA 5CEZH 2D0FA 5GGUA 4Y2DC 5CJ5A 1J18A 1K8DA 1RZJL 2GJ6A 1LP9B 5DD5H 3CPLB 1PG7W 1KIRB 4I3SH 1QFWL 4ZS7L 1AGBB 3SDYL 3U9UA 1JGVL 2XPGA 1LHZA 3GI9L 4FQQB 4LPWA 1IEHA 4U6XA 3M8OH 2NY5C 2E9WA 3KHQA 1YMMD 1A0QH 1XH3A 4XNYH 3GO1L 4NNXA 2ADGB 3LKSA 3SDDC 5I1KL 5D6CA 1OTSC 1CG9B 4RGND 2PR4L 4O2FA 5D5MF 3IDJB 1T04B 3V0WL 2L4OA 4MVBD 1CXHA 1GJIA 4L8DB 3ZKSD 3V6ZA 2C1OB 1CYGA 2B7DT 5IFJA 2H2PD 5CINL 4PGEA 3SKJL 1WTLA 3WSQL 2A6DB 1IGFH 4ZXBC 1EO8L 3CVHH 5H37H 4QRRA 4Q97A 1S7VB 5GGVL 2BJML 5DWUL 4MLIA 1U3HB 2X4SA 3KR3L 3QXVA 3RWJB 1QLFB 2HFGH 2E7MA 2VXSH 1DBKH 3LKPA 4NO5B 4POUB 5EWIH 1YY9D 2A77H 4O58L 4G8GE 4NM4L 4IIQC 2XT1B 1ZOXA 2DD8L 3BZ4B 4HIJA 1S7WB 3O45A 2C3GA 4I2XB 5DFVC 1MOEA 5CHNB 1KUMA 3CFJB 5BVJA 4FQJH 4KK5C 3B9KC 1N3NB 1XGTA 4NQXA 1OGAE 2VLKA 4X7TB 3HE7D 3W0WA 3X13B 1LD9A 2EKSB 3C08L 3GJEA 4TOYL 2EDTA 3I6KA 1NCUA 4P2YA 4ZOAA 3DUUA 2C26A 3SCMD 4EXPX 3UPRB 4PRNA 5EZLA 1EJ6A 4X7CC 1H5BA 4HPOL 4JCLA 3T0WA 1T5WA 3PGCA 3UAJD 1J10A 1NDMB 4PJGE 2PXYA 3HI6L 4PLKD 2ZCHH 3BYYA 1LE5B 1QSVA 4P23D 3VRLF 3ET9F 4Y5YC 4L29B 1W0YT 5JTWA 2X4UA 1L4IA 1BVLA 3IJSA 1O0VA 1UKQA 4S1SH 1GGIL 3EYUH 2VC2L 4PRIB 4BQCA 3FONA 1IAIH 1UJ3A 3QIBD 2V17L 4MA7H 4U05A 4F37F 3VGAB 5C0BA 4HBCL 1YMHA 2AV7A 3HC4H 4WW2B 1ZA6A 2FIRT 3ZSSA 1HIMH 3QCTH 2FX9H 3EUUA 3VH8A 2WBJA 4OCYL 3L7EB 1FNHA 2E27L 4FP8H 4QHLB 4NQVB 3KXFB 1R3HB 4LF3B 2DLEA 5JORA 1A1OA 1SYVA 4KQ3H 2N56A 3BPOB 5J13C 3OKKB 2B4CH 5E1AB 4OI9A 1IGJB 1MIMH 1RJCA 1SQ2N 2PETA 4LEOB 1X7QB 3DVGB 2BRRL 4BSJA 5C0RH 5F96L 1MHCA 3UDWA 5F1SA 2VLJB 1FN4A 1AGDA 5KG9A 1DVFD 3T0EA 2GQHA 1F4WL 1NSNL 2G9HB 4GSDL 3W11C 3DUSB 2C5DC 5D70L 2VR9A 4L4VA 1S7TA 2I60H 2NLJA 5I15L 3SKMA 2DF3A 4WY7L 4H5SA 4N8CL 3QBTB 4M7JL 4YR6A 1CICA 1XGQA 3V4UL 1K5NB 1MAML 2MCG1 4JLRA 1BM3L 3KPLB 2WUBH 4YDKH 5L7XH 5GSRB 3O6KL 1KCUH 1PQZA 4QYOB 2BXYA 3PWUA 5SWZA 3ULUC 4LAQH 3RHWF 5TDOB 4HK0B 4PLOB 3PGFH 4G42B 3LPGA 3VFRB 1SY6A 1O7SA 4NQEA 4HCRL 1OAUL 4YQXL 2DRUA 4BKLB 3R0MA 4YXLL 1I4FB 4PRHD 1YJDC 5IWLC 2LVEA 3STLB 1KJMA 1AQDB 1DQLL 2NY7L 4D2NA 5EFIB 5H2BA 3T65B 5JIKA 3QXAB 3ECBA 1DDHB 4PJCF 1P5VA 4Y19E 3IXAB 4WU7B 2WBKA 2F5AH 1PAMA 3A6CH 1T5XB 4XNZC 5EN2A 5CUSL 5TF1L 1UFUA 3G5YB 3OB0H 3P77B 5T3ZH 1KCKA 3CSBA 3ULVL 3WV0A 1U3HD 1FJ1B 3OAUL 5GJSL 2D7MA 3QPXH 1FHGA 3ZKMD 3STZA 3MRCB 5D7IB 1NFDA 3C2AL 3WLBB 3JV6B 5DRWA 3RIAF 4GW1A 2H26B 1HYSD 4PJXB 1VHPA 2XZZA 5FAAA 4X9HA 2MCPH 1XIWC 3CFBA 4MHHI 2EDJA 4ODWA 4P2QB 2DQGH 1AHWB 4W68A 2AJYH 3T2OA 1QG3A 3Q5TA 5L2KA 4I18A 1LNUB 3BQUD 2W38A 3GRWL 3QI9A 4JM4H 5FYJU 5ESAA 4RGOL 5HHMD 2H8PA 4U1MA 4I9WE 2XG4A 3SDXF 5DQJB 5EC2A 1FG9C 2ZUQC 2CKBL 1QA9A 3NIFE 4XVJL 1DN2A 4EVNB 4GRMA 4PG2C 3VMPA 3HRZB 4XX1E 3ULVE 5EU7E 1G9NL 2Y6SD 4MAYC 4E5XB 4OM1H 1A8JH 1KJ2L 4U2YA 1MI5A 3VXSD 3RDTD 4LPTA 1BFVL 2P4AB 3LKOB 1VFMA 4WNQB 4ODHL 1LO4L 4R26H 3SJVA 1ZE3C 4UIKH 3NGBB 1JE6A 5E8PA 4FTVB 3S9DB 4JG1L 1MJUL 4TUKH 2QV2A 5AUMB 2YRZA 4PRID 3DI2B 4UTAL 5D2LB 1Q9LB 1UEYA 4X6DF 4F37K 1JPGB 4GW5A 4M1CD 3C09C 2F54A 3D85D 3D18A 1DANU 4GH7B 4HPYL 2FCBA 4JN2A 1JYVA 2VE6A 1HH9B 1CGSH 2X4TB 3MUGB 2YBRA 2YA2A 3PWPE 1T22B 1I7ZB 1V7NL 3BIKB 4Q6IA 5DJZB 4APQC 3RX5A 3DX7A 4GQ9L 3JV4A 1JWUA 1G9MH 5DJ0B 3D48R 3VXMA 2IQAB 3MV7B 3TESA 1A6WH 5E2JA 4PJHE 4PJDF 1HSAA 2OCFD 2VLJD 4QRUB 5EU6D 3RWIB 5D5MA 1DZBA 4YFLI 1V3KA 5D7SH 5FCUH 4EEEA 5I1GH 2HT3D 3V6OE 3GUTA 43CAA 1IFHH 4X6BA 1BGXH 3QEQE 3SDCA 1HILB 1MCCA 5E5RB 1GOGA 1RSFA 5E95B 3U46B 2IADB 3FZUD 3ZMRA 4BK5A 3DBXA 4D8PB 1IZJA 1S5HA 4XP9L 5CJOH 1KIUA 3T09A 1Z9LA 1G6VK 5C7XL 4PP2B 4O2CA 1JF5A 1EAPB 5HY9B 5I75B 1J0IA 4XMLH 4K3EL 3NA9H 2DM3A 3RZCC 3D0LA 1Z2KA 4ZYKB 3E6FA 3L3IB 1IL1A 1IKNA 1AKJD 4P48A 4FQXD 2D03L 2CO7B 3HUJF 2HKFH 3MV8B 4P2CG 4PJFF 3EFDL 5F3HB 2R4SL 1AGEB 1NQBA 4ZQKA 5F6IB 1BWMA 1TVHA 1A6VL 1HXYA 3ESUF 4FFYL 2QTEA 2NY3C 4XPHL 4FQHA 5B39A 1IBGL 3CDGA 4P4RA 3C9NB 2Q76B 4OZGB 2NZIA 4X6CB 32C2B 5ICZB 3FT4A 1BBDH 5D7JB 1BIIB 1DUYB 2FO4B 3IU3A 3L3JB 4PGBA 3FB6A 1Q8MA 4KI5D 2KUTA 1CE6B 1SEQL 3CLEH 3N1QC 4JRYE 2UYLA 2CMRL 3P9MA 4PY8I 2Q8AH 4LEXL 2F74B 5C6TH 1XGYH 3DHJA 3RIAK 3S5LB 4FZEH 2DJ4A 4QTHB 1DQJB 5DRXB 3QFJE 5JQ6H 1A21A 5ALBH 3VFGH 4Q2ZB 4P2QD 4M7LH 4PJ8C 4WFHD 3ROOA 3IDIB 1J8HD 3FN3A 4Z8FH 4PTTB 2MPAL 1ULVA 4MS8C 3L9RB 4UTBH 4LCCA 4UAOC 2AJSH 2ZKHH 2RBLA 3HPJB 3BKML 1FZJA 3MRPA 1ORSA 1JGLL 4K94L 1LO2H 3NN8B 2EDOA 1E4XL 5D96C 4LKXB 1QSFA 4XCEB 3QULA 4G6AD 2DYPB 3KYNB 5EOCL 4W4OA 4E41E 3U7YL 3X17A 3RAJH 2VLRE 3G6JE 2CGRH 3GB7A 1C1EH 4P3DB 1E4KC 3VXUA 1F2QA 4JHWH 4NKDA 1QO3A 2MQ0A 3LKNB 3IU4L 5IQ9A 5C8JB 2D7OA 3PUCA 4FFZL 2DQFA 3MBEB 2GHWB 3S4SG 3QUYB 3U30C 4R8WH 4ZDHA 3MOBL 1ND0A 5EA0H 4FTVD 1RZ8A 1Q1JL 5T1KB 2FEEI 3NCMA 2A2QT 3QG7H 5TE7H 3I50H 4AH2B 1CD9B 3WE6B 2CDGA 2RFXB 5JNYA 3S8WA 4QHKI 4S10A 4ETQB 4X5XA 1L0QA 2P5WB 4Y4HB 5JDSA 3VD9A 4I3GA 2IH1A 5I1HL 2ZZUT 2N1KA 3PIQB 1TCRB 5IW6A 4KMTL 4WI9A 4QF1A 4K7PY 1JHLL 4M93B 3GSVB 2BY3A 5CSZB 3MV7D 3GIVB 5LAXA 4R96B 3W81A 1HEZA 4OZ4A 5DZOA 2YC1A 1QR1B 1RQ5A 3FHQA 4ZD3H 5EU4A 3V8CA 3RVVC 4U1GB 3REWB 4EUPA 3HMXL 3TFKD 4XAWL 2Q8BL 4OLZL 5IVOA 2Z35A 1UYWL 4KKBC 2OTUB 2AEPH 4G6KL 3DSFL 3U36B 2B1HH 5A1AA 5D1XC 4PRBA 2R9HD 1J05B 1IGTB 1A22B 4PJCA 2E6QA 4WFGE 1JRHI 2KQMA 2JK5A 3GI8H 4G8EB 5D7KE 1RIUH 1UVQA 2APWA 1NCDL 5C07A 4HWZA 1T1XA 1BOGB 5EC1B 1U3JA 1KG0A 4JFFA 1MNUL 4ODXB 5DD3H 5IVXE 5FYKL 2FZ3A 4MD0A 4Q58C 5TDNA 5T1DL 1KENL 5E8NB 2XXCB 3IAGC 5FO7A 1NAMH 3QUXB 1AP2B 3A6BL 4PJ7F 1CXLA 5L6YH 1J1XL 3PNWB 3O3BB 2XY1A 4HIHB 2DJUA 3QNXB 1IVLA 3BWAA 1UA6L 3PDDA 4PGDB 2AK4B 3TNMB 5B21A 2VYRE 2FL5B 3T4YB 1EJOH 3O2DA 3D3VE 4OB5L 5GGUB 4BZ2L 5CEZD 5C0FB 2CLRA 5D7JD 1K8DB 2GJ6B 4XWGL 3SDXA 2NY6B 3QG6A 1WAAA 4YHPA 4F9LA 4H88L 3RGVA 5CP3H 4HHAA 4L4TA 3U9UB 2XPGB 1E28A 3K46A 4HIEA 4U6XB 5BS0A 3QXTA 2X1OA 5JLZB 4IHOB 1ACYL 2OZ4L 2VL5A 5D6CB 3IDNA 4O2FB 1R3KA 4YX2H 1FPTL 4K8RL 5DF0A 1F4XL 4KAQL 5BW7C 3L5HA 3V6ZB 1TETH 4IS6A 5D1ZA 1U8IA 5FUCC 1JTOA 1IC5H 5IFJB 3KS0H 2FEDC 5E6IA 5B8CC 4I0PD 5HD8C 4J8RA 3T1FA 1RZ7L 4U7KA 3ROLA 5KSAD 4HV8A 4DUWA 3QFDA 4QRRB 3WD5H 4X6DA 3HZYA 4G8FA 3LN9A 4FFVD 4P2RE 4OTXL 1YEEL 3I02A 4KZEL 3RX7A 1I7TB 1I9JH 3B2UD 2CUMA 3LKPB 5B38G 1UZ6F 2DYPD 4ZSOE 2OXGA 4HIJB 3DNKA 3O45B 1BJ1J 1DTUA 5EO1A 5KSBF 1MLBA 1LO0L 3FAXA 3INUH 5LGHL 1YPZB 4NZDA 1WFOA 2DICA 1XGTB 4NQXB 1OPGL 4LSSH 4QEGA 3MROB 5JXEA 1ZLSH 4PJDA 3MNZB 2P8MB 3W0WB 3QUYD 4MD5A 1MRFH 3MGTA 1GGYA 1FNEB 1I85C 4Y16C 3QCVL 2F53B 4TQEH 4MSWA 3ALPA 5IBUB 5T1KD 4HF5L 1T66C 2KKQA 5FUZL 4KKLD 4F9PC 5GRUL 3OZ9H 5HVFB 1AO7E 5KTEL 2P5WD 5EZLB 3MV11 4BZ1H 3QEHA 1H5BB 1W2KT 1JFQH 5GPRA 3VFOB 1NC4A 5BV7B 1LE9A 3PGCB 4Q9QL 1RUQL 5HYSA 2PXYB 3LMJH 1S3KL 5E6ZA 4ZMAT 3OPZH 3D6GA 4JE4B 4Z76A 1VCAA 4Y5XA 5GISH 2M26A 4YFLF 5FYKU 2ED8A 1BVLB 4YK4C 3IJSB 3OR7A 3FB7A 2QL1A 3MTRA 3CU1A 3THMH 4XVUC 2W0KA 3HUJA 4PJFA 5IJVB 4JDTL 5FEBA 5I1IH 5A2JH 5C0BB 4GKSB 2AV7B 1ZA6B 5D6DA 4NKMA 4TNWF 5E70A 4JO4L 4KU1A 2WBJB 3VH8B 4OCRH 3O6FC 3BEWA 2FJFA 4YWGL 2RCSL 3GBNH 4KTYA 3P40A 5JORB 1X5KA 1A1OB 3R06A 3CFKA 5JUEL 3VG0H 2PTTA 2H3NA 1P84K 1JPFA 1AI1H 3QEGL 1CFVL 1MHCB 4XPBH 3ILQC 1FN4B 1AGDB 2IFFH 2VXTL 3QUXD 5KG9B 2DQJH 3LHPH 1XF1A 1C7TA 1HOCB 4KFZC 1FCGA 5I18H 4L4VB 1T2XA 2AJUH 1S7TB 2R23A 1D5ZA 3SGDH 2NLJB 5IMOA 5E7FA 1Z9SA 5FYLL 2E6PA 1IGMH 1BD2A 3LKRA 1OSPL 4K3JH 2WUCH 4LLQA 4PJ5A 3D25A 4BH7A 4YR6B 2W07A 4MDIA 1CICB 4M61A 1B0RA 2XYCA 3MRHB 4JLRB 3OG6B 2Z31A 1TITA 4QCIB 2A38A 4EN3C 5CJQH 1JVKA 2GJ6D 2NY6D 4PY7A 3PWUB 1CGTA 2E8ZA 3UTTA 1QYGL 4DGVH 3TJEL 3A0OA 4NQEB 3CXDL 5KVMC 2YRPA 4HKJA 4JFXA 5D71L 4K2UL 1HZHH 4U3HA 2NX5B 2NXZC 4HUVA 4XHJC 1KJMB 1MREH 4KJYA 4YHIB 2ENYA 5HBBA 3QHTC 3P0YL 4M7KH 2PW2A 1MEXL 3ECBB 1T0NB 1YYLL 2XN9E 3SO5A 1YEHH 5EN2B 3VXRB 1F6AA 3N9GH 4PIRF 5FO9A 3RY6C 4AEHH 1YYML 4QRRD 5KSUA 1NC2A 2XQYK 2BNQE 4OD2B 1VADB 4U1KB 2YPKA 5E9DA 4HJGA 4N9OB 3NAAL 1A3QA 1C8PA 1DSFH 3STZB 4TRPL 3LN4A 1XMWA 2E5EA 3HG1B 4IJ3B 3ZYOA 4P46C 4JVUA 4WRLA 2JKXA 5JW4Q 3CFBB 4JO2L 2X4NA 5KVDL 1CXFA 4KXZH 3D39B 5J12C 4POZD 3W0WD 4QY8A 1A4JB 5F7WC 3QI9B 3CDFA 2F53D 4NGHH 4WTWA 5I6XC 1W0WA 4LARL 1A7PH 5AAWA 5EC2B 3ZDZE 2R0KL 1KTRL 1T1WA 3NPZB 1QA9B 4GRMB 1U8KA 2EXWD 5E00B 3SGJC 4XVSH 1G9NC 5D4QA 2FJHA 3QIUD 2D7TH 2J8UA 4BELD 3EYOA 4DZ8B 4FZ8L 2YD6A 3MRNA 4NO0A 3WNMA 2PXYD 3KLAA 5ENWA 4MXWL 4XPAL 3VXPB 3G6AA 4X6FA 1FORL 4UQ3A 5T5FH 1QSEB 2EE6A 4Y1AE 3SJVB 1WQVT 3VRJA 1WTGT 2W91A 1A9BA 3TGXA 3MJ8A 1VPOH 5E8PB 4CVWA 5HYJB 4PJ7A 5KS9B 1P7QA 4LVHC 1RIVL 2BSED 2ADJA 5ADPL 1WBYB 4XT1C 2BMKB 5IG7A 4DEPC 4JFHE 2BNRE 2CLVA 3D18B 4TNWK 1ZT4A 2OTWA 2WBJD 1S7UA 2XTJE 3RVWD 3HAEH 4JN2B 4U1SA 2VE6B 3BGAA 3AY4A 5AAMA 2F8VA 3U4EA 5GS2H 2YBRB 1MCJA 1S8DA 2EDKA 4Q6IB 3TT1L 3DX7B 5LBSL 1JWUB 1E27B 4PD4K 4YHMH 5BZWA 3TVMD 4MB3A 3IDYB 4RZCA 2DDQL 4Y4FB 1HSAB 5HGAA 1I3RA 3FFDA 1PKQB 4O5LL 4JB9L 4XMPL 5JR1H 1N8ZA 1PZUB 5D5MB 2CLZA 3EDFA 1T83A 3PHOA 43CAB 4X6BB 1KLFA 2HLFD 1CT8A 4ALAH 3L7FB 4GFTB 3O2WL 4IDJL 2X1XR 2V7HB 4XCYA 4JZJC 1RZJH 5JPNA 2X4OA 4RQQA 3BDYL 2DI9A 1QFWH 2JJSC 4ZS7H 5GRWA 3D0LB 5EIVA 2UUDH 4NJ9H 1IL1B 3IDUA 2ZG2A 5I1KH 4PGZA 1IGCL 2GJZB 3NCJL 2NX5D 2PR4H 5KSBA 5CWSB 2A6JA 3V0WH 1T80A 3B9DA 1EMTL 3ZKND 4ZQKB 1CL7I 1TVHB 2W9EH 4XPFH 1BJMA 5HGHA 3SKJH 1ONQA 1YDPA 4JANB 4FQHB 4BFEA 3CDGB 3CX5J 4G5ZH 4P4RB 5B39B 3WSQH 5HXMA 4XP6L 1EO8H 1MFCH 4NO3A 3VXRD 2VLME 4H8WL 3FT4B 4MJ5A 4OM0L 5GGVH 2X4RA 4OZFA 1VKXB 1WIPA 4WTZG 4PGBB 5ANMA 3T77B 3UTQA 2DLTA 4O58H 1A2YB 2D0HA 4M7ZB 4NM4H 4LPXA 4NNPL 2DTSA 2R1WB 2YD7A 4N0FA 2IMNA 3HG1D 3NOIA 1HE7A 1NEZA 2QR0A 4JDVA 4MB4A 5LWYL 3UYOD 2DQEH 2HVJA 2Z8VC 3ROOB 4DKDC 4PGCB 3D39D 4OUUA 1KTDA 2I27N 5HI3C 3ARXA 2V2WA 4MA8L 5JPMA 3WN5C 2VISA 4LCCB 2NYYC 1JTTA 2QEJA 5T33L 1VDGA 4JFYA 3MRPB 1FZJB 1ORSB 1TZGL 4TVPD 1A6ZB 4HJJH 1RK1A 3AXLA 3FQNA 4BFIA 2O5YL 1DL7H 2CIIA 2COQA 1QSFB 2RR3A 3VWJB 1TZHA 3A67L 3T3ME 3HI6H 3JUZA 2I9LB 4DGIH 3MMEA 3AGVA 3VXUB 1Y6KR 2H9GA 4NKDB 1QO3B 1MFEL 3SGKA 4QHMB 5IQ9B 2I5YH 1QSED 2H32B 3WJLC 1I9RL 4AENB 3V0VB 2DQFB 5CP7A 2ARJA 3EO1B 4OF6A 1ND0B 4PJEB 5HYJD 4Z7NF 3DTXA 3BKCH 3RKPA 1RZ8B 1U58A 5DJYA 1R5IA 2ZNWA 4V2CB 4FFWC 2V17H 1BAFH 2WP3T 4HBCH 2L7JA 5A3ID 3QQ9D 2CDGB 5JNYB 5E5MB 3LSOB 5JDSB 4OCYH 4JFDA 2E27H 1QRNA 3O6LH 5IW6B 4U7MA 2DS4A 3K4DA 5HHOB 1H8SA 1GSMA 3KYMA 2IPKB 3QRGL 4FS0A 2R2EA 4LHUB 3WNPA 4UV7L 2VXQL 1IAKB 4PJ9C 5LAXB 3WNOA 1CIDA 3ARFC 3BHBA 3DI3B 1HEZB 2IEPA 3CUPA 4PP1D 5F7DB 1OP5H 4HKZA 1D6VL 4Y4FD 1NGQH 4L9LB 4MZ3A 3H0TA 1NSNH 1JF1A 4GSDH 4R6UA 2IGFL 3AFLA 4P3CL 3WDHA 4CADA 3WXWL 4NQCB 2OMBA 4NN7C 5I15H 1RZKL 5LKNA 4WY7H 1ZAGA 4LVOB 4N8CH 2HTKC 5EZIL 4DCQB 2DQDL 4PJCB 1KGCE 3B3IA 5I30H 4F7PB 3V4UH 1MAMH 2JK5B 5IFHL 1GAFL 4NBZB 1BM3H 2PF6A 2YZ8A 1LEIB 1UVQB 5GRYA 3WS6C 4HWZB 1T1XB 2CXKA 4EIZC 4LCUB 1XGUA 1KG0B 5EUOF 2BVEA 3RUGF 4UDUA 1GXEA 4GBXC 4MD0B 5TDNB 5MEQA 4AM0B 1T89A 4GKOA 5FO7B 3SKOB 4HCRH 1OAUH 4G6ML 4YQXH 1REIA 3H9HA 5IM7A 4XMKH 2LAAA 1CD1A 1OARL 5IB3A 1PZ5A 3RI5F 1N59B 3MC0A 1T6WA 1CK0L 3BWAB 4R3SA 5DD0L 6FABL 4WEBL 4CMMA 2BVTA 2PO6C 3MUJA 3GIZL 5CUSH 1JNLH 4GRLC 4JFED 1D5IL 3ULVH 3QG6B 4G7VL 1BBJA 4YAQA 4QHUA 5INDB 4R4FH 3OAUH 1RD6A 5GJSH 3T2NL 5D72L 1AJ7L 1BFOA 4LCWA 1T7WA 1BFTA 4G8IB 3UTOA 1KEML 3KLDA 5BS0B 2QQNL 3S37L 4ZFGH 1QBAA 4MJIE 4KUZL 3P0VL 2IH3A 3ALXA 4N90E 3ULUF 4NFDA 4W70A 2VL5B 3PP3H 3T04D 4IEFB 3O3DA 4K8RC 1GHFH 2Y36H 5MERB 3G08A 3PXHA 1MPAL 3C8DA 1U8IB 2HYMA 3ZKXB 4XZUB 5E6IB 1T7YA 3BH8B 1JGEA 4J8RB 3GRWH 1I7RA 4BSVA 4KJQD 3ROLB 1W72L 5B4MC 4HZLA 3QFDB 1ZS8B 2BFVH 5DJAA 1K2DA 4G8FB 3FT2A 5D2NC 3VFPB 3LB6D 3I02B 2CKBH 3S37X 4QRQA 4XVJH 4D0DA 3GMNB 5F9OL 1FVCB 3UZQA 5MEPA 3VWJD 4YJZL 1CFQA 5EO1B 1MLBB 4NKIH 4OUOA 4ODHH 3V7MA 5HVHB 3ZDYE 1KIQA 3E3QC 3RA7H 4OAWA 3MOAL 2H41A 2J8HA 4JG1H 1MJUH 5FDYA 3OG4B 3L5IA 5M95B 5B3JF 4YO0B 4ZODA 1NCNA 4HPYH 2EZ0D 3NMEA 2OR7A 5I73B 2X1WL 5C0JA 4MA1C 3BGFB 1MCSA 3QEHB 3LQZA 1NC4B 3X3FL 5HHOD 1V7NH 1ZT1A 4JN1L 5DYOA 1KPVA 2GYSA 3WIFA 3EAKA 4LHUD 3BXNB 4JFPA 3QH3B 5IB5A 4Z76B 4OT1H 2AS5M 4KRPB 3VE0B 4Y5XB 1IGYA 3OR7B 3FB7B 1U8HB 3AREA 2YWZA 2BDNH 3MXWL 3TN0C 1CGXA 4ELKA 3HUJB 4PJFB 4W6WB 4LCIH 1JWMA 4NQCD 3X3GL 5IMMB 4NKMB 3TF7C 2EXYD 2BOCA 2NY2B 5GRVK 4O02L 4PRPA 4X98A 1QUNA 3TJHD 4ZUWB 3UYRL 4ZFFA 2FJFB 4JM2B 4NRYA 4XP9H 2CPCA 1RI8A 1PG7L 1MCBA 1IGIH 3DETD 4L9DA 5IB4A 2PTTB 3L3HA 2ZOKA 2H3NB 2UVFA 4EQ3A 5L2JB 1B0GA 1LVEA 4XCFH 4FG6D 9CGTA 4EBQL 2AV1B 2G60L 1EGJL 1RZFL 5F70A 1NGWA 4OIIL 2XTLA 2D03H 3EBAA 2HT4C 3EFDH 5EOTA 5KVGL 3UO1H 4Z7OF 5GS1A 1D5ZB 5ILTL 5HDBF 4JAMB 2A73A 3RI5K 5IKCB 1BD2B 4ZUVA 3LKRB 1MCFA 4L3EE 1XF2B 4FFYH 2MTPA 4LLQB 4PJ5B 3D25B 4K71C 1PG7X 3QUML 4MDIB 3DROA 4M61B 1B0RB 5JQHC 1FIGH 4IDLA 2OR8A 3KDMA 4WU5B 1VFBA 1JV5B 1LK3L 2WV3A 5JHDD 1V05A 5TPWH 5CBEA 4WI8A 3WYRA 3IETA 3O4LE 3GSNA 3WO4B 3S5LG 2XQBL 4ZXBA 3LZFH 4KMQA 3SQOL 3BN9D 1ZGLA 1NCAL 2CMRH 3TIEA 5BS0D 2GTWA 1K3ZA 4LVEA 3HNVL 2YHGA 5LGJA 3ARGA 4JFXB 1TVDA 2ICWJ 3CZJA 1XFPA 4HUVB 1A4KA 1UCTA 4M1DL 4Z7VB 4IIQA 4GKZB 4AEEA 2Z4QB 3C5ZC 4OCNC 5E6ID 2HVKA 4Y0GA 5I1AA 1FO0B 4EDWH 1KN2H 3CH1B 4RISL 3M17A 2WANA 4JQIL 5FO9B 5DJCA 5KSUB 1NC2B 5GGQL 3BKMH 2HFEB 1JGLH 3PQYE 4K94H 1CLYL 2YPKB 5E9DB 4HJGB 3LPWA 4LGSB 4QNPE 5DJ6A 5EOCH 4NKOA 4Z0BL 3U7YH 1UT9A 4OGZA 3W2DH 5CKAA 4KJWC 4S1DD 4HSQA 3UC0H 2MHAB 3QDJA 4Y5VC 1ZHLA 5DFTA 1TTFA 1AY1H 1V7ML 3BFOA 4G9FA 1YMME 3QDME 4HG4J 3EZJB 2X4NB 3DURB 3UJTH 5E56A 3MOBH 5ABDE 2X4QA 4Y5YA 3MJ9L 4LPUA 4QY8B 3ZHLA 4KGJA 4HWNA 4JDZA 1Q1JH 1QPPA 5C0EB 4IRJB 4RFOH 4Y4KB 5BZDA 1ACZA 1OTTD 4KROC 1KF9B 3K1KC 4KMTH 1JL8A 1QKZL 3CGTA 3FN0L 3VDCA 1JHLH 1UXSA 3EYOB 5EZJB 4MNQB 1NBYB 3U9PH 1R3IL 3KLAB 3L1OL 5ENWB 1PGRB 3STBA 5EUOA 3CFCH 1XR9A 3RUGA 3MA9L 2HT2C 4UQ3B 2IAND 3LS4H 4KY1L 3QA3A 3G5XB 3WFEH 2J12B 3VRJB 3VI3F 1BZ7A 3MJ8B 4FMFA 4OIAA 3UTPD 4PJ7B 1P7QB 3HMXH 1MVUA 2ADJB 1HKLL 5HYFA 2LABA 4XAWH 1SMAA 3WFCH 4OLZH 5FO8A 4LVNB 5IG7B 2ATKB 3EYVB 4G6KH 3DSFH 4XCNB 2AGJH 5FHAL 3D9AL 5SX4H 1ZT4B 2OTWB 2NY2D 4ZUTB 2W65A 3T08A 3U4EB 4JM2D 1A7QL 1DQQB 3IFLL 4MQ7A 5GS2D 4RMVA 5HHPA 1ZV5A 1KJ3L 1QFUH 1T2QL 2VOTA 3NFNA 5FXCH 4YHLH 1U0QA 1EXUA 2OL3L 5BZWB 1CLOL 3JTSA 1KENH 5T1DH 5C9JB 3RTQC 1NJ9B 3A6BH 1I3RB 1CFNA 4BJLA 2ED7A 3N85H 3HCVA 1NKRA 4LSPH 1RUPL 3VXTA 2CLZB 3BN3B 1NAMA 1U95A 1A9EA 1S7RB 4HD9A 3PHOB 2R56L 3OKEA 4DUXA 1CT8B 1HHKA 4PJ5D 4KK6C 2HFTA 4TUJB 5IWLA 1HN1A 4OLWL 4JKPL 1MCWW 3F65A 1NKOA 4BZ2H 4NUGL 3HMWL 2KBGA 4XWGH 3MRQA 5JPNB 4RQQB 2ZG1A 4H88H 3UPAA 1AGFA 5ID1A 5DMIL 3DOSA 4BH8A 1P5UA 3LN5A 4NQDE 3CZFB 3ARBC 2LTQB 2C3VA 5CP3A 3ARTA 2EEDA 3I6LE 1EFXA 4PTUA 5KSBB 4QXUL 4LOUD 2A6JB 1FPTH 4KKAD 1MRDL 5JOEA 5CGYD 1RZIA 4KAQH 5FOJA 4HGKC 5DHVH 2J6EA 4Z7WF 3MNVB 5HGHB 5EZOL 1ONQB 4I5BB 1NDGB 3P30L 3UP1A 4Z7UB 5C0CA 3FOLA 1RZ7H 3FO1B 3WFDL 1XIWA 1KB9K 3WKNA 3N1MC 35C8L 4NO3B 4MJ5B 1CFTA 4OZFB 2NW2A 4K9EC 1BJ1H 4OTXH 4KKCD 2V9TA 5ANMB 4X4XA 1OGTA 5E9DD 5E2WL 3KLHC 2GY5A 3MQIA 2NPLX 2YD4A 1KJVB 3KHOA 1PSKH 1YEDA 3MYZA 3W9EB 5ETUA 1LP9E 4OGAC 4PG2A 1NEZB 4XNXL 4JDVB 3L6FA 4MX7B 5LGHH 3BGMB 4MAYA 1SM3H 4IOIB 5M7QA 1OPGH 1R3LA 2HVJB 2J7LA 1WWBX 1R5WA 1HI6B 4CGTA 4OUUB 1KTDB 3SY0A 3V6FB 3GBMH 3LD8B 2V2WB 5JPMB 2DKSA 3FRPA 4IRJD 3BVNA 2VISB 2YK1H 4JGUA 1KBGL 4Y4KD 1F8TL 5FUZH 5J3HC 1AR1D 1IC7L 5GRUH 1FV1A 4HWBA 4JFYB 2EE3A 3PGDA 5KTEH 3TO4A 2P47B 1RK1B 3FQNB 4PLJD 3QWRD 1TPXB 1S9WA 2A6IA 2CIIB 4JZNA 4JPIA 3K2UL 4Q9QH 2PTVA 1RUQH 5T1LA 4MNQD 1S3KH 2VTFA 4IOSD 3MMEB 3NFSL 4J3XA 1K6QL 2GITB 3M1BA 4YHKH 3CXHJ 4CU8A 2XWJB 4APQA 2VABB 3FB8A 4QHNA 4MMZC 1JHKH 1INQA 3ARRA 1TNMA 3VH8G 4BA8A 1A6AB 4I2XE 3D2UA 3IDGB 4U1IB 3BDBA 1U58B 5DJYB 4JDTH 3PL6A 1RJLA 2ATPA 2BSRA 3B8SA 1A3LL 3K8LA 3GSOB 5JHLL 1X3DA 2GSGA 4JFDB 1FYHB 5MENB 1QRNB 3EZ8A 4YWGH 1IAIM 1MCIA 2RCSH 2ZSVB 5GGRB 4HXAL 3UTZB 4LFHD 2VQ1A 1YEJL 8CGTA 5JUEH 3KYMB 5ISZB 2R2EB 3SOBH 4LDEB 3LV3A 1DBBH 3HLAB 4X6EA 4JJ5B 3SGEH 1GZPB 3MRKA 3CUPB 1U36A 3M07A 1CFVH 4HKZB 4MJ6A 3RJQB 1L7TL 2VXTH 1E4XI 4ZS6C 5GGTL 1PX4A 3EGSA 4L5FL 1JF1B 1WISA 4LSRH 1G0DA 1OWWA 2N4IA 3RZCA 2ZCLL 3PV6A 5E08L 3GGWA 4MNGA 2OSLB 4ONGH 4K3DL 5C08A 1MY5A 4XRCB 1OSPH 4Y19D 5CZXC 3DJ9A 4RDQG 4M5ZL 5DDHA 2YUVA 3OKYA 1VEPA 3WKMH 4PRIE 3B3IB 5A2FA 2Z91A 5JW4R 4OBRA 1FNAA 1H3WM 2MKWA 4HX1B 5DJXA 5I16B 1QFOA 2EDXA 2UV3A 1OSZA 3TJEH 2X7LA 3KXFE 1LDPH 3EOAA 4IRZL 4NNYA 4XWOD 1FL3A 3NBNA 1GGUA 4CMHC 5E8OA 4K2UH 1LDSA 1FDLH 3H9HB 3WCYA 5IM7B 4XHQA 1YN7A 4S1QH 4TSAH 1CD1B 4EI6B 4J4PC 4DGYH 2VLJE 5AD0B 4R3SB 1ZWIA 1I1YA 3DXAB 3FFCB 5D7LA 3GKZA 5I1CL 4ZUSB 1N6UA 4I9WD 5CJBA 5L88L 1YYMH 2XRAL 4PJ8A 4R7DA 2NY0B 5HHNA 5K9OA 5GGSB 4YAQB 4AYFA 5T3XD 1KB5A 1IT9L 4QWWC 5F7EL 4KRNA 3P11L 3QDAA 3BEVA 1TVBA 2HKHL 1U8PA 2IH3B 4KV5F 3C5JA 4JFZL 2UUDK 5CIPA 4TTGA 3QUKA 2FDBP 4IRSC 3G08B 2V6HA 4LSUL 4ISVA 1FH5L 2E9JA 4JO2H 3P4OA 5KVDH 1C08A 2X89D 4XPGL 4M5YL 1E4KA 1JGEB 3DVIA 1YQVL 4I8DA 3FRUB 3FL7A 1GPOL 4NYLA 4LRIC 5DJAB 4LARH 4DVRH 4LL9A 3FT2B 5J6HA 1BQUA 4R7NA 4QRQB 4D0DB 1Z3GH 3PWPD 4PB9L 3NIFF 3RKDD 5K59F 3QO1A 3MRDB 4J23A 3MZTA 4P5TD 5MEPB 4FZ8H 2JB6B 1UEMA 5HYEA 1WUNT 1CFQB 5IF0A 4IMKC 4HJ0C 2NCMA 4AT6A 4FQ2L 1IAOA 2YUXA 3VI4F 2XKSA 1TQBB 2YEZB 1FNSL 1XF3A 5D7IE 4XVTL 3VFUA 5A16A 1J8KA 4I18C 1KIQB 2IBZX 4PJXE 4OGXL 1NGZB 5DC4B 4YXHH 4LLDB 5ADPH 5T5NF 5IW1A 3RWHB 3P3YA 4P2QE 1EK3A 3K81A 4KH2A 2R0ZL 2CRIA 4R0LA 3RQ3A 4GS7C 4YIQA 1D5MA 1C5DA 5C0JB 1S9KC 5MEND 1BLNA 3LEYH 4MGXA 5JO5A 5HHXL 5D1XA 3TT1H 2XXMB 5LBSH 1W0VA 5ISZD 4LLYA 5IB5B 5E24E 2D7PA 4QTIH 1IGYB 4AEIL 1OM3L 5SWQA 3GJFA 4HKXA 4PJHF 3QIWB 5DVOA 5GRJL 1QVOB 4O5LH 4JB9H 5J11B 4ELKB 5E03A 1JWMB 2FATL 2ZSWB 5AZ2L 3QWOA 1EO7A 4CW1A 1SYSA 3F5WB 1TJHH 3Q6GH 4FTVE 4Z7WA 2BOCB 3F7RA 4PRPB 3C8HA 4RMTA 4ZFFB 1B90A 2GK0A 1F90L 3O2WH 5D2LE 1QBLH 4IDJH 4NRYB 3QCUL 4CDHA 3BDYH 3FCTB 2ZOKB 1PEWA 3PWJA 2P7TB 2X9WA 4GKNA 3OAZK 4Y2DB 5IB2A 2G5BA 1ZLVH 3VFMA 4G8GA 1NGWB 2OJEA 5B39G 3MV7E 5EBLA 3QFJD 4XNUL 4BM7A 1CDJA 4ZUVB 3SDDB 3QDGB 5F7NC 1OGAA 2GY7B 3MCG1 1BMGA 1G7LA 3CMOH 4EI5C 3DXAD 3FFCD 1EBAA 4MJ4A 4ZNCD 4XP6H 4NFBA 3I84A 3MOQA 4H8WH 1KPUA 4OM0H 1N64L 3ZE0E 5FA3B 5B8CA 5CBEB 5IESL 2NY0D 1AGCA 5CEZL 1FAIL 3H2WA 3SO3C 3K3QA 2ADIA 5DD5L 3TIEB 2VLRD 1ZGLM 1K4DA 3JWOC 3ARSA 1HKFA 5IW3A 4ZPTA 3M8OL 4RMUA 1A0QL 1F11A 5AEAA 3PABB 4RGNC 4EDXB 1A4KB 5JA9A 4YC2C 1GH7A 4HMDA 2NY1D 2V9QA 3SGEI 3IJYA 3BO8A 5F6HJ 3MV8E 2HVKB 1MRCL 5DZLA 1S9VB 4CBPA 2V5TA 4MA8H 3B9KB 2EYRA 3O8XB 3DMMB 5EUKA 4M7LT 4C56B 2CRYA 5T33H 5J4MA 1IGFL 3DV6B 4Y16A 1JP5A 3H9SA 4Y89A 4OZGE 2O5YH 4HS8H 1HSBA 4X6CE 4ODSL 5DJ6B 3OHXA 4F9PA 4XBGB 3TV3L 4Q9RL 3EHBC 4NKOB 1M6OB 2PNDA 1YY9C 2VN7A 2VXSL 1DBKL 4QT5B 2A77L 2Q1EA 3G6JF 5AZEL 4KTEH 1ZA3A 3LEXA 2X1QA 2AXFB 4WO4C 1I9RH 3WUZA 2H1PH 3QISA 3PP3K 4ACPA 3V5HA 2X4QB 3QO0A 3JSSA 4ERSH 1G6RH 1YA5A 5C6PB 1FSKB 5DEFB 1IKFL 3E0GA 4WFGD 3SCMC 5ICXA 5CKGA 5CLWA 1VENA 1BQHA 3DX9B 5IUSA 1FFOB 1J9CT 5I1DB 1R24A 3KLSA 4EUPG 5EUOB 1XR9B 2X44D 3RUGB 4MQXD 4P23C 5F6HI 4YDIH 4WHDA 3WJJA 5J13B 3QA3B 2DJSA 1D6VH 1A1NA 3MUY1 3QIWD 1K8IA 3KJ6L 1MVUB 3QNZB 4NWTH 1MF2L 3O11A 5FO8B 1RZKH 1CDHA 3QIBC 3ZE1E 2V7NA 5EZIH 1Y0LB 3HC0B 3LRSA 3MREA 1J1PH 2DQDH 2W65B 2YD9A 3B5TA 3PXJA 1HIML 1GAFH 2FX9L 5SX5H 3I75A 4AL8L 3HN3A 4Y88A 2WWKT 4N0CD 3RL1A 2P5WE 1MCOH 2OQJA 4G43A 3TA3B 4ZAKD 1EXUB 5FF6B 3JTSB 5IVXF 3MLRH 4LPCA 2B4CL 1JPTH 4FN0A 4Y2DD 1CR9H 2KDGA 4TULL 4KHXL 3HCVB 1X6NA 1MAJA 3GMRA 1OARH 1UC6A 4HCRA 4RA0C 1A9EB 3NZ8B 4M8QA 5DD0H 1IARB 3SDDD 6FABH 3QDGD 5CGMA 1KEGL 2A6KA 3B4NA 4WEBH 5F9JA 2VB5A 5F89A 1FL6B 2BVYA 4P2RD 5C09A 1D5IH 2VDRH 4PYGA 4YZFE 5LJYH 1A7BA 1G7HA 1AGFB 5CEYA 2WUBL 4OCSL 4YDKL 1QBML 3T2NH 5GSVA 4BH8B 1RZGB 3LN5B 1KCUL 1AJ7H 5D72H 4OV5B 3FQRB 1KLUA 2YD3A 3AB0C 1KEMH 3RY6A 3QXDA 4RFEA 5FKAB 3S37H 1P7KA 3P2TA 4KUZH 4UOW0 3P0VH 4ZO9A 1BEYL 1NCCH 1ZVSA 3AAZA 3PGFL 4LBEA 4PTUB 2IALB 4BK4A 4Y8DC 2DMBA 4ZFOB 4P46A 4CVXB 3BP7A 4OSUL 3WLWC 1UH4A 3RX8A 4KK5D 2NNAA 3B9KD 1NGPH 3O8XD 3DMMD 1CFTB 3RGVC 2NXYD 3FTGA 1YN6B 4C56D 2NW2B 4WCYL 3EO9L 4PBXA 4JR9H 3GRWA 1KTLB 2AK4E 4LQ1A 4X4XB 1I8IA 1BF8A 5F9OH 1U3HC 2CJUL 1YEDB 1EIBA 3T4AA 2GJ6E 3ZKMC 2ZUQB 5H35B 3QPXL 4MYWB 3L6FB 4NN6B 1HYSC 4MAYB 5D1ZC 4QRPA 1KJ2A 2IBBA 3HS0A 3OKOB 1HYRC 3M45A 1R5WB 2VUOA 4N5UA 4PJHA 1GZQA 3MV9A 1OLZA 1U2HA 4K55A 2MCPL 3SY0B 5I1LB 2XNAA 3RP1A 3VRIA 2AJYL 3BVNB 3BQUC 1XGRB 3JVGA 4NZRH 1I1FB 1C5CL 4JM4L 1FV1B 3V6OA 4HLZG 3V4PH 3PGDB 4NOBA 2A74B 5ID0A 3QEQA 3G9AB 1NMAL 4OZHB 1S9WB 4U1JA 5FK9A 4QRRE 5FM5M 3X3FH 3C09B 1UXWA 4JZNB 4JPIB 1KIPB 4JN1H 3KPOA 5BV7L 2O61A 1GCFA 3MNWB 4HIIA 1MFBH 4OM1L 3RDTC 1BVKB 4GJTB 4APQB 4FQIH 1OL0A 3FB8B 4QHNB 1R3JA 4NDMA 2ERJC 5I71B 1ZHBA 4V1DA 3MXWH 4FQLL 4I1NB 4I48A 3MLXL 4EQ2A 1YPZE 4R26L 1RJLB 2ATPB 4LQFH 3X3GH 4UIKL 2BSRB 1S78D 3U0WL 3SKUD 3AS1A 1LWRA 3BPLC 3W0WE 4K7FA 4M1CC 3L3KA 5KZCB 2VDNL 1AFVL 3UYRH 5EO0B 2F53E 2CUHA 3SDAA 4ONHA 2VR4A 1CGSL 2YN3A 5I74C 4F57H 3TA3D 1T0MA 2VWEC 4X6EB 4KDWA 3MRKB 1FIEA 4EBQH 1QEWB 4MJ6B 4JFOA 2DQTL 5IBLD 1RZFH 1A6WL 2JJSA 3RZCB 1JK8A 2OMNA 1RUMH 1FFPA 2W0FA 3GGWB 2B20A 2WLZA 4MNGB 4UBDD 1RHFA 4OF8A 5L8LB 1E6OH 2NTFB 2PYEA 1DQTA 5C0DA 4UT9L 4ELMF 5FCUL 3TBYA 3BUYA 3HI1A 1G0XA 2Z91B 5HYIA 1CFBA 2BNQD 1QPXA 5C0BE 1U8QA 5TDPA 2OK0H 4M3KB 1NBQA 2NY3B 1CXIA 5E99L 5CJOL 2XQBH 3SQOH 3MRLA 3EOAB 4XMLL 5C2UB 3WHE0 3HNVH 4NZJA 1HDMB 4E41A 3GSWA 4H0HB 2P44B 3CLFL 5ELIA 4M48H 1YN7B 3G6JA 4FQXC 1HINL 2R2BA 3GZKA 4RNRA 3L3GA 3BOVA 3BESR 2D9QB 3G04B 2C3XA 3B2VH 5DQ9A 1I1YB 5D7LB 4L4VE 3WL9B 1XCQB 2XZCH 4RISH 2ESVA 4JQIH 1KXTB 2OR9H 1G84A 4PJ8B 3TIDB 4MA3A 5HHNB 3KPQA 2HJFA 5CD5D 1SVCP 1KB5B 3WBDA 4OCXL 1BBDL 2D9CA 2I25N 3WN5A 5DJ2A 4NHUA 4UAOB 2FX8L 1Y18A 4X5WA 2HJLA 3BEVB 4KI5C 4Z0BH 1GGTA 2IC2A 1TVBB 5FA4A 4Q9CA 2BVQB 1H8NA 2EYSA 2WWKO 5D96B 5CIPB 3QYCA 2Q8AL 3QUKB 3CFEA 4NQEE 3G6DH 4FZEL 1C08B 4MDJA 2Y1VA 2YMXL 2NX5E 5CZKA 3MJ9H 5BRZA 4YPGA 4ZFZA 4M7LL 2CK2A 1J88A 1N2RA 3WJLA 3JWDC 4NYLB 5HYQA 3NCCB 3BMWA 2Z92B 4P2OA 1GC1L 3GSUA 2R1YB 1OP3H 2QQLL 4DAGH 2H6PA 4J1UA 3TBWA 3ZDZF 3EYSL 4UTBL 1V3LA 5I2IB 5HI5C 2AJSL 2EDLA 3VXRE 2W1NA 1QKZH 4TVPL 3QO1B 3ARUA 4X0KA 1H3TA 1LO2L 1YQ2A 2VZOA 3FOMA 5GRZA 3V7AG 3KYOA 4J7RA 3L1OH 2UY6A 1U6AH 1JZ4A 2A9NL 1IAOB 5IMKA 3MA9H 2J5LC 5IIEA 5IVXA 3RAJL 5CSBA 1XF3B 3D69A 1ZLUH 2P45B 1C1EL 1MUJA 1UWEH 2AQ1A 3C6SA 4KY1H 3CFDB 2CDFA 3HG1E 3TZVC 5SWSA 2E6JA 4PJ9A 1NAKH 1OB1A 2DLIA 2WQRA 5C0GA 2JE8A 5JXAH 3NGBC 4ODTL 3U0PA 5DA0B 5IBTL 3TPKA 5A43C 3MX0A 4R8WL 3EOBA 1G6RB 1D5BA 5EA0L 4HS3A 4KUCF 3D39E 1ADQH 5FHAH 1I9IL 3D9AH 1T0PB 1GOFA 3HMXA 1A64A 4YIQB 4QGTA 1C5DB 4QXTA 1BLNB 4JPVH 3IFLH 1A7QH 3LH2L 1CLCA 3DO3A 2P48B 1FAKT 1T2JA 3E6HB 3D3VA 1YNKH 5D1XB 4TVPE 3FKUS 4MHHG 2YKLL 1KJ3H 1W0VB 1M4KA 4P4KD 2OL3H 2NY4B 3X11A 2X10A 3BZFA 1FG2A 3WS6A 5DK2B 2GAZA 5SWQB 3GJFB 4JRXA 4I3RH 1MI5E 4HKXB 2GJJA 3T0BA 1HCFX 1UB5B 4GBXA 4XXDA 3RZCD 1RUPH 4NBYB 1URLA 4H20L 3VD5A 1QSEE 4NCC1 4B0MM 1F97A 3TFKC 3BD3A 4N1CA 3QWOB 3SJVE 2XQYG 2R56H 4CW1B 1SYSB 3AY4C 5GIRA 4Z7WB 3Q6FA 2AKRA 5HYJE 4NWUH 1RJYB 2GTZA 2GK0B 2AEPL 2R9HC 4JKPH 3U79A 4GG6F 2VZ3A 4CKVX 1NUDA 3JV5A 4NUGH 2XY2A 3GI8L 4WJ5A 3DHMA 1BF2A 4G6FB 2NY3D 1JZ5A 1U8LA 1I3GL 3IXTA 3PWJB 1PEZA 1Z0MA 4GRLA 2D4FA 3H7LA 5DD3L 1QNZL 2R29H 5HDLA 2QHRH 4Z18A 1F4AA 2DIAA 4GO6B 3VFMB 3EYFB 4UUJB 4ZSOA 4QXUH 2DTMH 1UENA 2AP2A 2OZ4A 5IQ7L 3F7VA 4OFVA 4OZFG 4JY4A 4HFWB 1TQCC 5EZOH 1IM9A 1PKQE 2EH8L 5D7LD 5D5ME 5GZOD 2V2TA 35C8H 1U8OA 2YXFA 1KPUB 4P5MA 5IGXL 2F19L 1AGCB 1NEZG 3U48A 3NCYS 4G3YL 1AO7A 3C60A 4X9BA 5F3BB 1AIFA 1K4DB 1VSCA 1MVFA 5D2NA 3SE8H 1OHQA 4LCYA 4ZPTB 1A14H 4XNXH 1FGVL 1T3FB 3MGOA 3OR6A 2W59A 3O41B 3J8F7 3OJMB 3DIFA 4J3VA 5H94A 3BO8B 2DBJA 4YX2L 1X5FA 3H3PH 1IM3B 5AWNH 4RA3A 3LKQB 1TETL 4I0PC 2EYRB 1FVEA 5EUKB 2OI9B 3WEXA 3QQ3A 2AJXL 5KSAC 2P43B 5A2LH 1IC7H 4Q6YA 3Q0HA 2M1KA 1A7OL 4M62L 4Y16B 5TF0A 2Y23A 4NQSB 4XBPB 3H9SB 3WD5L 2DQHH 4Y2OA 3B2UC 1W8OA 5DD1L 4ZNEA 1I9JL 3N1FC 2V2XA 5F1OB 3UX9B 5L8JB 2GFBB 4RAUA 5CS7A 4P9ML 1K6QH 1ZA3B 3ELAT 1XF5A 2BVPA 2V5MA 1HHHA 3LEXB 4CU7A 1AD9B 4F7TA 3V5HB 5ESQB 5B38B 3DUHA 3QO0B 3O4OC 4WHCA 5JZ7C 3VRLE 4LSSL 4DQOL 3QUYC 3GSXA 1MRFL 4YK4B 1G1YA 3NH7H 5JHLH 2P5EA 3TN0A 3T3PF 5ICXB 3ZE2F 4ELMA 4F8QA 1ZHKB 2J4WH 1BQHB 4HWUA 1Q9WA 1MHEA 1OF2A 2GI7A 4FRWA 4NRXB 1MWAB 5DO2C 4KKBD 1R24B 1AR2A 1YEJH 3FAWA 1K9TA 5D1XD 5FGSA 1F3JA 3O6FB 4M93C 3SGKC 4WFED 2NY4D 1QSFE 5GS0L 3LMJL 1H3PH 2ICEA 3F58H 3OKNA 4Q7DA 3B8YA 1A1NB 1L7TH 5GGTH 1C5BL 4L5FH 3BZDA 4KK8C 3VXUE 1K8IB 3BP6A 5E08H 4U1GC 2KH2B 2MQ3A 3KPRB 2V7NB 2OM5A 4LSDA 1T4KA 3LRSB 2FBOJ 2V5RA 3D0VA 4PJEE 3MREB 4X4YA 2VDOL 1EVUA 1BX2A 2VR5A 3I75B 3QHFL 2XN9A 4WV1C 2Y25A 3KYKL 3S3PA 3KPSB 2CKNA 3RL1B 4MXVF 3GBLA 3GBNL 2OQJB 4G6FD 4O00A 4YDJA 1PX3A 4GUPA 4Q74A 3RWGA 3X12A 3ETBF 2B4CC 4S0SD 5HHOE 4N90D 4EN3B 5E1HB 2EDFA 2WIIB 3PWNA 4LASL 1AI1L 2P8LA 3K2MC 4XPBL 5IEKB 1EEYA 1SJVA 4YGVB 3BRGC 2IFFL 2HLAA 2DQJL 1JBJA 3IS0X 3BPNC 1YEGL 2AJUL 4M8QB 4DZBB 5MI0C 4B41A 2NXZB 3L5XH 5F9JB 1ETZA 3QT2A 5I1CH 2BK8A 4NQCE 3ARDB 4K3JL 2WUCL 2GK2A 5C09B 5L88H 2GW5A 3C5ZA 5KSVB 5F1IA 5FGRA 2UZXB 1I1AC 4P5KA 2FEDD 1G7HB 3FQTA 4YNYA 3MRJB 2ICWB 3F6IA 3OKMA 4PJCE 5HD8D 4ZO6A 4ZO7A 1IT9H 4P57B 1G9EA 5CJQL 3P11H 3QXDB 1DUZA 1P7KB 2F58H 3ILPB 2HKHH 3TT3H 5T1MB 4JFZH 1WWWX 3AAZB 1AE6L 1WT5C 3VFNB 4TYUA 5KJRH 5DRNA 4N68A 2WAHA 4LSUH 2XKUA 1FH5H 4JCMA 1UKTA 4P46B 4M5YH 1CU4L 1JCKA 1JWSA 2FYYA 3BP7B 2GIYA 2P46B 2VIRB 1YQVH 1H0DA 1HQ4B 2NNAB 5A40E 3UBXI 4N9GA 4MCZA 1WZ1L 3MJ7B 3FTGB 5J12B 1YEHL 4MNHA 2BNRA 3N9GL 1I8IB 2FSEB 4M9OA 4PB9H 3H9SD 5DTFA 4KVNL 2ZPKH 2AAVA 5I6XB 3F7PC 2BSTA 4J6RL 1T66D 2APVA 3V4VL 3DARA 3T4AB 2VDQH 1Z5LA 4GRWB 1FVDA 1DSFL 4FQ2H 2R0WH 5DVKA 1CF8H 3ZSTA 5BS0E 1FNSH 3G5ZA 4QRPB 4XVTH 1KJ2B 1OAZL 3ZDYF 2DKMA 1M1SA 2VKWA 3MO1A 3BMVA 3MV9B 2L0DA 1XZ0A 2XNAB 4POZC 2UWEF 2VDML 3FB5A 5FYJD 3NTCL 2R0ZH 4XVUD 3B6SB 1EO5A 1UB6B 4LVHB 4PGJA 5ID0B 1AD0A 1DCLA 2A1WH 1E6JH 4U1JB 4U6YB 4GG6A 4HK3J 1UXWB 2EXWC 4DEPB 4GXUN 2HRPL 3BP5A 4UU9A 3QIUC 3KPOB 1CFSB 4HIIB 2EIBA 3PG2A 1B2WH 3O6FD 2BVUA 1AXTL 1OM3H 3GNMH 4M02A 3ZHKA 1R3JB 2HJKA 1ZHBB 5T5FL 4V1DB 1U2CA 4I48B 3RTQA 4HT1L 1CXEA 5AZ2H 3ILQD 2UY7A 5A2IH 1QLRA 3KPRD 3VWKB 4K7FB 3MRIA 1U93A 1UM6L 4XBEL 1F90H 3RVWC 1RK0B 3QCUH 2P8PA 2VXVH 4BSWA 3KPSD 5KN5A 5KANI 1T0MB 2VKXA 5IOPA 1IZKA 3SE9H 2AQ3A 3AREC 1G9MC 1FP5A 4JZJB 3TVMC 4HZAA 4EN3D 4RRPA 2B2XH 4X7EC 4PG9B 5IK3A 4X8XA 3KNBA 5DSCB 1FYTB 2A0LC 4NRZA 4UNTA 4HS6A 2W0FB 3T2PA 3ARBA 4XNUH 3ME0A 4RBPK 2PYEB 5C0DB 5CILL 1A1MB 5JR1L 3GSQB 3SPVB 1WC7B 4D9LL 3UTPE 2NXZD 3TBYB 5MHSD 1F58H 3BUYB 3HUJE 4PJFE 2GCYA 3RJDA 5J57B 4UT6L 3ARDD 4ALAL 4ODVL 1U8QB 1FCCA 5C09D 5TDPB 3PQYD 5IESH 2R1XA 1CTNA 5EU3A 1CQKA 3FN9A 1FAIH 5JMOC 5SX5K 5CAYB 4CN4A 1MLCA 3N0PB 3MRLB 1MIEH 3HB3D 3JTTB 1EHNA 4FABH 5GQBA 4NM8L 1LEKB 1X5HA 4WUUB 5GS1C 3GSWB 4NJ9L 2YA1A 3QSKB 2I26N 4RNRB 3QDMD 4M8VA 5DC9B 1GGBH 1II4E 1MCDA 4JPKL 1QTYT 3ZKNC 1MHPL 4P46D 5DQ9B 1MRCH 4LP4A 1TTUA 3EJJX 2W9EL 1NL0L 4XPFL 4FQPA 1AXI