4OZIB

S2 protein complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 180
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4oziB01
1T22B 1T5WB 4PRID 3X3GH 2CK0H 1F11B 4HT1L 4KVNL 4FZ8L 4P46D 2EDYA 4OI8A 3V5KA 3RZCB 3ULUL 2WSKA 4X98B 3UTPD 5BZWB 5JR1H 1U8LA 1A6VH 1KIRA 4ZAKB 1CFTA 3MJ6A 5BJTB 1IARB 4HEME 1LK3L 3ZHKA 1EEYA 1XGRA 1T03H 4XX1E 3T1FA 3HAEH 4P5KB 3VD5A 3O4OB 1BGXH 2AJYL 5IR1B 2PXYD 4JANA 3U2SB 2IBZY 2B4CL 5IW6B 4D0DA 4JO4H 5DGRA 3PV7A 4NO3B 1LEGA 3K4AA 2ZUVA 1PGRB 1ZVSA 3CFCH 35C8L 4LPCA 2C3XA 2QR0A 5DA4A 1I1AC 4G43A 1FFPB 1FC2D 5EOCJ 2NLJB 4XVUC 3S4SB 1X5LA 1FNGB 1KFAH 5K59F 1JUFA 4FQLH 3AY4C 2YK1H 1B0RB 4FABH 1NCDL 5D4QA 5JZ7C 5EZIL 1CN4A 3HC3H 3QXWA 4XPAH 3Q0HA 2EE2A 4R3SB 1B6UA 1MEXL 2X4TA 3DUUA 5DD0L 3VWKD 1P9MA 4YH6A 4PGJA 2I9LB 2CPCA 1OAZH 3S88L 1DN0B 4JFOA 3DV4A 2X1WL 1I8MB 4PJ8A 2AJ3A 3P40A 5GGSB 2FEEL 3MRHA 4AIOA 5KAQG 3G6JB 4WEMB 4N8CL 1M71B 2AJXL 5KN5B 5DA0B 4XBGB 2P5EE 4F37K 1O7SA 1VKXB 1W72A 1HHJA 4F7MB 1K8DB 2J6EA 3CSPA 4X6FB 2YHGA 1U8NB 3UJIH 1KELH 4X6DA 4JLRA 1EERB 5DQDL 4HK0B 3TYFA 3C5SA 3LN5B 1AGDA 4LARH 5HGGS 4ZNCD 3WN5A 3RIFF 5D9SA 3KYKH 5A16B 4G7VH 4RWYH 1IC5H 2W60A 4KPHL 3FB5A 4HPOL 2DQHL 5DVNA 4HFUH 1T1WB 4E5XA 2W9DH 5D1ZB 1I1CA 2H41A 3JV4B 3UBXI 5GXBB 4H5SB 2PTUA 5GZNC 3KPMA 2CDFA 4P49A 4J1UB 3MRQB 2R1YB 3MNVA 3OKKA 4JFEE 4X83A 1J8HD 4F7TA 1MVFA 2FB4H 5CJOH 3QFJE 4JFDB 3S8WA 1HSBA 1M05B 5DHVH 3UTQB 1KIUA 2A38A 1OCWL 1F6FB 4XPHH 1I1FA 1DBML 2OTWA 5E8NA 3AFLA 5FKPB 3GMPB 2IH3A 2QSTA 5BZDB 4HGWB 5IK3A 3VD9A 2BVEA 3OKDB 2F58L 4TSCL 1JCKA 4W70A 3PHOA 4UT7L 4LAJH 1U8IB 2RGSA 3KJ4B 1MQ8A 1I7TA 4LHUA 3ES6A 1NMBH 2VERN 1M7IB 3ET9F 2AEIT 2L4OA 3FONA 4ETQB 4WTWA 1BFTA 5GS0L 3O6FC 2ZG2A 3QHTC 3IU4H 3V95A 1WVZA 4GRWF 9CGTA 2MQCA 3LKPB 1T0MB 1MPAH 1BEYH 3BP5B 4NO0D 1KLGA 5CZVH 2V5RA 3KPQB 1TCRA 1ZVHA 3HI1A 4TVPE 2Q8BL 3C2SA 4PLKC 3O2DA 5TE4H 4XCCH 3QEUA 1T7XA 4MVBC 4WI4A 3TO2B 3DPBA 1U8PB 3KYAA 1P1ZB 4WTZG 3AMKA 4KQ4L 4OZFB 2XQYG 5BV7C 4CBPA 1IGFL 4M6MH 4K8RD 4UNTA 3SE3C 4U1KA 4MZ3A 4GQ9H 1OARH 2X70B 4FQQA 5E2UL 4ZDHB 2IG2L 3DXAA 1EEZB 1MIEH 1MFAL 4TTDD 3NH7H 5JPMA 4S1SH 3RI5F 4JPVH 1KIPA 4FQ1H 1JWSB 3ARTA 5LWYL 1OSZA 3W81A 1JK8B 5DYOA 1FVEA 2P8MA 1CQYA 2CQVA 1AGFB 2NX5E 1NL0H 1NAKL 1KN2H 2FSEA 1A1NA 4BQ9A 4ONGH 3EYVB 5FYJU 4ODUB 1RK1B 2UVEA 4LCCB 1QSEE 4KZDH 2DJUA 5KVGL 2VL4A 1AFVL 3VXUD 4CVXA 4U1LB 2NY2D 4WFFE 4YHMH 4ZUVB 3W2DL 4YE4L 5IJVA 3P0YH 1DQTA 2MWCA 3D1MC 4Z7OE 3O6KL 3MV9A 1JHLL 1DUZA 5D7IA 3BP7A 3EOTH 4PJFE 2O5ZH 1QBML 5BO1H 4OCSL 4Z95L 4EI5A 4J23A 1I3GL 3TBVA 1XR8B 4K7PH 5EU6E 3A0OA 2A73B 3KAAA 4YDJA 5DD5L 2XN9B 3T0BA 3QZWG 4ODHH 4JJHA 4LCWB 3TN0B 1LP9B 5F3BA 2Y06L 3MODL 2WP3O 4CNIB 4JQXC 4NQDD 3HC0A 3T2OA 2Z9TA 4XHJC 1P4IL 3MJ9H 4D9RE 5I15H 3WEXB 1QBLH 5I17B 4M61A 4PUBH 1OAYL 5IT2L 1NANH 3LHPL 4PRIE 3AM8C 1UXWB 4M4RA 3ZDYE 2JK5A 4URTB 5D2NE 4EI5D 5FF6A 5EUOB 5JIKA 5ILTL 1EFXD 4LLMB 4GRWH 4OB5H 4OZGF 4IDJH 3UTPE 2WIMA 1JE6A 2HLFC 3H6JA 5F44A 3IDUA 3TNNA 1QRNB 1BHGA 2OSLB 4JJ5A 4M5ZL 2Q3ZA 3MRCA 5H94A 5IW1B 5DJ2B 3H9HA 4JDVB 3IF1B 5IMLA 1WAAA 2E7MA 2BNQD 5A2FA 1YQVL 3T0DA 1I1AD 3T65B 4PJHE 1TVHB 1A1OA 1NUDA 3QI9B 3NZ8B 2R8SL 1MHCB 2PO6C 1FO0A 1NGPH 5SX4I 3O2VL 4XPBH 4MS8D 2VR9A 5C07D 2XG5A 3LD8C 4PTTB 3F62A 5JZ7D 1N5AA 1SJEA 1UB6A 4WW1B 3DNKA 2CUMA 4RQQA 1CD1A 4U1JB 5C09B 3OAYK 1HEZA 4Y5YB 4O58H 2BOBA 4U6VL 1KPRA 2Y1VA 3HI5L 4EDWH 4XNMB 1WCBB 4PRAA 5J7CC 1G9MH 2W0PA 2I60H 5E99L 5TE6L 5C0FB 1S9KC 4NUJB 3SKJH 3SDYL 3ZE1F 2DIJA 3ILPA 2IEPA 3PP3K 2R56H 12E8L 2X89D 4Y0GA 4WO4D 1H0DB 3OAUL 5EBLA 1N64L 4XP1L 4DN3H 3ULUC 1QFWL 4MD4A 1UQSA 1CK0H 4P2YA 3ARQA 1RHHA 3BPLC 2FJGB 3EDEA 1RJZA 4KRMB 4GRMA 1X44A 5B8CC 1I3RA 1QFUL 2W65B 3WIHA 4M1GH 5EO0B 1PZ5A 3W0WA 1LNUB 4QHUB 2B4CC 3MBEC 4FN0A 4OCWL 1QACA 4OLEA 5E6YA 5GZND 2KKQA 4K3EL 2CIKA 2LVCA 1EHLH 5AEAA 3VFMB 2XFXA 2X4OB 4MA3A 4UDTA 2F19H 1C08A 2H9GA 1J8HE 3MXWH 4YX2L 3LS5H 3WLBB 5D93C 1MJUH 3EFFB 4IM8A 3VRIA 3BH8B 2EE6A 3PWPB 2EYTB 2EEBA 3CSBA 5SWZD 5JA8B 1WFUA 4Z7UE 3MXVL 3W0WD 4M8QA 1F4AA 4LLVA 3DO7A 3X13A 1GGCL 5D5MF 5B22A 3N1PC 4MNQD 3QJHB 3MX0A 1YN6A 4XP4H 3O6FD 3RZCC 4DAGH 1GAFH 3BVNA 4ZAKC 1TETL 5MERA 1NCAH 3TNMA 4XCNB 4LASL 2JCCA 5FK9A 1ND0A 4U6HA 3VCLA 3FO1A 4FTVD 1OP5H 5DTFB 5I1HL 1W0VB 2XKNB 5IHZA 3EZJB 1RIVH 4P59L 2FZ3B 3STBA 1MJ7L 1A6ZB 3WSQL 2C3GA 3LEVH 1BFVL 3VA2C 1MCJA 1JTPA 3L6FB 2Q6WA 1KCUH 1QNZH 1EBPA 5DMYA 3SE4A 5IG7A 3D69B 4PJGE 2R23A 4GW4A 1W0WA 5A2KH 5EO1A 4TN9A 3HS0B 1JYWA 4BKLA 4XPGL 2VN4A 2CO6B 2GYSA 4QTIL 1PG7X 5FCUL 1HZHH 2DKMA 2YD3A 3GSQB 1D5BA 5EU3B 3S37H 1CTNA 4OCMC 3MV7A 3QHFL 5HI5C 1UWEH 1U8LB 2VOTA 3IDMB 1KIRB 1MRDL 4GKSB 4M62H 5DVMA 3REWA 1F00I 4P2QA 1EEYB 5TF1L 5BXFB 1XGRB 4JHBA 4CJ1A 1NAMA 5T3ZL 3NAAH 2AAVA 3K81A 2XZQH 4BZ1H 4NSKB 3FMGL 3VXUE 1VSCA 4QRPB 3RVXD 3GBMH 4ZS7H 5GS0C 1YEFL 2OJEB 5C8JB 4X8JA 2Y36L 1JZ3A 2QR0B 1ZLWH 4G43B 1C12A 3VXTA 4XNYH 2EDRA 5C6WH 1LO4L 4JAMA 1JI1A 1JUFB 1KB9K 1UG9A 3DETC 2OR9H 1JNNH 2UWEB 4PJ5A 4HC1H 1FRGL 4GRLB 3W11C 5JIIA 5D1ZC 5I8EB 1FNFA 1RIUH 3N85L 5IMMA 3DX9A 3IB4A 3F7YA 5TPWL 1JIBA 2XPGA 4NQDE 3SGDH 3IFNH 4OLUL 1KYOJ 5D7LB 4JFOB 1INQA 1K4CB 5F7EH 3H2WA 2XZAL 2AJ3B 3QSKB 4JO1H 4J12A 4PJCA 4EI6B 4Q9QL 4G3YL 1B4JH 4I8DA 5B38G 2WV3A 4HS6A 3CXHJ 1RULH 2AJSL 1MVUA 3V7MA 3MUZ1 3ARDA 2ZUYA 4KKNA 2HT4D 3KJ4C 2J8UF 5C0BD 4CN1A 4ZFFB 1T6WA 4ZO9A 1C5CH 4X6DB 4JLRB 3UTTA 4D3CL 4APQC 5E8DL 1AGDB 4KQ3L 1A64A 4QHLA 4OM1L 1WWBX 4QNPE 4PP2A 2ICWA 4QCIA 4BSVB 1CGWA 3DARA 2NNAB 3MA9L 1WIUA 2VDPL 2W60B 3IJHB 2H6PA 2ZJSH 5I18H 2QHLA 1GPOL 4DKFL 1YZZA 2BNQE 3KPMB 1KSRA 1U8OB 3OKKB 3HKFA 5KS9E 1NSNL 3ZLQC 2H8PA 2GHWB 3V4UH 3WHXB 1GZPA 5DRZB 1E6OH 5C07E 1HK6A 3FB6B 3WUWG 5FUZL 1I1FB 4M4PA 2XWJB 2NY5L 4NZTL 4GBXA 3SO3B 4P4KD 2B1HL 2OQJA 5E2WL 1KOAA 5IK3B 5LAXA 3BSZH 3N50A 3TVMD 1MCWW 3Q5YA 5DURB 4BSJA 1F4XL 3HR5A 3PUCA 4RAUA 3ES6B 2QHRH 3OJ2C 3VXMB 2VZSA 1QLFA 2FATH 2I27N 3VFUA 3UZVB 4KK8C 1JV5A 1NDGB 2R2BA 2J6EL 3ULUD 5CBEB 4KHXL 4HWEL 4LCCC 3I84A 5FA4A 1KLGB 1WIPA 4M1CD 1TCRB 2ZNWA 4LBEB 5GISL 2HN7A 5DWUL 1A3RH 4OSUH 4X7TA 5JW5A 1H8SA 4Z7VA 5JUEH 2XT1B 5I1KH 1TTGA 1G7HA 1KTRL 4XWGH 3DYMA 5DJ8A 3U30B 3TF7C 3FQRB 4OCRH 1FVCA 1TNNA 1RZ7H 4ELMF 2IPTH 1EPFA 1IBGL 4JHWL 2JIXB 4OCLC 2YUWA 1CIUA 1J18A 4RFOH 3L3GA 3L3JA 4S10A 4ERSH 5DYOB 5DR5L 3B2VH 3MR9B 5JOFA 3MRJA 4EUPH 3TN0C 5CSBA 3LQMA 3ZZ1A 2AK1L 3AU1B 2EYSB 5CGTA 2ED9A 5I0DA 3O2WL 2GIYA 1A1NB 4HKZB 2PN5A 4R26H 4X9IA 3E2HC 3T2PA 1KN4L 2ZCHL 3GSXA 5SWZE 3MRKA 2VYRE 4W4OA 1X5ZA 3NABH 4L29A 4Z5RB 2VZUA 1A02N 1L7IL 3RZCD 4PJEB 4MNQE 3UC0H 2YUVA 1DVFA 1U3HB 5HXMA 4LEXL 5GJSL 3NCJH 1X4XA 3QQ9C 2AK4E 3QIUA 3MJ8A 3KHQA 3MV9B 3JWOH 2Q86B 2BNRB 3V52L 3K3QA 1DUZB 5D7IB 5I1GL 4AQ1B 5KVFH 5F7YC 1ZLSL 4FTVE 2VDNL 3L5XH 4LSRH 1JPTH 4NKOA 3HCVA 4XBPB 4EDXB 3TBVB 3WIFB 1JYVA 3W9DB 1YQ2A 4ODSL 4YDJB 4JQVC 2BVPB 5EZOL 4X7SH 5F3BB 4P5TA 4GMSH 1MFEL 1T7VA 4OFDA 4UV4H 5C0NC 1MHPL 5M7QA 5EULV 4PGEA 4XI5C 2ZCKL 2QSCH 2FLRT 4OZ4B 5DHVA 4HBCH 3DSNA 1D5ZA 1CD9B 4ODVL 4MQXC 1WQVT 3RTQA 2YKLL 1ZHLA 5C0CA 3FOLA 5HI5D 3QIWA 1WFTA 3I50H 2DQUH 4IRJC 4DGIL 4Y5YC 3C6LA 4WWKB 3D2UD 5K93A 4F7EA 5IHUL 3S34H 1GHFL 5C0RL 3TNNB 2V2XA 3HFMH 4P5TD 4AEIL 3L95A 4JJ5B 3MRCB 1NCBL 5H94B 1FH5L 2A6KB 3H9HB 5ELIA 1V7NH 1FGVH 4Y1AD 4NQUA 1MHHA 3QUYA 4C57C 1CR9H 1DBKL 3GSOB 4R90L 2AS5M 1NFDF 1J0IA 3GBNL 2MSPA 4N90D 2GSIA 1YUHB 3AREB 4Y19A 1A1OB 4OD2A 3RGVD 1U8MA 4P2OB 3MGOB 1IGYB 2GK0B 3LCYA 3GHBL 3GIVA 2GAZB 5D7SH 3QDGA 3W11D 4YO0B 3GEWB 5F93C 1SJEB 1MRCH 1UB6B 4UOW1 1ITBB 2DB8A 3GJFK 3MYZA 4K7FA 1J0ZA 4RQQB 4BSWA 4K7PX 2ADJB 4QXUL 4YHZH 1HEZB 1U2CA 2BOBB 1Q1JL 1NFIA 5DMGC 3UX9B 3QUYD 4JFDD 3GO1L 3HE7A 1ZOXA 5HVFB 3D18A 1IGCH 4J3XA 3D85A 2VABB 1JZ8A 4OLXL 5ESQA 3RWEB 2BRRH 4BYHA 1YN7B 5EZLA 4GXVL 5IJKC 4U3HA 1DQML 4HXAL 4MD4B 4PRHA 3W82A 1UQSB 5FO7B 1ZGLM 2LTQB 2Z92A 5E6ZA 1SM3L 1RHHB 4APQD 4CL7A 5GZOD 1RJZB 1U8QB 3T0VA 1P7QA 5C0BE 2IMNA 4O4YL 2ZUTA 1PZ5B 5HYSB 1B2WH 4TYUA 1I85A 3LSOA 4YNYA 3QDJB 5I74B 5IV2B 2CIKB 1RUAH 5F71A 5DEZA 1HNFA 2ZUXA 4UDTB 4MA3B 1C08B 3HC4L 2A6DA 2H9GB 3S6CA 1GGIH 3LB6D 1XGYL 4XCYA 1JBJA 1HN1A 4ZTOH 1RUQL 3L3KA 4YPGA 1DBJL 1P7QD 4M6NH 4M8QB 1GRWA 2VR4A 4LLVB 4S0TD 3ZDZF 5B39B 4N0FA 2AI0H 3ARPA 2E8YA 5CEZH 1B4RA 1NGQH 3U48A 1MIMH 1IQWH 5DI8A 3ULUE 4BK4A 4HPYH 1XGTB 4U6HB 3FO1B 3KXFD 4YC2B 3RPIA 4PY7A 1V7ML 4OGAD 1EO7A 1N2RB 5JDSB 2BY2A 2FCBA 1T2QL 4DTGL 15C8L 1N3NA 2ORBL 4Z0BH 3GI9L 1EJOH 4IBLT 3TFKD 1Y0LB 4KK9C 4Y16A 1P5VA 5ALBL 1CDUA 4QY8A 2C4XA 4GW4B 3K1KC 3INUL 4BKLB 2X1PA 5LVEA 3SE9H 1S7VB 3CFJA 1RMFL 2V2WA 2ZOLA 1MF2H 5B21A 4GRLC 4LCWD 1B90A 3EYUL 1D5BB 3P4NB 1CLCA 4LKCB 3MV7B 3QUKA 3Q2CA 3RP1A 1KCVH 3HMXH 4RWHA 4WUUA 5C2UB 1FNAA 4I2XE 2NY5C 4KI1A 2AW2A 1CGSL 1CXLA 3ZYIA 1P9MC 4P2QB 3ABZA 4G6JL 1TVDA 4ZODA 4X5WB 1BP3B 1VFBA 2CLZB 3G5VA 3HG1D 1IGML 2VB5A 2BSED 2DDQH 2QJDA 5GHWH 4UTBL 2OJZH 4OBRA 4FFWC 5H37G 1HQRA 4I3RL 4MWFB 3QHZH 5CD3A 4X8JB 3GRWH 1C12B 1FNEB 5DJDA 1S9WB 3M17B 4KUZL 4L4JA 1SJXA 4RGNB 1SQ2N 4Y88A 2EDEA 5I30L 3QNXB 2X4UA 3VXNA 3BMWA 5KJRH 2VDLH 3QAZB 2DBLH 3UPRA 5C0ND 3ZT7A 3JV6A 5FM5M 1WICA 4FOMA 4XI5D 2QQLL 3AS0A 3RVTD 2PUQT 2GTZA 4IMLA 5F89A 3SKMB 4YQXL 3NA4A 1YJDL 3TPKA 3CGTA 3F7YB 2A9NL 5IB3A 3DMMA 4MQXD 3ULSA 1N8ZA 2D7NA 3BKYL 3LEYL 1INQB 4UIKL 4X6CB 4XMKL 4IRJD 4PJCB 4LU5L 4GJTB 1RVFH 3SO3C 2BK8A 4YDKH 4OZGA 3QUMB 3QEHA 1G9NH 1OAKL 4HS6B 3S37X 4D0CB 3UXFA 3PL6A 5EH1A 1Q0YH 3ARDB 1FL5B 1YPZF 4MJ5A 4G80B 4GAYB 3LPWA 4UNVA 5J89A 3G6JE 1CFQB 4LSTH 2DKSA 3BJ91 3RY4A 2ICWB 4HWBH 4QCIB 3B4NA 4ZPTB 4Y1AE 3ZSSA 1O7VA 4V2CB 4R4FH 1EH9A 5F9OL 3C5ZA 4UT6H 1P4LA 2OL3H 1CFNA 2AGJL 1B3JA 4EN3A 5FIEA 1PG7L 5JXEA 3WXVH 3K2MC 3LZFL 1X5YA 1DL7H 1GZPB 5ID0A 4J8RB 3PL6D 1BD2B 4ORZC 3L1OH 4YUEL 1JGVH 4P2RA 2YXMA 3U30C 3QG6A 1F4WH 1IAIL 3FCTA 4GBXB 5DEGA 5GRUL 1SEQH 2HFFA 2OQJB 2R0ZH 3HZKA 5C0IB 1QSZA 5LAXB 3UYRH 3S35H 4DQOH 4JFDE 4KTEL 3HR5B 3MUJA 4RAUB 2Y7QA 3QUML 4M7KL 3PWPD 5FGCB 1H3WM 3JUZA 4U2ZA 1MI5D 3VFUB 5JXED 2CLRA 1JV5B 2R2BB 2VE6A 5CWSA 3V6FA 3H42H 1INEL 1CIDA 1QG3A 4S1RH 1CXHA 2X5PA 5JHDB 3HAEB 1I7ZA 4AT6B 3P4MA 5DVKA 1PKOA 4H0IA 5KSAA 4PBWD 2HN7B 2E7CA 2DLIA 1XH3A 4X7TB 5T3ZD 5KAQF 4KTDL 4Z7VB 5HYIA 1OWRM 1FIGL 1U3HC 3TH4T 3RWFB 4KMTH 2YPLD 2WBJA 4NP4L 5AZEH 1G7HB 2EIBA 1IAOA 4JZJB 3KPSA 1LO3H 1AQDA 2YD5A 3VFRA 5BVPL 1FVCB 4YHNA 4LHQB 4OAWB 1KEGL 2FX8L 1EHAA 3DVGA 4PJ7E 3ZKNC 3HPJB 3L3JB 4FMFA 5D1QB 4PJDF 3X3GL 5JOFB 3G5YB 5KSAD 4JVUA 3U0WH 2CK0L 3QIBB 5BQ7A 3VE0B 4XZUA 3ARBC 3KNBA 1NGYA 3O45B 5D5MA 4ZO7A 4BH7A 5JR1L 4KV5E 1AR1C 1A6VL 3IDGA 3SDDD 3FO9A 5ETUB 1YNLH 4L29B 2CK2A 4V2BA 3GSVA 3VJ6B 1T03L 1PKQA 5B3JE 4GT7A 4F58H 3ARVA 5HYEA 1DVFB 4WWKC 1BGXL 1EEUA 4XBEH 4POYA 3IXTB 5A2LH 3QIUB 3MJ8B 4JO4L 4MXVF 3EYSH 5CLWA 1OF2B 3KPNA 4OKVA 1BQHB 4RFEA 3TBSA 1JGEA 1JHKH 3K46A 2FIKA 3CFCL 5CZXC 5SX4H 2GITB 3KXFE 5F9JA 3THMH 1UH2A 1JWUA 5KBNC 1KFAL 1Y6KR 1YY8B 5IM7A 3VXSA 4FQLL 4PJIE 2ERJB 5TQ2H 4D8PB 4N8VB 3JV0A 1FJ1B 3VWJC 1SYVB 2YK1L 3B5HA 3FZUD 3RUGF 3AREC 4FABL 5L9DH 4P2OC 2RFXA 3HC3L 4PGEB 2V5YA 5DHVB 4NGHH 4XPAL 1BWMA 1T2XA 1GOGA 5DQJA 2WIIA 4L3CA 5BOPA 1FV1A 2OTUA 3BD5A 1T21B 3RTQB 1ZLWK 5CIPH 3QG7H 5C0CB 1OAZL 1JYXA 1Q38A 2X4RA 1HQ4B 1HI6A 2QSQA 4LCWE 5DLMH 5IEKA 1KBGH 4EZMA 1WJ3A 4F7EB 3ROLB 3JVGA 3RWDA 3W39A 4KRPB 4S2SB 5DVOA 5DJ0A 3L95B 2FJHA 3B2UD 3UJIL 1KELL 2B2XH 1IEAA 5C0GB 4MSWA 5ADOH 4LARL 3BZDA 1MHHB 3HG1E 5EUOE 2F15A 4FFWD 2AV7A 3KYKL 4NQCA 2Z8RA 2R4SH 4G7VL 5DEFA 4RWYL 5C0DB 3MCKA 3ARUA 1J12A 5F6IB 1IC5L 2LTQC 3Q5TA 4HFUL 4OD2B 1ZA6B 2W9DL 4EXPX 4LLYA 1QRNE 3DYPA 3QDGB 1WWCA 4C83B 2DM3A 2FB4L 5CJOL 1CICA 2IPUG 4V1DA 4BSWB 4K7FB 1EJ6A 2J5LC 5I74C 4XPHL 4P23B 4PRBA 4UT9H 3D18B 1JGDA 5T3XH 3MZGB 3WDIA 5MEQA 5AG9A 1M7DA 3D85B 4X80H 3ZDXF 1NMBL 2QQNH 4IIQA 4PY8J 4Q6IB 5C09E 4F8QA 1I1YA 2NXZB 5BRZD 5DURD 4POZC 2BP3A 1UVQA 2J8UA 3IU4L 4F80A 4OCNC 4V1DD 1MPAL 2Z92B 1BEYL 1P84K 1SMOA 5CZVL 5FDWB 3QPQC 1T04B 4O2EB 4OZIE 2CUIA 5TE4L 3RWHA 1GL4B 4XCCL 4HIXH 2ILLA 1L6ZA 1MFNA 5MP6H 2CKBH 2P8LB 4HLZH 2RHEA 4YC2C 4M43H 3LSOB 3UTSB 3TO4D 4YNYB 4M6ML 4Y2DB 3VXRB 4GQ9L 4NDMA 1OARL 2D4DA 1OGAA 4HF5H 1MIEL 2A6DB 1CG9A 3NH7L 4S1SL 3NCYP 4JPVL 5E9DA 1IAKA 4FQ1L 4CN6A 4XCYB 4XAWH 1MY7A 2G5BA 1NMCB 3L3KB 1LDSA 3IYLW 3N0PB 4YPGB 4ZOAA 2JIXD 1VA9A 4KRNA 1N7MH 1FFNB 1WUNT 1NL0L 1KN2L 1OL0A 4KU1A 3QXUA 4PJAE 3G6AA 1S3KH 2F54A 4ONGL 1YJDC 4NKMB 3J8F7 4KZDL 1KTDA 2YWYA 3WXWH 1IRAY 2R1WA 2XA3A 1KJ2H 4GRWB 2JB5H 3QQ3B 4S1QH 5CHNA 1ED3A 4YHML 3PWPE 3K2UH 1WZ1H 4HJGB 2M26A 1MI5E 2F9BT 3P0YL 4WFED 1RZ8A 2BMKA 5DI8B 5IVXB 3RPIB 1G7PB 4XAKD 5E8EA 3N1FC 2CD0A 3BOVA 1EGJA 3EOTL 4DOHB 1KIQB 1NDMA 1URLA 4F9PA 2O5ZL 3RVWC 2VQ1B 5BO1L 5T3ZE 2BNRD 4GUPB 1MCOH 3VG0H 3V6ZA 1MY5A 4L5FH 4TNWK 2YPLE 4K7PL 4ELMA 1KNOA 43CAA 4Y16B 4QY8B 4ODHL 2ARWA 3NVQA 3BGMA 3VDBA 1ZE3C 4F2MA 4RGNC 2EDTA 1XF3B 2WWKT 2ZOLB 3DUSA 1D6EB 3MJ9L 5I15L 4XNXH 1Y18A 5D6CB 1QBLL 3QAZC 3ARFB 4XH2A 5F1KC 5FYJD 4PUBL 3U4BH 3ARBD 3JSSA 1AR1D 4WUUB 5IB1A 3N06B 2BSTA 1ZHBB 4CDHA 2BHYA 5IBLC 4Y4KB 5CFHA 4OB5L 2OZ4H 4IDJL 1VFBB 4HJ0C 1FZMA 1MCFA 3IFPA 1YNTB 4WWKD 3O11B 3AS3A 4UI2A 1A7RH 3RHWF 2I07A 3NGBB 4HV8A 1H3GA 3WDHA 3ARDC 4GKZA 2EO9A 2XWBB 4IOSD 2E8ZA 5DJDB 1JZ2A 1UT9A 3MLXH 1C5DB 2F5BH 5DJ6A 1NGPL 4W68A 2VWEE 1F4YH 4PRPA 2EEAA 4XPBL 4QRPE 5FAAA 4OLZH 4YLQT 2AABH 4NFBA 3VWJD 1J0JA 5CP7A 2X4UB 3VXNB 4JGMA 1IC1A 4WENB 4P2OD 3JV6B 5D96B 5H2BA 4MAUH 3CPLA 2GTZB 4IMLB 5F89B 3T1WA 3L5WA 4OF3A 4O58L 5IB3B 4M7LH 2PW2A 2HVJA 3DMMB 3ZKMC 3ULSB 2W38A 3T4AB 1XF5A 4EDWL 3SDXE 1GCFA 3RVVC 2UWEE 4AEHH 4H0GA 1G9ML 5ESVA 3SKJL 4GBXC 1C5BH 5HDBF 3VFOA 4OZGB 2CDGB 1Q9WA 3ZYZA 4OLVH 1TFHA 2R56L 4AIXA 1KTLA 4LLWB 2LU3A 1YEKH 4JPIA 4DN3L 4LPXA 3VMNA 5D7LE 5I1JH 4BM7A 1HYSC 1T4KA 3GSWA 3CDCA 1N5YH 3FFCD 1CK0L 4TUKH 4YFEA 5CGYC 4PJXF 1VEMA 1NFDA 4PGCA 4X7EC 4P0DA 1CLYH 1ZGLP 2V2TB 2FGZA 4M1GL 3FQTB 4LK4A 4HZLA 5CD5C 5JW3H 3C5ZB 1P4LB 3WFCH 1CFNB 1T3FA 1ZHKA 4EN3B 3LIZH 3P3YA 4WJ5A 1C16A 3S5LG 1T89C 4H88H 5MENA 1FG2A 1BVKA 1EHLL 2F19L 4JZJC 4P2RB 3QG6B 3QDJD 3MXWL 5JTWA 3FCTB 1MJUL 5K33A 2HFFB 3HZKB 4HGKC 5IGXH 3VH8A 3UTOA 3QCUH 3WNKA 1V05A 5D1QC 4M5YH 3QJFA 1CL7I 4Q97A 2BVUA 3ZHLA 3HMXA 4NIKB 5F1NB 3OWEA 2MNUA 3QIBC 2H26A 4XP4L 3E1F1 2CLRB 1RZGB 4POZD 2VLJB 5CWSB 3V6FB 4DAGL 1GAFL 3SKNA 1AXTH 3WO4B 1NC4B 1AO7A 3PWNA 1FPTH 2Y23A 4MXQC 3MOBH 4XNQB 5BRZE 1NCAL 3P4MB 3U4EA 4OGYH 1P4BH 3VXME 1XH3B 4OCXH 4V1DE 3ZT6A 1BECA 1DVFC 1S8DA 4RISH 3UBXA 1RIVL 2WBJB 3GRWA 5J8OA 3LEVL 1AQDB 3D39B 4Z76A 1KCUL 1QNZL 3LKSB 2EECA 1CDCA 2VLMD 3WFEH 2LABA 2WBWB 4FA8A 3I6KB 2YN5A 3MC0A 4TOYH 2ERJC 5L7XH 4IOIA 4I0KA 1HZHL 1BIIA 2R2CA 4NN7B 4XZUB 3EKCA 4LDEB 3KNBB 3S37L 1NGYB 1HE7A 4ZPVA 3B9KA 5D5MB 5CJ5A 1UWEL 5I71B 1EXUB 3RKDC 3BMVA 1B88A 3FO9B 4M62L 5I1EH 3LKQA 3O3BB 3WYRA 3F5WB 3RTQC 2ATKB 5KTEH 5H35A 3S35X 4EOWH 1PKQB 2VIRA 5IF0B 3NAAL 4DFIA 2MQ0A 2XZQL 4NUGH 4BZ1L 4KGLA 3RL2A 1O5DT 1FYTA 4KRPC 4DWHA 3GBML 4U4BA 2G75B 1AR2A 4ZS7L 2CGRH 4RFEB 1KACB 3UYOD 1NBVH 1QTYT 1YEJH 4WFEE 1FZOA 4I0PC 2DTMH 4HWBA 3VI3F 5FYLH 2L0DA 5F9JB 4KMLB 2ZNXA 4XAKE 4PJEE 5DRNA 4XNYL 1KB5A 1ACYH 1JWUB 4TQEH 4YIQA 1OW0C 4Q2ZB 5DD6A 1WBYB 3VXSB 2JKXA 3GSRA 2OR9L 4GAJH 2OL3A 1JNNL 2BNRE 4HC1L 5C2BH 4W6XB 4Z7QF 5CSZB 4AQOA 3OV6A 3H0TB 4CMMB 4I3GA 3EYQC 4ALAH 1MFCH 1RIUL 4FXKB 2VDOH 2WIIB 4L3CB 1N0XH 3SEPA 1FV1B 4E9LA 2ESVD 2OTUB 3PWVA 3IFNL 4G9DA 3T3MF 3QULA 1F90H 1QFWM 5ID1A 4FQPA 2X4RB 5F7EL 5DC0A 4JO1L 4LPYA 5FYJE 5IEKB 1KXTB 3VI4E 4P23C 3VDAA 3C87A 4U49A 1KYOK 3RWDB 1B4JL 4HJ0D 1RULL 2FYYB 2Q8AH 3NIDE 5FUCE 3P9WB 3DBXA 2BSRB 5EORH 4B53A 4JQIH 4FQ2H 4L4TD 4Q6IC 1C5CL 1LQSR 3CXHK 1IEAB 1RZJH 5HYQA 4HIIB 4X9GA 2FD6H 4NQCB 5DEFB 1K3IA 3MCKB 4B50A 3B6SA 1QHPA 5DJAA 2ZJSL 5I18L 2B39A 1S5HB 4LLYB 1XCTB 4LVHB 4YHIA 2ZUWA 5FKAA 4RGMB 1I4FA 2PR4H 1IJ9A 1H8OA 5EUKB 3V4UL 1I85C 1Z5LA 4HUMB 1U3YA 1P6AB 1E6OL 1BZ9A 1WSST 1WBXB 1DQJA 4Y2DC 3MJ7A 4PRBB 1J1XH 2YC1B 5E1HB 1BD2D 4EUPB 1T1YB 3BSZL 2IANB 5FA3A 4BFIB 3SGJC 2FJFB 2J7LA 3HUJE 1M7DB 4P3DA 2QHRL 3E3QE 3RVUC 5TGBB 3CFBA 1I1YB 2FATL 5D71H 1V3JA 4KMQA 1JRHI 1YPZA 1DQLH 2H3NB 2I5YH 2P5WA 1UVQB 4NQXA 4RCAA 4ODTH 1HYSD 3LRSB 2CR6A 4QKXB 4MAYA 4U7MA 5ANMA 5GS1B 1R3JA 3HZMA 2OYPA 5CEYA 2FWOA 4OFPA 3OF6D 1A3RL 3FFCE 4OSUL 5JHDD 5JUEL 1OVZA 5CD5D 1FFQA 5I1KL 3OXSA 4ZFZA 5C7XH 4Z9KB 4XWGL 5CMAB 4YJZL 1JPSH 4OCRL 4LCIH 4G8GB 1X5GA 1RZ7L 4X0KB 4NDMB 2IPTL 1OGAB 2P5WD 4KTYA 4MX7B 3EW3B 5JOPD 3EIFA 1CG9B 1F3RB 2BXYA 4KKCC 5E9DB 4MAYD 4RFOL 3H3BC 3JWDH 4ERSL 4QRQA 1K6QH 5F3HA 2G5BB 1ZS8B 3FO0H 1DJSA 3QDJE 5T1LA 4MJ6A 4L8SB 4IRSC 5CIPA 3O4LD 2NY3B 4RMSA 5ESAA 4R26L 4Y4HD 3VFGH 1LDPH 3ARFC 4P5MB 3KG5A 3NABL 1KTDB 1KPUA 4MMXC 4JFQA 2APVA 1G9MC 4LPUA 3T3PE 1ED3B 4UQ3B 4A2LA 1JPFA 3UC0L 5F6HJ 3P77A 4ZD3H 1BZ7A 4JFFA 3KDMB 1JP5A 4IEFB 4Y4KC 1RZ8B 3NCJL 3TJEH 3ARGA 3SDCA 3JWOL 4WRLA 5KVFL 3IDYB 2D0HA 1XF4B 5F7UA 1EZVX 3L5XL 1OAQH 4LSRL 4PPTA 4RX4A 3KS0J 5F7HA 3AB0B 4ELMB 1KNOB 1NEZA 3B9DA 4KJYB 3TZVA 4X7SL 3LN4B 1NH6A 3E0GA 4GMSL 2O61A 4CKVX 4UV4L 1FL6B 4BFGA 3FN0H 3BGMB 1ZT7A 3D0LB 2VLME 3UCRA 4F2MB 1Q9KA 4PJDA 2QSCL 1MFBH 3ARGD 1OT1A 5C92A 3SDCD 3C5JA 3X11B 1X5JA 2BOCA 1Y18B 1IMHC 1MCHA 5DMKA 4KKAD 1BX2A 3P9LA 1RUKH 3I50L 2B0SH 2DQUL 1IM9A 3PQYB 4RX4D 3DMMC 4XCEA 3I2CH 3S34L 4Y8DC 4AENA 1X5FA 2VH5H 2OR7A 2W92A 3IFPB 2BJMH 3HFML 3SN6N 3P4OB 4HX1A 1S5IH 1V7NL 1CDHA 1FGVL 2GJZA 4MD5A 1F58H 3R0MA 3MLWH 4HV8B 1CR9L 4PV8A 2I25N 4I0PD 4YGVB 4GKZB 4C56A 3FB7A 3IGAA 5I75B 3KYMB 2VLRA 4OGXH 4NC0B 4NYLA 4NHCH 4Z18A 5F9AC 2I24N 4PRPB 1JTOA 1WZKA 1YY9C 5D7SL 5CP7B 5DHYA 1NKRA 3BIKA 5HGDB 3EDKA 3C5ZC 1MRCL 3OZ9H 3CPLB 3BKCH 5D7JA 4EN3C 3L5WB 5EN2A 5LGKA 1EAJA 4YHZL 3MV8B 2PW2B 4XRCA 4GAFB 4KI5C 3TC9A 3OGOE 4NQEB 2ID5A 1BJMA 5C0AA 3O8XD 4JN2A 2YN3A 2ZZUT 5HHVH 2OX5A 3BISA 4DUXA 2ESVE 5DD1H 1EHNA 4P23D 4H1LA 3V6OE 1Q9WB 1IGCL 4HAFA 5DFVC 4JM2F 2KZWA 2ADIB 5BW7A 4FP8H 3WJJC 3RJDA 2BRRL 4JPIB 1KJ2A 4K07A 5I76A 4X6CE 4XPTH 3WUZA 4IOFC 3MMEB 4OUOA 3CDYA 1F6AA 4DN4H 1DEDA 4PGCB 3WO4C 4L4TE 4PRDB 1GOHA 4JY6B 3QDMD 1QQDA 4FRWA 4HZLB 3MLSH 2Q20A 2G2RA 4M7ZB 4OV5A 2AXHA 3EYFA 1WC7A 3DYOA 4UINH 1YMMB 2VC2H 1J0YA 1T3FB 1ZHKB 4PY8I 4G7YH 1IL1B 4WJ5B 2BNUA 1R24B 1RUAL 3S97C 1BVKB 2YD4A 2N1KA 1PZUB 1UFUA 4BH8A 5INDA 3UTSD 1QVOA 1GGIL 1TZHB 3AVEA 4AYFA 4HKJB 3QUXA 4Y2DD 1IKFH 1I8LC 4ZTOL 4KC3B 4G8FB 2JJSA 4NRYA 3DRTA 3NIFE 2PCPA 5E5MB 3TV3H 1ORQB 4M6NL 2P7TA 3QJFB 3OJMB 4YDIH 4Z7OF 1BD2E 3SDAB 3QO1A 4KHTH 5DQ9A 3RVUD 2HVKA 2AI0L 4R9HA 1K5NB 4NN7C 2H26B 4B5EA 1CDJA 4QRRB 3L3DB 4PJFF 5CEZL 1TIUA 4HIHA 3E6FB 1NGQL 3SKNB 2CJUH 5I71C 1AO7B 1MIML 3PWNB 5A43C 3A6BH 1HHGA 1IQWL 3U4EB 4S1DC 4HPYL 2Y6SC 1RFDH 2R2EA 5C08B 1E27B 5FGCE 1EZVY 3CFKA 3UBXB 1U8JA 4YHKH 4RBPK 2HJFA 5ISZA 2M8XA 1CGXA 4Z0BL 1KUMA 5JHDE 1EJOL 2MHAB 5CEXA 3G6DH 3B9AA 4E42A 5FV1L 3SJVA 2IH1A 3ZDYF 4OGZA 3ARSA 4KKCD 1YYMH 3LH2H 3SE9L 3PXHA 3VRJB 1SHMA 4KKLC 1MF2L 1BFSA 1EO5A 3VGEA 4M48H 5JOPE 3MRLA 1BIIB 5E6IB 2A9MH 5E8PB 4YXLH 5F88A 1G6VK 4IRSD 3IJYB 5EIIA 3B9KB 1IT9H 1KCVL 1ZVYA 2DL2A 1EUUA 3ARFD 3LKQB 2HFEA 1CVSC 3O4LE 5DUBA 4DW2H 5DK3A 2I26N 3H7BA 2VIRB 5SWSD 4PJHF 1QO3B 3C6SB 3NFSH 2Z31B 1AXSA 1FIEA 3M8OH 3RL2B 4Y4KD 4G42A 4S11A 1FYTB 5EC2A 2W91A 2DDQL 5GHWL 1X5IA 1NUNB 3QEGH 2OJZL 3ETBF 4U6YA 3ARXA 1MAKA 1L9MA 1TJGH 3QHZL 1WBZB 1G7LB 2F53D 3GRWL 1OB1A 4ZNEA 5DRNB 1AGBA 3BDYH 4QRSB 3GSRB 4N0CC 1FAKT 5EIQA 4C55A 4Z7NE 2OL3B 2LAAA 5DVLA 1QFPA 5H37H 1BQUA 5KJRL 2VDLL 2DBLL 3WS6A 4LVHC 4XP5H 1G9EA 4RGMC 2V5TA 3DLQR 3WE6A 4HUNB 4LQFH 1HSAA 3CXDH 1TCMA 5C71A 1CU4H 4LSVH 4F15B 3PWVB 4YHPA 3L5JA 4G9DB 1LD9A 4E41D 4XP9H 1I8KB 1RVFL 3F58H 4RIRA 4PGBA 4YDKL 3HTLX 2JJUA 1YECH 2ZG1A 1G9NL 3O6LH 8FABB 4U1MA 1PBYA 1MWAL 3TBYB 4XVTH 1QZ1A 1Q0YL 1UEMA 1UXSA 1QEWB 4NZDA 5DZLA 2SEBB 1FBIH 1KLUA 4NO2A 5L2JA 2DLTA 4LSTL 4RFNB 2WQRA 4HWBL 5GS1C 1WCQA 3B6SB 3HE6A 5DJAB 4K71B 4R4FL 3DX7B 4UT6L 4YHIB 5FKAB 3JWOC 4O00A 1I4FB 2OL3L 3DIFA 1VADA 5TH2A 5C0JA 3CUPA 3WXVL 3UJTH 2C3VA 1AIFA 4Z7UF 1Z5LB 1DL7L 4JG1H 3NBNA 5E7BA 2GSGA 2E5EA 3O81A 2ZP0T 3L1OL 1JGVL 5KSVA 4R7NA 5K59E 1F4WL 3BRGC 4ZTPH 3NCFB 1SEQL 2R0ZL 4KI5D 1S9XA 3S35L 3UYRL 2R4RH 1GJIA 2EXWC 3HE6D 1ZSDA 3BZFA 4P3DB 3F7QA 4Y5XA 2PYFA 3HZVA 5IB5B 2VO5A 2EYRB 1BF2A 1KCLA 4L8SC 1RHFA 4EXKA 2NY3C 3H42L 4OIAA 5DMJB 25C8H 4S1RL 3DSFH 3L3OA 5GGUA 4IOFD 4KJQC 1R3JB 3ZHDA 3EO1B 3HZMB 4PJXA 4K9EC 1CLZH 3QXDA 3EHBC 2C3HA 1NC4D 4PJGF 2A83B 1UCTA 3FQXB 4MJ2A 4KMTL 4AMKH 5AZEL 5LCVH 2IMMA 4JE4B 4O2FB 3EYOA 3QDME 1LO3L 1Y6NR 1CDIA 1MNUL 4J4PC 3D39D 4U0RB 5BMFH 1U93A 3AB0C 4BFBD 5F3HB 5GGRY 1AP2B 1CDBA 3UTSE 3U0WL 1LVEA 2PYEA 1AJ7H 4MCZA 3OPZH 4OLYH 5E7FA 4WDIB 5T1LB 1YNKH 3VXRE 1DP0A 2RR3A 5CIPB 5DFWH 3OAZH 3HLAA 2ITCB 3CX2A 5I16A 1T7WA 1I8IA 5IMOA 4OD1H 1YNLL 4ZUUA 1DEEA 4UUJB 1KPUB 1T7ZA 1M6OA 3OTTA 4GOSA 3TGXA 5K9OA 4F58L 2XG4A 1BZ7B 5IB2A 4AEFA 4XBEL 1NLBH 1QFWI 1MQKH 4S1DD 5D6DA 3EYSL 4WHDA 1JI2A 5CJ8A 2HWZH 1JHKL 5B38A 4B7LA 2FECL 5JIHA 2AXGB 1W72H 4GRWE 5IQ7H 1ZMYA 3THML 5JHLH 2R9HD 4ONHA 3I6GA 3DJ9A 4HJJH 3RY6A 5TQ2L 5IVXE 3KHOA 3BRDA 3LKNA 3SCMA 1HHHA 1GXEA 5L9DL 3DTXA 4DOHE 1EIBA 1Q9KB 4NGHL 4ELKA 3T0EA 4XXCC 4YFLI 4U1IA 1AKJD 3C5JB 4TNVF 2BOCB 4NKDA 4MDJB 4LVOB 3C2AH 1NGZA 2MKWA 1HH6A 2AJZA 4HH9B 3QG7L 2A0LD 3P9LB 1KGCD 1IM9B 1J8KA 1RZKH 3T2QA 1KBGL 2GK2A 1NCNA 5JLZA 4FFZH 1MCLA 3MRNB 4Y4FA 3WUWA 2VISB 2DMCA 3FQNB 4QNPF 5INCA 4NT6A 4AENB 4LLDB 5GGTA 1A2YA 3EUUA 5DFTA 2OR8A 2EXYC 3P4LA 3KPRD 4OUUB 2WAHA 4RAVA 3MRPA 4F9LA 5JDJA 5GRVL 3LDBB 5E2VH 3VXQB 1ZT1A 3FQUB 4HX1B 2B2XL 5SWSE 2BVTA 4JKKA 5TDNA 4MD5B 5ADOL 5KS9F 3L3IA 4K8RH 2R4SL 3DGCR 1VB9A 3IGAB 5KSUA 1DSFL 1R5VB 2VLRB 4JFHE 1QYGH 1GOFA 1P7KA 4NYLB 5CJXC 4YGAB 4CU7A 2QKIA 2CKBB 4HCRH 1CTOA 2R1XA 1IAIM 4N0CD 1LMKA 2F53E 4HAGA 3RUGB 1DDHA 1XIWB 1UWXH 5DHYB 4TUJA 3O2DH 4M7ZC 4UU9A 5HI4D 3TIDA 3KPTA 4ONOA 1HHKB 3OB0H 4LF3A 2BHZA 1U91A 1GGTA 1ACZA 4XRCB 1QLRA 3IETA 5EA0H 4UT9L 1CL7H 1NGXA 4OFIA 1A47A 5C0AB 5GS2D 1F5WA 1I7UA 4JFXA 5T3XL 5I1AA 2X40A 5F1IB 2VLLA 3HMWH 4D9QD 4QXTA 1UZ8A 3PNWB 4X80L 2VZTA 5IFJA 2QQNL 4E41E 1LK2A 1CD8A 4BQ8A 1K4DA 4JFZH 1CLOH 4P9HC 2OS7A 2MCG1 1KJ2B 3I9GH 2A1WH 3SDAC 4KK5D 3U46B 4KDTC 1HOCB 3NA9H 4I13B 1D5XB 3D25B 4FZEH 3FQWB 2YA0A 4AG4H 3PIQA 4L8CA 2BVYA 4HIXL 2BVQA 4KJPC 2G2RB 1D9KA 4X6BA 5MP6L 3V79C 4OV5B 2CKBL 5DT1H 3EYFB 3QUZA 1V5JA 1ONQB 3BQUD 4M43L 3L3HB 4OQ1A 1L0QA 3KLAA 1J1OH 1L7TL 7FABH 4DZ8A 4HF5L 4BH8B 3TA3D 1FNLA 4HHAB 3PJSA 5F7MC 1QVOB 4LLUB 2FBOJ 3VXOB 2XIDA 3BPCA 1B9ZA 4XAWL 4Z77A 4OIIH 1X4ZA 2RCSH 3DRTB 2WWMD 2PCPB 4F7PA 1AY1H 5T1KA 1N7ML 3DRQB 2DQGH 2EXWD 3QZWB 4HUXA 4KI5E 1X5KA 1A1MA 1S3KL 4UDUA 5DQ9B 4LNRB 5E6IC 3C8KB 1UCBH 4NQVB 3WXWL 2F74A 2AXFA 1A4JA 1KJ2L 3B9KC 2JB5L 2NY3D 4S1QL 4MQTB 5HI3D 4UAOB 1OM3H 1G7JA 3K2UL 2BVOB 1WZ1L 3RBGA 1HHGB 4KJQD 2K3TA 3RNKA 1L6XA 2QEJA 3EHBD 4JHAH 2R2EB 1G9NC 2Y72A 1YMHA 2YRPA 4NN5C 1K2DA 2Z31C 1U8JB 3DROA 3H8NA 2HJFB 2QL1A 2VLJE 5ISZB 3L7FB 3B83A 1RQ5A 4IJ3B 4ZUWB 3O3DB 2Z93A 1MCOL 5EG6C 3VG0L 4L5FL 5JW4M 3UDWA 3ARYA 3OJDA 1CXEA 3RAJH 3SJVB 2IH1B 3ECBA 2BX5A 1FYHB 3RWJA 3PP4H 3M07A 1EMTH 1FO0H 3VU2A 4DZBB 1A14H 3BEVA 4KAQH 4XNXL 3VGDA 3EOBA 1Q9LB 3D39E 4UQ2B 4IS6A 4G8EA 5F88B 3U4BL 1R5IA 5BS0B 5EIIB 1U3ZA 1LWRA 5GGVY 5BVJA 1OY3B 2IAMA 4JKPH 3S96B 2IQAA 5DUBB 2OZ4L 3K8MA 3H7BB 4WV1A 3RGHA 1AE6L 2FDBP 3PQYD 3REVB 4W4NA 1AXSB 4HH8A 5HGAA 4G42B 5EC2B 5F9DC 1A7RL 1BFOA 1ZV5A 2X4SA 5I8KH 4JCLA 3V0VB 1CF8H 3Q6FB 1DQDH 1AD9B 1X3DA 1AGBB 4F3FA 3MLXL 4Y5VA 2F5BL 4TPRL 3V8OA 4RFNC 2AQ3A 5AWNH 1F4YL 3TM6A 4FQXB 4OLZL 4N68A 5E00B 5ICXA 3WIHH 1N6QH 3GNMH 2GFBB 4KXZI 4LRIA 1J0HA 1XGPA 3AGVA 4MAUL 3KLDA 2P5EA 4PJBB 1GGBH 1HSAB 1ZTXH 3O9WA 4ZUTA 4CW1A 1FG9C 5AD0B 4M7LL 4YHPB 2IFFH 1VFUA 1S7RA 4R96B 3VH8G 2R0WH 1NC2A 1UH3A 3WIIH 4NOBA 3FT3A 1UJ3C 1C5BL 4PGBB 1JRHH 3P30H 3SKOB 4OLVL 3U7WH 1KGCE 1KT2A 1RZIA 5HVHC 5L2KD 4A2MA 1SEBA 1ZK9A 4U1MB 2VQTA 2EXYD 3MA7A 1D3CA 1YEKL 1UXSB 5I1JL 3WS3A 2FO4A 1N5YL 4LCUA 3SPVB 3L9RB 4R4BA 4JFEA 1UWGH 4TUKL 5DUMH 3KPRE 2P5ED 4NO2B 2YSSA 5BV7H 3BWAA 3QFJA 3AXLB 3CD4A 5CEZD 1CLYL 4WI2A 4ZG1A 4EBQH 5JW3L 4AEEA 2CLVA 4PJ9A 3WFCL 1BBJA 3LIZL 5C0JB 3CUPB 5E5RB 3FN9A 3IS0X 2C3VB 2K9UA 4H88L 3C60B 5I0ZA 2XTJD 4ODBD 4ONFH 4NKIH 3GMNA 5FO9A 3FTGB 1A3LH 5KSVB 2E9BA 4DGYL 5HY9A 4CN4A 3NCYS 3QFJD 4JY4A 3QNZA 4UIMB 4X7DC 5IGXL 2DRUA 4X99A 4YFDB 4U0RC 5D1XA 3QCUL 1T5XB 1LEIA 4TRPH 4M5YL 5HGHB 3BZFB 3ULUF 4JM2A 2A6JA 1NBZA 4HW6A 1FVDA 4N1HB 4QOKD 3SGKC 5A3IC 1SYSB 2NY1B 1AXTL 4ZYKB 5IBTH 2FHFA 3UEZA 1KJ3H 1FPTL 1T83A 5GGUB 5J56B 3MOBL 2IANE 1XT5A 5DSCA 4PJXB 4QRRD 4AJ0A 2YUXA 4OGYL 3QXDB 1P4BL 4LEOB 4QYOA 3UROR 1NAMH 2NTFB 4RISL 4EVNA 3VGAB 1U92A 3O3UN 5EU4A 4P48A 3EYOB 3GMLB 2MQ3A 4U7KA 2CIIA 1TTFA 5C08D 5IB4B 2NX5A 4U05A 2DLGA 2VITA 5GSVB 3ULVH 4GAGH 2C1OA 4A6YL 3WFEL 1U58A 4ZXBD 2Q1EA 2X1OA 3F8UB 1UENA 3OKNA 5LXGH 4JO3H 3GGWB 1QSEA 4TOYL 4OI7A 1L9NA 2PYEB 4MCZB 1XZ0B 1MLBA 4G8GE 4HKXB 5LJYH 1U42A 1T1ZB 3HLAB 4JRXD 1C7SA 1ODAA 2J8OA 3P9MA 4Z7WE 5DJXA 1I8IB 1ZT4B 1D5MA 4OTXH 4LVOC 5I1EL 4PJFA 4ZUUB 4OT1H 4P9MH 5KTEL 3DX6B 3RWCA 4EOWL 2PF6A 3FT4A 1RJLA 4JRYB 4YXHH 4NUGL 5IB2B 3MGAA 1ZEAH 4HFWB 5EU6A 1F02I 3D48R 3TT1H 2GQHA 2ICEB 3SBWA 4X4YA 2CGRL 4ZMAT 1NBVL 1YEJL 2Z31D 4QRTA 1IZJA 5B38B 4WGWB 3LDBC 2DTML 5FGSA 1F42A 5FYLL 5C6TH 4OF7A 1NEUA 1ACYL 4TQEL 43C9A 3I6GB 4I77L 3MRDB 4PRIA 1KPVA 3FFDA 4GAJL 5I9QB 3MO1A 4RZCB 5C2BL 1HHHB 5D2NA 2EZ0D 4P46A 4ALAL 1MFCL 3M1BA 3MREB 2WQ8A 4OQTA 4ELKB 4GLRI 2VDOL 1XIWC 1N0XL 4XVSH 3ZKXB 5DK2A 3HAEG 5LBSH 1F90L 1KCRH 5EDXA 2KBGA 5E5UB 4O2CA 3ZT5A 3OR7B 2PXYA 4GW1A 4Y4FB 3WUWB 5INCB 3SOBH 1DFBH 4ZFOL 4NM4H 4NRXA 4QT5B 3BUYB 4PJHA 1A2YB 2KQNA 2P43B 2HTLC 1EAPB 3RIAK 2AJVH 2XNAB 2Q8AL 2JJVA 1G7IA 5EORL 3FO2A 4JQIL 4FQ2L 3S3PA 2HP4A 3PQYE 1RZJL 2HKHH 3CVHA 3EO9H 3L3IB 5HVWA 4NNXA 4KY1H 4XP6H 1GSMA 3VFVB 2FD6L 4FHBD 3KR3H 3CDFA 2V6HA 2X4NA 1CGTA 4O02H 2QKIB 4CADA 2G9HA 2R1XB 5HHOB 2PR4L 3L7EB 1DBBH 4TUJB 2J3SA 2HJLB 2JJTA 3MRRB 1OP9A 4L3ED 5EZIH 4UU9B 4KKBC 3I6LD 3VWKA 3TIDB 1MAJA 3EJYC 4RNRA 4LF3B 4CAGA 3MFFA 2FBJH 1K3ZA 3OMZA 2F8VA 1U91B 3KYOA 3NN8B 1J1XL 1NGXB 3BX7C 5SX5K 3WLWC 5CKGA 3BZ4A 2VLLB 1TENA 4N8CH 1AGCB 4QXTB 5DRWB 1A21A 4BELD 4NHUA 2IALA 1RPQA 4C4KT 5D71L 3MV8E 3BPOB 1DQLL 2I5YL 1JVKA 4JGJA 4ODTL 3DVNA 1MSPA 5L2KE 1NBQA 2VAAA 4HXBH 1MCDA 1FZJA 4L8CB 4UAOC 3JXAA 3G5XB 1J8HA 1EUTA 4KUCD 2BVQB 3IAQA 4PJ7F 1CXFA 5CEZE 4X6BB 2FR4B 3LQAH 1ZGLA 3QUZB 2BERA 5C7XL 1Z9MA 2EO1A 2H1PH 2FEDD 3CX5K 1NEZG 1JPSL 4Z7UA 4LCIL 2HG5B 1IVLA 1WLHA 1IM3A 3GHEH 5KSBE 1UKQA 4IJ3C 4KV5F 3PJSB 3OKOA 4OKDA 4TUOB 5HJ3A 1A7PH 3EOYG 3JWDL 3BPCB 2XTJE 1K6QL 3NFNB 4Z77B 1XCQB 1YMME 5HPMA 3FO0L 5B3JF 5AUMA 5IFHH 4QF1B 2Z91B 4RSVA 1X7QB 3OG4B 1OPGH 3WJLA 4HUXB 2JELH 3BO8A 3WHE1 3D3VB 3LMJH 4UDUB 1ITCA 4D0BA 4NO0A 1PEZA 3VFGL 1LDPL 4MNGE 1IKNA 1JN6A 4GW5A 2F74B 2AXFB 1A4JB 1VACA 4M93B 4NPYA 4DUVA 5FOBB 1R5WA 2P8PA 1JF1A 1G7JB 4ZD3L 4OCYH 4QWWC 3TJEL 5D2LE 4QOKE 4PJIF 2HRLA 3JTTA 2HLAA 4PJGA 2GT9A 3DVFA 4YK4B 1K2DB 2CH8A 4O51A 3OAZK 2FGWH 4QRRE 1P84J 2VLKB 5E1AA 5GGQL 4YZFF 5KW9H 1OAQL 4FQHA 3RDTA 3ZE0E 2ZSWA 5IWLC 4HCRA 1JNHA 4NNYA 3OJDB 1G7QA 3FOMA 1G7MA 5C08E 2APBA 1DZBA 2ENYA 3RWJB 3FN0L 2VNCA 2E27H 3G04B 1E4WH 1MFBL 4FQXC 5TDOA 1MCQA 4IMKC 4IS6B 1XMWA 1IAII 4MJID 1R5IB 3VXUA 4OFYD 1TDQA 2Q76B 1EHXA 1RUKL 2VRAA 2B0SL 1HCVA 2GJ6B 4MA8H 4H1LG 4DVBA 2WUBH 2CR3A 3B5GA 3RDTD 5BVJB 5I1DA 2IAMB 4OZHB 5EUOF 3I2CL 1BM3H 4JRXE 2MCPH 2VH5L 3HHRB 3MLUH 4JPKH 4WV1B 4HDIA 5HYJD 2BJML 1P69B 1T7YA 3MRFB 1S5IL 1BFOB 4G9FB 3QXAA 1GIGH 4TTGA 4NZJA 2RBLA 1F58L 3MLWL 1JFQH 1R3LA 4R6UA 4M03A 1ZWIA 3HB3C 3QPXH 3JV5A 3TWCH 2YOCA 2DLFH 2B8OT 1UYWH 3U9PH 4HUUB 4OGXL 4NHCL 4NQDA 5AZ2H 4N9GA 3HNVH 2G5RA 3KWWA 3V5DA 5ICXB 5IEHA 4L4VD 1S9YB 4H25A 3OZ9L 4GG6E 3HZYA 2R69H 1YDPB 3BKCL 4YFLF 3EAKA 1PYWB 1XIWD 4PREA 5IMKA 1SBBA 3O0RH 3EJZD 1EFXA 2NW2A 3C60C 1S7RB 4M6OH 5EIVA 3IDJA 3EDJA 2W07A 1NC2B 5HHVL 3VMOA 3O6MH 3FT3B 2NY4D 5DD1L 4JVPA 4KJWC 4R0LB 3BH9A 1RZIB 4FP8L 4WY7H 2XY2A 4BZYA 4OZIF 3WKMH 1J0KA 4WW2B 3MA7B 1BLNB 3SE8H 4M5ZH 5F7WC 3O3EB 1A6AA 2BNQA 3WS3B 1I1AA 2HTKC 4Q58C 4LCUB 4XPTL 4R4BB 5EBMA 4JFEB 5KS9A 5CINH 4DN4L 2BSSA 3AY4A 2NY1C 5C07A 2IPUK 4XVJH 1T0NA 1CZ8H 4WHCA 5I8OH 3MLSL 3B9VA 2WUCH 4JPWH 4UINL 3N9GH 3QEQD 5ACZA 2VC2L 1AHWB 4XXDA 5FYKH 4Q9RH 2D7OA 1BBJB 4G7YL 1DR9A 3MUGA 3VGAC 4KKBD 4PJAF 3UO1H 1P6FA 3V5HA 3EJYD 1ADQA 5FO9B 1RURH 3GK8H 1ETZB 3EGSA 4XVUD 1FL3A 4L3EE 3I6LE 4I0CC 1IKFL 1HYRC 4AZ8A 4DK3A 5HY9B 2NYYC 3QNZB 2X89A 4WO4A 3WLWD 4UBDC 4FQJH 4ODWA 3TV3L 4HUVA 5D1XB 3MRMA 4YDIL 3QCVH 1S7QA 2XZZA 2A6JB 5F8QC 4KHTL 1CE6B 1NBZB 1V8HA 3OAUH 1FVDB 1MCIA 1FLTX 5J3HC 2H2SC 1FE8H 1VFMA 3QB7C 4OF5A 2CJUL 2IADB 1KG0B 4FXGA 2P24B 3A6BL 2D7PA 4D9LH 2IJ0C 2OK0H 2GTWA 3PGDB 3ZTNH 3GSNA 1RFDL 3IDNA 2XRAH 1QSFB 1P2CA 1QFUH 2VXSH 1BWWA 4YHKL 1U92B 1YA5A 4JKMA 5EU4B 1H15B 4LPTA 1WFOA 1NLDH 1RZJC 5LGHH 1NBYA 2OMBA 2NX5B 2VITB 3LV3A 3BRFA 4HMEA 4JY5H 1KF9B 3G6DL 1U58B 2IQ9H 3OKLB 3ILQC 1XGQA 4ZSOB 3VRLE 3H9SB 3OKNB 5SWZA 1QSEB 1IGJA 5KZCB 1YYML 3LH2L 5F1SA 4F37F 1NFKA 2NCMA 2XY1A 5I9QC 2CRIA 2VUYA 4MNQA 4M48L 2A9ML 1E4KC 1MLBB 2XOTA 3O6FA 1HNGA 4WU7B 2AK4A 4CMHB 1MCKA 1IT9L 5GIRA 3P9MB 5DJXB 5FEBA 1QRKA 4PJFB 1TMCB 4R7DA 3BESR 3DX8B 2YBRB 4FTVA 4GS7B 1AD0A 4DW2L 3QH3A 4WU5B 1R3KA 2A74B 2BC4A 3P2TA 3FT4B 3NFSL 3UTZA 3BKJH 3KPOA 3M8OL 4LKXA 4LMQE 4QWWD 4XB8A 1UKTA 4Y4FC 3PXJA 3BW9A 2UZIH 1HHIA 1GC1H 4X4YB 5ECJE 1A6WH 4HGMA 3QEGL 5JO5B 1TJGL 3SE3A 4NC1C 1B0WA 2AK4D 4MQ7B 1OTTC 4MXWH 4NJ9H 3HRZA 4X4ME 3BDYL 4EKXA 3MNZB 43C9B 4PRIB 1KPVB 2ARJQ 3A67H 3AMLA 1F3DJ 2XICA 3SDXF 4K3HA 2O93L 3BGAA 5D2NB 4P46B 4PLKD 3RQ3A 3F6LA 3O4OC 3JWNC 4IRZH 4XP5L 3M1BB 4D94A 4MB3A 3QWOB 4MVBD 4FQXD 5E70A 4LQFL 3CXDL 1L0YA 1CU4L 1NJ9A 1VGKA 4LSVL 2ATPA 3S5LA 1A9BA 2X1XR 4O2CB 1GH7A 4YXKH 4XP9L 2XACC 3JWDC 3F58L 3BAEH 4GW1B 4MJIE 5AAWA 1YECL 1MUJA 1F13A 4EQ3A 1Q94A 4PJHB 3O6LL 1CFBA 4X5XA 1GZQA 1BF8A 2C1PA 2X4QA 4XVTL 1HKFA 3V5KB 3FO2B 1FBIL 4FFVC 5T3XE 5HYJE 3MV11 4W6WB 5D70H 5D7KE 3BPOC 1CFTB 3F65A 4NNXB 4ZOEA 4N0UE 1QA9A 4EIGB 2E6JA 4Q9CA 2FX7H 3T1FB 4GO6B 4JQXA 2XQBH 5L8JB 3FJTA 4K23H 4JANB 5DS8A 4D0DB 4JM4H 1ZHNA 3UJTL 1VEPA 2EC9U 1LEGB 3BXNA 1ZVSB 3PGCA 3QUZC 3AM8A 4JG1L 5E8OA 4RNRB 3CFDA 3MFFB 2DM7A 2N7AA 5MI0B 1Q0XH 4L4VE 4ZTPL 1BQLH 2FL5A 2VSCA 4OLWH 5F7NC 5TFSH 2XXCB 2R4RL 4CUCA 3BZ4B 2WM0A 2ZSVA 3TJHC 1NANI 3NTCH 2W9EH 2X9WA 4KJWD 4NHUB 5C0BA 2IALB 4XHJD 1VFOA 3ARWA 2X4TB 3DUUB 5EU5A 25C8L 3DVNB 5T1MA 5KVDH 3DSFL 4LOUC 3DV4B 4PJ8B 2VAAB 3GZKA 3MRHB 4NNPH 5JORA 1CLZL 2NW3A 4WEBH 3AAZA 4M93C 2NY1D 4G6AC 1FZJB 3HNTH 5DXWA 4UB0H 1J8HB 2HLFD 5IIEA 4PLJC 1W72B 1G6RA 1HHJB 4AMKL 5LCVL 1JZ7A 4NM8H 3O3AA 5IROC 3TYFB 3VW3H 1RU9L 4Z7UB 3GSUA 3TPUA 3C5SB 3MZTA 4P4KA 3QXTA 2KZ1B 3WN5B 5FYLD 5D9SB 1XF2A 3QEQE 3TVMA 3FB5B 3VDCA 5BMFL 3ALWA 4E5XB 2PO6D 2N4IA 2NYYD 3GKWH 4XMLH 5HPMB 3UZEA 4CRPA 1AJ7L 2CDFB 4UBDD 1G1YA 3OPZL 4OLYL 3CK0H 3KS0H 3MNVB 1YNKL 5ACMA 4F7TB 3OBAA 3QA3A 3RWIA 3BWUC 1HSBB 2XYCA 4HD9A 4D0BB 5CP3A 1QFHA 4OD1L 1JN6B 2HRPH 2OTWB 3IKCA 4GMTH 5J1AA 4KRLB 5L8KB 4WVRA 1R5WB 5E8NB 2IH3B 4PJEF 2P8PB 3GMMA 4PD4J 1HILA 2QQQA 1NLBL 2IAMC 3MBEA 5I1CH 1MQKL 3PHOB 5GISH 2HLAB 4PJGB 2W9LA 4WV1C 2GT9B 1I7TB 3DURA 4LHUB 3ZL4H 2HWZL 3X3FH 4LGSB 4O51B 4JRYD 1BJ1J 3FONB 5IQ7L 1W72L 4JZOA 1JF5A 5JHLL 2HMIC 4JREB 2V9QA 4DCQA 2X1QA 2NY0B 2ZSWB 1HXMA 3MYJA 1OSPH 4EUPG 4HJJL 1JNHB 4KXZH 3RNQA 2DYPA 1YEGH 3HPLA 3HI1B 3ILQD 4XHQA 1FNHA 1G7MB 1F2QA 4I2XA 4YWGL 1GGUA 2YZ8A 3QEUB 3VI4F 1T5WA 3MBED 3VGBA 1D5IH 3V2AR 3C2AL 3KJ6H 1Z0NA 1AC6A 3NIDF 5TQ0H 4LRIC 3RZCA 3VXUB 1RJCA 4X98A 1JMXA 4U1KB 4FQQB 4PGDA 1Q72H 4H8WH 3DXAB 3SO5A 1EDQA 1RZKL 4DVBB 5JPMB 4FFZL 3VGGA 5BJTA 1KIPB 2MOVA 3QYCA 2WANA 1OSZB 1FVEB 2P8MB 2DYPD 3I3DA 4P5KA 4HK3J 5E95B 3R1GH 5T33H 5KVEH 3U2SA 4BQBA 1W0YT 5E2VL 5IW6A 5BS0E 4R0LC 5IVNA 4XNZB 2FSEB 3QXAB 4LP5A 2FH8A 4WW2C 4K8RL 1ZWIB 4CVXB 2EIEA 1OTTD 4U6TA 1QYGL 3S4SA 1FNGA 4NQDB 4ZAKD 3VXPA 3AC0A 4HCRL 5IJVB 4N9GB 1DBAH 3KWWB 1B0RA 1Q9OA 3O2DL 3BP7B 1MRFL 4H25B 1RK0A 3HZYB 5CUSH 1AHWC 3HUJF 3RZWA 4LLAA 4PREB 4R3SA 4PLNC 4EI5B 3D2UA 1EFXB 3R06A 3WL9A 5HHQA 5EA0L 4CU6A 3BP4A 3MUY1 1CL7L 4XPFH 1I8MA 1B6DA 3IDJB 4G5ZH 1BAFH 4OD3H 4QXGH 4X4ZA 3HMWL 3G6JA 5FCSH 3QI9C 2XTLA 3HC0B 7CGTA 1HH9A 2KUTA 3BH9B 5KN5A 4P3CH 4PJBE 4Y1AA 4K2UH 4F7MA 4JFZL 1CLOL 1K8DA 4M61B 3I9GL 4X6FA 2A1WL 2BNQB 1H3XA 1U8NA 1Y6MR 1RUPH 3NA9L 1FHGA 5EBMB 2JK5B 4FFVD 1FN4A 4HK0A 5HHMB 3RGVA 2P46B 5KS9B 5FF6B 3OAYH 4FZEL 3HNSH 2BSSB 4AG4L 3V4PH 2J8HA 4ISVA 3VFWA 4ZUSA 1WK0A 1T0NB 4YBLB 1OGTA 1T1WA 4WI3A 4H5SA 5DT1L 4XXDB 2R1YA 3PP3H 2EDLA 2EE3A 2OP4L 5FYJH 5E24E 1J1OL 3MUGB 3BKML 1EGJH 7FABL 5F70A 4G6KH 5GS0D 4JFDA 3OB8A 5IMLB 3TYGL 3UTQA 1M05A 4MDIA 4NZUH 4F57H 4JFPA 4JN1L 1S7WA 3EGSB 1CGUA 2ZG3A 1HINH 5K9JH 4XX1G 5DRXA 1FO0B 4OIIL 3GMPA 5BZDA 4HGWA 2RCSL 2NZ9C 3DETD 2J12B 4WO4B 3T3PF 1X6LA 2D0GA 4LVNB 1AY1L 4HUVB 2DQGL 2WK2A 3SGDI 3TJHD 5D1ZD 2X6MA 4XB7A 3MRMB 3WFDH 1N5AB 1X9QA 4NOFA 1CD1B 4APQA 1UCBL 2LU4A 1XGUA 4CMHC 1FFOA 1KPRB 1E6JL 3LKPA 3D3VD 1T0MA 5DC4B 4PRAB 1OM3L 4FXGB 3BP5A 3NIGE 4ZOCA 1ROWA 4U7SA 3UJJH 3I75A 1VGEH 1T1XA 1YEIH 3IDNB 1RY7B 3ILPB 4JHAL 1P2CB 1XR9A 5JNYA 4NFCA 4TSBH 4PJ7A 5EBLB 1PAMA 1P1ZA 2Z0BA 5JW4R 5K9QG 5EO9A 4OZFA 1Z9OA 2ITDA 1AC0A 4GRMB 3WHE0 3RAJL 4RMUA 1BPVA 1UACH 1I3RB 3QCTH 1IGJB 3EBAA 1E4JA 3PP4L 3W0WB 5L6YH 1EMTL 5FYLE 1FO0L 2J88H 1A14L 1UH4A 5D2NC 3X12A 4KAQL 4P46C 3LQZA 4YBQC 1OD7A 4QGYA 3PWLA 3IS1X 4N0YH 1SJHA 2W0FA 2AEPH 5GIRB 2XFXB 3DI2B 2AEWA 4I48A 4ODUA 1JNLH 5GGSY 4R7DB 4JKPL 2VXUH 4X4XA 1A7NH 2G60H 3KXFA 5GRYA 1AD0B 4HIJA 3CH1A 3VRIB 4ZUVA 2BC4B 2GJ6D 2R0KH 2HH0H 3UTZB 3KPOB 5DF0A 5KG9A 4PJIA 4U6XA 3FAXA 3DO7B 4LFHD 3X13B 2DI8A 5BV7B 4RMVA 5I8KL 2GY7B 1YN6B 15C8H 2Z8VC 4KH2A 4KK8D 5ICZA 1CF8L 1DQDL 2GI7A 3BVNB 3HRZB 4JRYE 1OAXH 2W59A 5MERB 1XR8A 1E0OB 3KLSA 4F33A 5AWNL 2JCCB 2A73A 5FK9B 1ND0B 3VCLB 4FQCH 1DTUA 2LE9A 4PYGA 4LCWA 4NJAH 4CNIA 5IHZB 1N6QL 3BD4A 3WIHL 5FM5O 3GNML 4M7JH 4X7FC 1FORH 1GGBL 1ZTXL 4P3WA 5I17A 1NJ9B 2Q6WB 2IFFL 3SQOH 1UXWA 5IG7B 3S5LB 1A9BB 2R0WL 1A0QH 2XA8H 3WIIL 3RIFK 2R23B 1KENH 1W0WB 3BDBA 5DC9B 5EO1B 3HG1A 5EUOA 3T2NH 1JRHL 3OR6A 4LLMA 3P30L 1MUJB 1TQCB 3U7WL 1H8NA 1MREH 2XN9D 3CU7A 4X5XB 3NZHH 3TN0D 2WBKA 1QRNA 2OSLA 5IW1A 3LPGA 4JDVA 1A22B 3IF1A 2PW1A 1UWGL 5DUML 1PLGH 1D7FA 5IUSA 3ZMRA 5T1DH 3REWB 4MA7H 5B4MC 2PTVA 2H2PC 4JQVA 3H3PH 1W8OA 4PJ8C 1NAMB 3NZ8A 2V5SA 4EBQL 1MHCA 3ZKSD 3NCMA 1TJHH 4MCYA 3QQ9D 4NC1E 5DS8B 4M9PA 5A2JH 3NIFF 3HA0A 4PTTA 5DMIH 2DI9A 1U9KA 4P2CG 3SGEI 3OKEA 1KULA 1QRND 4NKIL 4U1JA 4IRJA 5C09A 1A3LL 4Y5YA 3VXTB 3WN5C 4JAMB 3LEYH 4XNMA 1WCBA 3UMTA 5HHOE 5HBBA 1T66C 3RFZC 5C0FA 5HTSA 4PJ5B 3QI9D 4TRPL 1A7QH 3GUTA 3AS2A 1S7XA 4C54A 1H0DA 2JF1A 4OZIA 5IMMB 3DX9B 1OHQA 3QWRD 1QD0A 2Q7NA 3T3ME 2B1AH 2DS4A 2XPGB 4NN6B 5IBTL 5T1MB 2YUZA 1UM6H 1KJ3L 3QNYA 1RZKC 5I19H 2FJGA 5C09D 2NPLX 3AAZB 3L5HA 1N6UA 2B7DT 1C1EH 1YC7A 3RI5K 2W65A 3LD8B 3U82B 1NAML 4MNHA 4RA0C 4HWZA 1MVUB 4O5LH 3O3AB 1QSFD 3UTTB 1EX0A 4K8RC 4L8DA 3GSUB 3ULVL 4P4KB 4PJAA 4QHLB 2EEDA 3UPAA 1XF2B 4PP2B 1J1PH 4JREC 4YUEH 2NY0C 3TVMB 5LXGL 4JO3L 4M7LT 2H6PB 1KB5H 3WLBA 3EFFA 3V7AE 3H9SD 3PWPA 2EYTA 4CDGC 1MI5A 4K3GA 2H8PB 2DWEA 5IJKA 3QA3B 3KYNA 3OGCA 3RWIB 2P48B 4OTXL 2I9TA 1DQQA 4JKLA 4OT1L 4P9ML 3IKCB 5J1AB 3BT2H 2DQEH 3F7PC 5DMGD 1NQBA 4EIZC 3ESVF 2DQCH 1HILB 4YXHL 4XCNA 1ZEAL 2YPLA 1I1RA 4I9WD 3K4DA 4HS3A 3TCXA 3TT1L 4Z7NF 3D3VE 3DURB 2XKNA 4Q0XH 5DDHA 1QLFB 2DIBA 2EH8H 4J3VA 3RA7L 4JZOB 5C6TL 2EDBA 4XNZC 1A6ZA 2QSVA 4EJ1C 4NZRH 1F97A 1HXMB 1ORSA 5FA4B 1ZLUH 5EOQH 2D3VA 3HPLB 1ZLVH 3HS0A 5JW5B 2Y07H 2VLKE 1EBAA 3SDDA 3GSQA 3UPCA 4XVSL 5DJ8B 5EU3A 4YBQD 4L1HA 5K9QI 5LBSL 1KCRL 3CH8A 3DOSA 4PGDB 3IDMA 4GKSA 4EI5C 1INDH 3PGFH 4NBZB 3WNOA 5BXFA 3L3GB 3N1GC 3GFUA 3SOBL 1DFBL 1OP5K 4NM4L 3QRFM 2HKFH 3MRJB 3QFDA 2X10A 2C7UA 2AJVL 3BYYA 4NSKA 1F4HA 4QRPA 3U7YH 1OWWA 2GJ6E 2HKHL 3STZA 1KCKA 3EO9L 3GSXB 3F12A 3MRKB 3RKPA 4KY1L 4OZHE 2OJEA 4XP6L 5C8JA 4MJ4A 3KR3L 1LO0H 1FFRA 4U3XA 4ZS6C 1IGTA 4O02L 3VXPB 4YHLH 5ABDE 4MS8C 5HDQH 3SDXA 2UWEA 4G9FE 3BN9C 4GRLA 1DBBL 4YBLC 1Q9OB 4ZOBA 3RX7A 5I8EA 1T6VN 1RK0B 1IC4H 4PBVC 2FBJL 4QRPD 2CMRH 4NKOB 3D2UB 3HCVB 4AY0A 5I6XB 3BJLA 1A6TA 5EZJA 3R06B 1DCLA 3WL9B 5HHQB 3BP4B 1KCSH 4Y2OA 5D7LA 1K4CA 4KK9D 4EI6A 4P5TB 1X6NA 3RRQA 1HH9B 3IFLH 1LO5A 4WO4C 4ETYA 4Y1AB 4LVNC 1DLHA 3Q3GA 4GRLD 4OFVA 1D5ZB 4JVWA 4XTRC 4U1HA 1ZHLB 3JTSA 2CXGA 3FOLB 4ZFFA 3QIWB 2XN9E 3TNMB 1FN4B 3RGVB 1LP9E 3GJFH 4L9LA 3C6LB 4HXBL 4WUKH 4BSVA 2PTTA 5B4MD 2NNAA 3VFWB 4ISVB 2H2PD 3EZ8A 4ZUSB 5D7LD 1N6VA 4PJ8D 1OGTB 3IJHA 3LY6A 5IQ9A 4NFDA 3BUTA 4JEGB 2V2XB 3LQAL 2X9YA 2H1PL 1U8OA 1QFOA 1II4E 1U3JA 4YPJA 3QUYB 3WHXA 5DRZA 3GHEL 2D7TH 1Z6JT 2BFVH 4MDIB 4JFPB 3FB6A 5J12B 2GSIB 2XWJA 4Y19B 1A7PL 1S7WB 1U8MB 1CBVH 5DRXB 2Y5EA 1QR4A 1T66D 3GIVB 5IFHL 3S9DB 4LPVA 5BRZA 2NXYB 1OPGL 3RX8A 2JELL 3U6RA 3LMJL 3VXMA 2VZ1A 1WEJH 2EDFA 3FRUA 1WITA 4APQB 1XGUB 4JB9H 3MNWA 1NDGA 5CJQH 3D9AH 1NFIB 5CBEA 1FFOB 3HE7B 4HLZG 4OCYL 4CVZA 2AERT 3I75B 2D7QA 5IVXF 4LBEA 1T1XB 3TO4A 1XR9B 5JNYB 1D6VH 1HIMH 1QHOA 4PJ7B 5ESQB 5HYFA 4BUGA 2FGWL 5EZLB 3MGTA 1TXKA 4R8WH 5KW9L 2VXTH 5EO9B 4DKAA 1ES0A 4HG4J 4PRHB 4LHUD 3VXMD 3FQRA 5J1TC 2DQJH 3N1QC 2ZKHH 2ITDB 4MB4A 1QSFE 2JIXA 1F8TH 1P7QB 2NY0D 1U8HA 1E28A 1J05A 3S36H 4Y8AA 2E27L 1E4WL 3MR9A 3WV0A 4GQPH 4RDQG 3R8QA 5KVMC 3GI8H 4ODXA 3X12B 3AU1A 4PP1C 3OHXA 3LQZB 2EYSA 2OBGA 3WFBH 3PWLB 1SJHB 2W0FB 4HKZA 4KDWA 4ZSOE 4Z78A 2EDXA 3H9SE 4WI7A 4I48B 4MA8L 2WUBL 4YEEA 4Z5RA 4X4XB 1S7UA 1BM3L 4G6MH 4UNUA 3SE4C 3KXFB 2W0KA 2MCPL 4HIJB 3CH1B 3MLUL 4PJEA 4JPKL 3TT3H 3DXAD 1J86A 1U3HA 2E7LA 1I9IH 5KG9B 4PJIB 3VGHA 4U6XB 1N4XH 1TQCC 2HYMA 4H1LH 3RVXC 5A1AA 2Q86A 2BNRA 1GIGL 4N0FB 1JFQL 4I9WE 3VFPA 3KLHC 3GJEA 4IHOA 3TIEA 5FUOH 4N5EC 5ICZB 3QPXL 3TWCL 4D2NA 2DLFL 1UYWL 5GJTH 3U9PL 5FV2A 4XBPA 1JPST 5AZ2L 4EDXA 5B3NA 4CU8A 3CC5A 5MHSD 3WIFA 4F33B 1YEHH 3W9DA 3HNVL 3ZTJG 2BVPA 2WWKO 5DHXB 2VR5A 4PY7B 2VKXA 5LKNA 4QTHA 3ARBA 1U3HD 2OM5A 1M7XA 4OZ4A 2R69L 3E2HB 1N3NB 3MV9D 4HIEA 3ULVC 3O0RL 2YD6A 2EDWA 5I1IH 4M6OL 3O6ML 4WWKA 2D2OA 1W8NA 3HG1B 4I18A 3OR6B 3ZKND 3CFJB 2V2WB 4WY7L 2WP3T 3WKML 5I8CA 3SE8L 3EDDA 3KGRA 2AVGA 2HT4C 3RPKA 3RU8H 2A6KA 3WNMA 3QUKB 2WW8A 4Y89A 4JHZA 2PW1B 1HXYA 5CINL 3GSOA 1A7OH 4NN6C 4UV7H 3T8XA 1FGNH 3VWJA 4XVJL 1YUHA 5HHMD 1CZ8L 3AREA 3QQ4A 3G5VB 5I8OL 4P2OA 2FECI 4ZS6D 3MGOA 1IGYA 2GK0A 2WUCL 4JPWL 4LNVA 4MCYB 3N9GL 2GAZA 5FYKL 4Q9RL 3BN9D 4YO0A 2J2ZA 1E4XI 4J3TA 3QQNA 4AL8H 3OKEB 3UO1L 5CKAA 1HQRB 3HUJA 4KI5F 2P45B 5CZXD 5CD3B 4DVRH 4W81A 2ADJA 3FAWA 1RURL 4IRJB 4WIQA 3GK8L 5DJCA 1SVCP 4P4KC 3OX8A 1MCPH 3ARZA 1EVTC 1H3PH 4JO2H 3TVMC 1A6UH 4FQJL 3ARED 4LMQI 3UPRB 1Z3GH 2X09A 3QCVL 4GKOA 4LSUH 3OKMA 3GUTB 1S7XB 2VABA 3FFCA 4OZIB 3RWEA 1YN7A 1IEBA 1XAUA 5GRJH 5M95B 2V17H 1N8ZB 2NMSA 1FE8L 4XTRD 5FO7A 5CBAA 3QNYB 2I60L 1U8QA 4I1NB 4KK6C 4M1CC 4D9LL 2OK0L 2EKSA 3ZTNL 1WISA 2QLVB 2E7BA 2XRAL 4XCFH 2VXSL 3QEHB 4MNHB 3I85A 3MJGX 3CLFH 5EOTA 5HYSA 4HWZB 1S9VA 1UM5H 3PL6B 3OKYA 4MJ5B 4PBXA 3RBSA 1NLDL 1IGIH 5LGHL 3QDJA 5E56A 4E0RA 3ZSTA 4L8DB 5IV2A 2R0LH 4JY5L 4HQQH 1J9CT 4PJAB 4B0MM 1K8IA 2IQ9L 3PG2A 1LE5A 5JMOC 5C9JA 1B0GA 4Z0XA 3BZEA 4K55A 3QRGH 1RUMH 2K7QA 4X6DE 1MI5B 3QT2A 4NKQB 2DWEB 3KYNB 3OGCB 1Z2KA 5ID0B 5B39A 2I9TB 1DQQB 2W1NA 3PV6A 2YZ1A 3LS5L 5DEGB 1I3VA 1Z9LA 3M45A 2QQKH 3BKJL 2YPLB 2F5AH 4HS3B 2D9CA 1XGTA 3TH3T 4NWTH 4HWNA 2UZIL 1GC1L 1N2RA 2ED8A 1A6WL 5DDHB 5JDSA 4DKEH 2Y7QB 1IAMA 2WMPA 1VENA 2VE6B 4MXWL 4NJ9L 3CSYA 1I7ZB 1ORSB 1Y0LA 4W4OC 1A5FH 3CCHA 4TULH 3A67L 3VA6A 3QPQD 1U6AH 4ZFGH 5KSAB 5C0EA 3IFOA 4OI9A 4FNLH 1S7VA 3LQAC 4IRZL 4ACPA 5J06A 4NC2B 3QIUC 3SDDB 1IAOB 1NCTA 3KPSB 4PP1D 1MCRA 3P4NA 3VFRB 4LKCA 4UTAH 4YHNB 3O41A 5IFAH 4YXKL 5I6XC 1LE9A 4G8IA 3BAEL 3DVGB 4XWOC 3HI6H 3K8LA 1F6LL 3HRPA 5GSRA 4N5UA 1H3UA 4X5WA 2CLZA 5JQ6H 5FM8A 3QFDB 2DQFA 2C7UB 2YRLA 3CLEH 4M3KB 4P5TC 5EOCH 5BQ7B 3MLPA 4EQ2A 3FB8A 4DFHA 4BH7B 3DXAE 4J3WA 3ZYJA 3STZB 3IDGB 1FAIH 5D70L 3F12B 2VDRH 2FX9H 1LILA 3KLHD 2C4FT 4MWFA 3RX5A 4U1GB 3MUHL 2VZVA 3MV7D 4N5ED 5T5NF </