4Z7VB

L3-12 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
187
structure length
172
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSLLVCSVTDFYPAQIKVRWFQEETTGVVSTPLIRNGDWTFQILVMLEMRGDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 172
sequence length 187
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7vB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7vB01
4PJEE 4DGYH 4I48A 1A6VL 5B4MD 2X1WL 4GT7A 4JHZA 1VGKB 3MSPA 3RWDB 3MRIA 4IRSC 1R5WB 5C07A 4XCCL 1YEEH 4PY8J 2W65A 5D7LE 3CFDB 1BWWA 2A1WL 4OZGE 5LWYH 2ED8A 1MCCA 1W72B 5LJYH 2XY1A 4YBHA 4JCMA 4OAWA 2C1OA 3U2SA 4WGVB 1M7XA 2V9TA 2YBRB 5D7LA 2I9LB 2A6KB 5EUOF 4FQHA 3HE7D 4P46C 1KB5A 3V7AG 3MV8B 3JUYA 4JM2D 4FTVD 3O4LB 3QNZA 5TFSL 3EYSH 4ZFOA 5HYJA 2AXGA 5C09A 4OD2B 5HY9A 2R2HB 1NL0H 1B90A 3QDME 5JORA 6FABH 3QQNA 1QLEH 4L8DA 5I15H 3U82B 1BD2A 1T2QH 1VPOH 4MB3A 1BVZA 1H15A 5CGTA 5D6DC 5ACZB 2H6PB 1NC2A 2M2DA 3BP5A 4JO3L 4LSVL 5HBBA 1EX0A 3BPCA 4Z7UA 4ZXBB 4ODVL 4U3HA 5DD5L 3DXAA 3HFMH 1CD8A 3S4SG 3L6FB 2X09A 1U8QA 2VLLA 2PO6D 3WS3B 4L8SB 1U8OB 2VR4A 5FFLA 5CD5D 4M3JA 1FIGH 3FT2A 3GIZH 3RI5K 2IFGA 4UT9L 1F6AA 5MP6H 3DRTA 5T3XH 1HI6B 3BPLC 1DUYA 3RWIB 4G5ZL 3KNBA 5BS0A 2ARJB 3FL7A 3P73B 2VITA 2LU4A 3RGVC 5DUMH 2ZUQC 4D3CH 3C60C 5A2JH 4JKKA 4L9LA 5D7KD 5DLML 3VW3H 4NJ9H 1T83C 1FNAA 4JFPB 4U3XA 1FGVL 2VC2L 5I76A 5MEND 2BHYA 2WWMC 2PTTB 4ONGH 3QHTC 3QG7H 3K80A 5GGUA 1AO7E 3L3JB 4OKVB 3F7QA 1QA9B 3QQ4B 5JNYB 5I30L 3TYGH 4GSDH 1NCAH 4L3EA 1YDPA 3AAZB 3U1SH 4Z7WF 1JI2A 2VDQH 2NY7H 4E5XB 4GG8A 2KZ1B 1DBKH 4OCNC 1AO7A 3VDBA 5T3ZE 3V5HB 3CMOL 4LARL 1ITCA 3A67H 5IW6A 5CEZD 3S88H 4GW5B 4N0FB 1QFOA 5CZKA 3CDFA 4OQTA 3E2HB 1Q0XH 4DZBB 1WUNT 4K07A 1DR9A 4WJ5A 4B50A 4F7MB 3ROOA 4ZAKB 2YRPA 5HI3D 3HLAA 5IHBA 5JXAL 1I9EA 3TESA 1G0YR 5GRXG 2UV3A 3IDNB 4LPYA 1N0XH 1AD9A 1GC1L 5GS0D 2D9CA 1FIEA 4YXHH 1TCMA 2CKBL 4CVXA 3MYJA 1D7FA 4UB0L 1C08A 1RZFH 1T04A 4R0LB 3HMWH 1MCBA 5I6XC 5AUMB 1UH3A 3IB4A 5TQ0H 5IIEA 1FBIL 2AK1L 3RWJB 5E5RB 3BUYB 4UIMB 4ZS7H 2FYYA 3TBSB 5ILTH 5GQBA 1AJ7L 4DN3H 2Z4QA 3AS3A 3PWJA 5CBAB 2X4UA 3OX8A 3MRRA 3MCLL 4JKMA 2FX9H 4HCRH 3BZEA 4HUWB 3MUHL 3QUZC 3RGHA 2X4NA 1UJ3A 2YKLH 3D25B 3LSOB 4WTWA 3ZYIA 4D9LL 2NY4B 3L3IA 1FNEB 1XF4A 5IB5B 4YK4B 1NBZB 5DJ6A 5FYKE 3WFCL 2X1XR 1NKRA 2D4FA 5B3JF 4M7ZB 1HCVA 1MHPH 5BQ7A 3LPWA 2X40A 3T2PA 2Z8WC 1FVEA 3JXAA 1ZHBB 4XNXL 3D6GA 4CVZA 2MNUA 5FB8B 4KFZC 3SPVA 1JGUL 4J3VA 1F13A 3FTGA 3BP4B 3HKFA 3HNVL 1A6ZB 3BI9X 1VFAA 3R0MA 3TJEL 3GHBH 2VLRD 5DJ0A 3IAGC 1KNOB 3C9NB 3MJ7B 2IGFL 3MRCA 2HMID 5IGXL 3BZDA 1JCKA 1UVQA 3LQAC 4V1DE 1N7MH 4JE4B 3DBXB 4KPHH 2UVFA 1KEML 2NY0D 2DTMH 5BXFB 2O26U 4MQXC 2Z0BA 3RWEB 4CNIB 5LCVH 2YN5A 3ISWA 4XX1G 2XOTA 4V1DA 3K7UA 3GM0A 4Z7VB 4G3YH 4WWID 2A9MH 4AMKH 2BVYA 3RKDC 4GRLC 5CKAA 2X4TB 1EO7A 1YEHL 3NCJH 4PRNA 5TDOB 5D6CA 4WV1A 4CW1B 3CSYA 2OLDA 1YMHA 2YD4A 3V95A 1WBZB 1A3QA 2CIIA 4IRZH 3RX7A 1J1PL 2VXQL 1GOHA 4PJAF 2K7QA 1TJIH 3QP3A 3UDWC 3VXSB 4KJQC 3I6KA 4PRPB 2DQDH 2F54A 1P7KB 4B7LA 3CGTA 1CL7I 3RWGB 4OZFA 2UZIL 4KVNL 4M1GL 3WDJA 3LZFH 4TSAH 4OLYH 3SQBA 4O5LL 2G60L 5EO9A 1XFPA 2FRGP 2A6JA 1F6FB 5IW3A 3WIIL 4XH2B 5DJ8A 3ZDYF 4WHTB 3WMSA 1YEIH 5DQJB 4U0QB 3QIWA 3LRHA 3TO2B 3I02A 4WHDA 1DDHB 1RUMH 5TH2B 3FO9A 1KFAL 4Z95L 5CBEB 5E8EB 3QNYB 1MCOH 1BJMA 1CLOH 1KELL 4EKXA 4O9HL 4WDIA 1FZMB 5F7YC 3MUY1 4MNGA 1SBBA 2W9DL 3N50A 1OARH 2JJTC 4ODWB 4OFYA 1RFDL 1ZMYA 5IWLC 3Q6GH 4PJ5D 3GRWL 3QUKA 3CD4A 2V7NB 1O5DT 4LSTH 3LQZA 2V2XB 2V9RA 4XNYH 4RMVA 1CLZH 2NY1C 1MCQA 1OTTD 4NCC2 2GJZA 5GISL 3TNMB 5D9SB 3UTQA 1BBDH 3ULUC 1UT9A 4ORZC 4LCWB 1MFDL 3CU7A 4G6AC 4U1HA 3D9AH 4LGSB 4YO0B 4OIIL 3O45A 5DDHA 1PZ5A 1CCZA 4Y5XA 4YDIL 4HW6A 4P48A 1JPFA 1UEYA 4HWBH 4JFFE 1CFBA 4MX7B 3ZYJA 1K3ZA 5I2IA 1V7NL 1UKTA 4C58B 1DBAH 2FWOB 3B43A 5AZEH 2Q8AL 1MEXL 3ZHKA 3RDTC 1NGYA 5JXED 4P3WA 4XBPB 3VDAA 3D0LA 3PDDA 4GXUM 3TVMD 5C0CD 1B6UA 3D0VB 4W4OA 5BZDA 4OKDA 1LP9E 2DQIH 4P46D 4HIIA 1KCUH 5ECJE 5J56B 3WIHL 1KJVB 2ZCKH 5FV1L 2BX5A 3LN5B 4JPWH 1EFXD 4CBPA 5J11B 3T65B 3KLHD 4YDVA 1N6QH 1LP9A 1IEBB 3VGDA 3MA9H 2CO6B 3C8DA 2F5AL 4OGAC 3R06B 2VSDA 1IAKB 4S11A 3P11L 2X42A 2ZSVB 2IANA 4XTRC 5HGDA 3TT1L 5DTFB 1HHJA 1TZHB 2C7UA 5FGBC 4I13B 4YFLI 1RZJL 1GRWA 1CGVA 3H3PH 4G8GE 3HI5H 5HHME 1CBVL 2Y7QB 1UH4A 1DFBL 4GAGL 5F3BA 5CMAB 3S4SB 5F6HI 5J1AB 1I7UB 4OLWH 5MEOB 3HNSL 1P84J 3GK8L 4Q9CA 4NP4L 4QT5A 5FKAB 3HB3C 4JPIA 1DN0A 4YE4L 5FK9A 5LVEA 1DLHB 4N0UE 5FKPB 1ERNA 3G5VB 5T5NG 5GRVL 3L1OL 3SDDB 1NMCB 4RISH 5DJ2B 1HSBA 4F9PA 3T4YB 5FA3A 2ZJSH 1JN6B 3U0WH 1UB5B 5EBLA 2YA0A 3LS4L 4LLYA 5KTEH 4Z0XB 3OJMB 2WWMD 3ULVH 1G7MA 3F12B 4XMPH 4YX2L 2AJSH 4XCFL 3ZLQC 3TM6A 1C8PA 2Y5EA 1BQUA 3BVNA 4FQXC 4NN6B 1IGYA 4PRIA 5SX4I 1YNLL 3ARQA 1MFBL 4P3CH 1AGCB 1GIGL 2QEJA 5F7EH 3VG0H 1XR8A 3WLWD 2QQQA 1GZQB 2IPUG 2H32B 5BW7C 1G7LA 3HI1B 4J4PC 3MLSH 4X80L 1BOGA 4XHQA 2R1YB 2FZ3A 2KL6A 2ARWA 4PLNC 5EU7C 5EU6A 4M62L 1ZS8A 4QHLA 1PGRB 4I0CC 5E8OB 3U46B 1JK8A 5JUEL 2JCCE 3ZSSA 5TF1H 1D5XB 5I75B 1KUMA 5ALBH 4QTHA 1EHXA 2GEEA 2Y06H 1QSED 3R1GL 1XAUA 5TQ2H 5EOTB 2OR9L 4QRPB 5EZOH 4ZO9A 4M6NH 3BISA 3VFMA 4TTGA 1U3HA 4M61A 4K9EH 3DSFH 5D1XC 3BZ4B 4RGNC 4WUUE 1YEGH 3IYLW 4OLUL 1G0DA 4J6RH 4LCCC 1SJEB 3AXLB 3KPPB 5CIPH 4JVWA 3EDFA 4OF3A 4GG6F 1MCHA 2ILLA 2HH0L 1N8ZB 1H5BC 1KIPB 4QLRA 4PJFE 4Q9QL 3BMVA 1T7ZA 4R9HA 2W59A 5CGYD 3RY6A 5DRZB 4JRWA 2UUDK 4WI8A 5I1IL 3BDYL 4Z18A 1FL6B 2QSCL 2GITA 2NY3C 3HA0A 4XVTH 2V2TB 5DFTA 2AV7A 5EU7E 3G6DH 3RTQD 2PYEA 4LBEA 3QFJD 1AQDB 5A3IC 4PJFA 5ID1B 1F3JB 3WXVL 1WIPA 2SEBA 3GJFB 2MQ3A 4LHUA 1S7TB 4P9HC 5D7SL 2BVPB 3OF6A 3L3OB 2EYSB 4JRXE 3WFDH 3IDIA 5GGQH 3H7BB 5AAMA 3D69A 4OLVH 3TN0B 3KPOA 3VXRB 1JVKA 1ZVYA 1VKXA 4OLXH 4NN7C 5IMKA 1G7HA 4QYOA 4XCNA 1HH6A 3MREA 2GSIB 4XRCB 1GGIL 1YPZB 3GMNA 2DM3A 4ZFFA 5MEQA 4JRXA 4PRDA 4I3RL 5IEHB 1NJ9A 4QNPF 3IRZA 4P2OA 1BAFH 3LV3B 4JLRA 2R9HD 5FYJH 4IHOB 1FDLH 2E7LA 4DAGL 1R3KB 1NFKA 5ENWA 1CIDA 1BX2A 3SDAB 4DKEL 2HAZA 1HIML 2WP3T 3V0VA 1RK1A 1ZA6A 3IRPX 2FGWL 4NO3A 2DS4A 5GIRA 5ELIA 4D0DA 5KW9L 4PJCE 5I8EB 4JY4B 1MCJA 1M4KA 4KXZH 1INEL 3ARDB 4D0CA 5F9JB 3RJQB 1A4KB 1YYLH 3KYNA 4JG1H 1K4CB 3H3KA 1OWWA 4PJDF 3LKRA 1S7UA 4YPJA 4YDJB 5D70H 3OTTA 4XI5D 3M17B 3LMJL 1UM6L 1WBXB 2I07A 2R56L 2GAZB 3QXTA 4GMTH 3V6BR 1SY6L 1LNUA 4I48B 1OAUH 5JQ6L 2IAMA 3VWJD 4M1CC 5K33A 2L4OA 4OF8A 3MRIB 3HZMB 3L3KA 4LGRB 1JGVH 4DGVL 2FEEI 2W65B 3NCFB 1A0QL 4LIQE 5ANME 3PHSA 4JO2H 2DLGA 2Z92A 4L1DA 4KHXH 5IVXA 1YQVH 1AD0A 4AG4H 4OCLC 1FZOA 2WWKT 5IOPA 4OAWB 2C1OB 3KPLA 3QUMH 3U2SB 1UZ6E 3V7MA 4KK9D 4MVBC 4RMSA 5IMMA 4Z7OF 5DWUL 4E42B 1KB5B 3SO5A 5ID0B 1OHQA 1H3UA 2F9BT 3A6CL 5M95B 3QNZB 3NACH 2OK0H 3SEPA 4ZFOB 4RWYL 1KN2H 2AXGB 5HYJB 5C09B 3B3IA 1XIWD 5HY9B 5JORB 2XZCL 1CS6A 3LEYL 1IQWH 2ITDA 5DK0A 4FOMA 4Z77A 4L8DB 2G5BA 3DVIA 1BD2B 1ZHLA 1H15B 3FOLB 1NC2B 2D7PA 3ZYZA 4HGKC 2JJWA 3QEQB 2DTSA 1OL0A 3BPCB 4U3CA 2IADA 4Z7UB 2VQ1A 1I85C 3Q2CA 2P5EE 5ACLA 1T5XA 1BLNA 5CD3A 3DXAB 1PY9A 1FO0L 1LEIB 3QDJE 1I8LA 3EJZC 3LS5L 4ZPVA 1U8QB 2VLLB 3QJHA 2GJ6A 1VENA 5BZWA 4WW2A 5F1IA 1TPXC 1HXMA 1GZPA 2VZ1A 2P5EA 3FT2B 4NPYA 3HS0B 3MV01 1F6AB 3FMGL 3G5XB 1RJYB 4IRJA 4WHYH 3UJTH 4QRRD 2NR6D 3VXUA 1DUYB 4HUMB 1G6RA 1QFWL 3KNBB 5BS0B 5I1JH 4BUGA 3KJ4B 1LK3L 1Q9KA 2VITB 1AXTH 3DHMA 2H45A 4MNQE 1IAII 4GKSA 4K3HA 2FIRT 4LQFH 4L9LB 4D9RE 4G9DA 1F3DH 3EYOA 3BW9A 1NGWA 5L2JA 5KVFH 2BXYA 1J87A 2FX7L 2WAHA 4MA3B 4YLQT 4LNRA 2OI9B 5I76B 4TN9A 3RZCD 2CJUH 5HDOA 3IFLH 5GGUB 1OM3H 1INDL 5D2LE 4R26H 4L3EB 1YDPB 4KWUA 2AQ1A 2NW3A 4ETQA 2CXGA 4JZJA 1CE1H 2EDHA 4TVSa 4WI5A 1TJHL 1B4RA 5CUSL 3P9MA 1PEWA 4EUPG 1E6JL 4JFEE 1SEQL 5IW6B 2UZXB 3STLA 2AV1A 4WJ5B 3OAYK 4G6FB 5DI8B 3ROOB 1G7IA 4YHPA 3VD5A 3OG6B 1IC1A 3HLAB 1Y6MR 4L4JA 3OKEA 5DK2A 2HKFL 2EIEA 4JFEA 2O5YH 3DSNA 3CK0L 4F58L 3DMMA 4QXWA 1PQZA 3ZMRA 5CJXA 4OGYH 1U36A 4CVXB 3MYJB 2KUTA 4ELMA 2XQYK 1C08B 3MOAH 3OR7B 1T04B 4HK0B 5F93C 3MACL 4PV8B 2EDDA 1ETZA 1T7YA 5EU4A 2BNUA 4TNVK 2D0FA 2Z31C 2OMNA 4KKCC 5F7KC 4ALAH 2Q6WA 4I0PA 3NFSL 4YXKL 2IPTL 3QO1A 5ADPH 2IBGA 4Q74A 4APQC 4KDVA 4NWTL 1B88A 1J8HB 4H1LA 2FYYB 3V79C 3ZTJH 2ERJB 1IKFL 1T66C 4JPKH 4KMTL 2Z4QB 4MJ5A 5E2VH 3BN9C 4PTTA 3N1QC 2X4UB 4Y0GA 2UWEA 3MRRB 4FTVE 4PJHA 4Q7DA 5L0QC 3BZEB 1L0XA 1QTYT 5C0RH 1KPUA 3U9UB 5IHUH 1HINH 1UJ3B 2X5PA 4H88H 5CJQL 4XVUC 2IG2L 5GS2H 4BKLA 3L3IB 3P4OA 1XF4B 3HE7A 3RFZC 4XHJC 1NCCL 4JM2A 5DJ6B 5IJKA 4RGOL 4LL9A 2AXFA 1EHLL 4LFHG 4UNUA 4XPAH 4ORGB 5BQ7B 2W0LA 2HA1A 3FT4A 1FVEB 4LPXA 2EXYC 25C8H 3U4BH 2DBJA 1AI1H 3SPVB 2FSEA 5I73C 1X5ZA 1J1OH 5DQDH 4GW4A 1GSMA 5FO8B 4ZYKA 1VFAB 2JELL 5L88L 5CEYA 5I1EH 2AQ3A 1AKJB 4CMMA 3HZVA 1DN2A 3MRCB 3ZE2E 3BPOC 4UUJA 2G9HA 4NUJA 1UVQB 2ZUWA 2PO6A 1J5OL 1NCTA 3H2WA 4J3SA 2YD9A 4UTAH 3CZJA 2YRZA 4RAUB 5D7IF 4IDJL 4QRQA 2VZTA 3TPKA 1NGQL 4LSDA 3EFDL 2C3VA 1NQBA 2B5IB 4LVHC 4X6EA 1JMXA 5D7KE 2BSSA 2OR7A 3V6ZA 4KJWC 4Y4HC 1TCRA 4TVPD 5E2TH 5C0AE 4ZD3H 3ME0A 3MLZL 3VWKC 3SDXE 3GMMB 2V5SA 5J6HB 5D6CB 1S7QA 2W0KA 1MCNA 4ZDHA 3CSYB 1YMHB 2CIIB 2HJKA 2KBGA 2NMSA 4U1IA 3F7RA 5MENA 2RFXA 3RVWD 4Z8FH 3SDXA 3OBAA 1E4XH 5JLZA 3QEUA 2F54B 5EU3A 5DHVB 3KPSE 1G9EA 4UQ2A 1C5BL 2E27H 4N0YL 2DDQL 2VJXA 3G04A 3TJHC 1B2WH 4Y19A 4FQCL 5EO9B 2F8OA 1G7QA 2D2OA 1NEUA 2DQGH 1K8IA 5JR1L 5DJ8B 4XPFL 4HIHA 4XXDA 1RIHH 5BRZE 1FG9C 3QIWB 3OKKA 5F7LB 3ECBA 3WEXB 1FH5H 4JJ5B 3ARSA 3FO9B 3NA9L 4WU5A 1JWSB 2J2ZA 3PL6D 2VLKE 5A2FA 2DQTL 4QOKD 4WDIB 1CDBA 4MNGB 2ZWLT 3QBTB 1X5HA 2CK0H 2K1MA 5JDSA 5DJXA 1MWAL 1GAFH 3QUKB 3INUL 5L2KE 2CUIA 4FXGB 5KOVC 3AMKA 4LSSL 1HYRC 3P9LA 4R90H 3LQZB 4DGIL 4JFXA 3SE8L 3MRLA 3O3DA 4GXVH 2XZZA 4MQTB 2GJZB 4P2RD 2OL3L 3UTQB 1TVBA 1MWAA 4N1EA 3MRDA 4U6XA 1WTGT 2P8LB 2EC9T 3CFKA 1KLUB 1U6AH 4U1HB 5CILL 1UA6H 3O45B 1PZ5B 3OKYA 5E7BA 5A43C 1IGIL 2IBZY 4M1CD 5I1KL 4IIQC 1PD6A 3LKSA 4HH9A 2I25N 5I2IB 1JHKH 3CX5J 2AJYH 4HF5L 1S3KL 3MBED 3X11A 3ZKND 5H35A 3EDKA 3MRBA 3C5ZB 1G9MH 5CZXC 1OF2A 2FL5A 4PGCA 1IGFL 4NNPL 3X12A 5K59E 4JZNA 4ODXA 3F5WB 3P77A 3DIFA 4JQXA 2DQCH 2VLRE 2EDQA 5BZDB 3CFEA 3E6FA 3WFHA 1IVLA 1P4IH 1EEUA 3VCLA 1MFCL 3I6LE 4R97C 3C08H 2DI7A 3VGGA 3QISA 3DUUA 1P4BL 2VLRA 3T8XB 4PJ9C 1ES0A 1FORL 1U8PB 5F89A 3TFKD 4PPTA 2M26A 1MIEH 1YEKL 1ZA3B 3FQTA 2AEPL 2IANB 5HGDB 3DV6A 4CL7A 1INQA 3CVHL 3U30B 5K9KA 1MIML 3QPXL 2C7UB 1HNGA 2O93L 4JM4L 3L5XH 1A47A 3M45A 3DROA 1F4AA 1WWBX 2BERA 3MMEA 5F3BB 3GUTA 3AM8C 4OCYH 4OSUH 1JZ5A 5FM5O 3HC4L 3S36L 5SWQA 4HQQH 1K6QL 1JZ4A 4NDMA 4IMKA 4C56B 1ZEAH 4KRMB 3L95A 4L4VE 5HHMB 3U4EA 5F9WC 1R0AL 4FQ2L 4K9EC 3V4PH 4JFOA 1JUFA 2RB8A 4KRPD 3I50H 3MLPA 5IFHL 3TIEA 2VR5A 4P23D 1ZXQA 2A77H 1IQDA 5I8OL 1UWEL 1HSBB 1VHPA 1S9YA 1MCEA 4WI7A 1LO3L 5FA3B 5J12C 1WIUA 5EBLB 5FGSA 1ZGLP 2CUHA 4LLYB 4QHUA 3IJHA 1Q1JL 2ZUXA 1W2KT 4XCCH 4JN2B 5C0DA 2PXYD 4ZMAT 1J86A 4OFKA 1I8IB 3GEWB 4RMTA 2A1WH 3ARTA 2H1PL 3BVNB 4OLZL 1S7WB 5I71C 5IHLB 3LN9A 4PRIB 5HHOE 3IFNH 1MUJA 5DC0A 2DLEA 4RAVB 1A7OL 4Q9RH 1WWWX 2R15A 2UYLA 1XGRA 3T0XA 1XR8B 1NGPH 1WISA 3QHZL 3NIGE 4YEEA 1X5AA 1G7LB 5TFSH 4EUPB 2JTDA 3DLQR 5JOFA 5EZLA 2FZ3B 3QWOB 3IDYB 5F21B 4PJ5A 5EU6B 1E4WH 1ZS8B 2Q8BL 1NGZA 1JK8B 2QJDA 4GMSL 4XCEA 3UAJC 4X4XA 4JO3H 2Q86A 3WBDA 4LSVH 4OM0H 3PWNA 3WYRA 5HI5C 4Y88A 3V6OC 3VFMB 4EIGB 1U3HB 4M61B 5IK3A 3GSOA 5L8JB 1T0MB 4TUJB 1A7NL 3X3FL 4U1LB 5ICYA 5DD0L 4TQEL 1LVEA 3QUXC 5I0DA 2YD1A 4OFIA 3EJYC 4HC1A 2XFXA 4F7EB 1T66D 3NPSC 4ENED 1KXTB 3BN9D 2E7MA 3J8F7 3N85L 4G5ZH 4ODHL 1HILA 5JXEA 3UPRA 5HGHA 1WZ1L 3MXVL 3QR2A 1TMCB 2PYEB 3M1BB 1LEKA 3TVMA 5C0CA 2ED9A 1I75A 3WNPA 4AIXA 4BH7A 1OOAA 2SEBB 4TUOA 4XCYA 4P46A 4DFIA 3IDIB 4AY0A 2YPLE 2X44D 3D69B 4Y8DC 3T08A 3D3VE 1VKXB 4NZDA 1EFXA 3QZWA 1G7HB 4QYOB 4XCNB 1A6AA 1HH6B 4XP9L 1IBGL 5I30H 4O00A 1MRDL 5MEQB 4ZFFB 1ED3A 4NQVA 2VISA 1NJ9B 2X7LA 4P2OB 1CXKA 2HVKA 4WEBH 3BYYA 1KPVA 3DX6A 4QF1A 5BO1H 3DGCR 3SGKC 3S8WA 1BX2B 1T1XA 5GHWH 1YY9D 1LO0H 3V0VB 4JKWA 1ZA6B 3JUZA 4NO3B 5GIRB 4POYA 1JJUA 3W5MA 1Z5LB 4D0DB 3SKMA 1Z9MA 5FEBA 3T0BA 1RMFL 4X6CA 4D0CB 3KYNB 1OPGL 1OT1A 3LKRB 5JIIA 1S7UB 5HYIA 3I84A 2CKBH 4UB0H 3QCVL 3FO0H 1GXEA 4NN5B 2K3TA 4QO1A 2I07B 4X83A 4TRPL 1IE5A 1IKNA 4O2FB 3IXAB 4G7YH 5INCA 2DIBA 3D5OF 2IAMB 3L3GB 1PLGL 4Z76A 4X9FA 1G0XA 3L3KB 4J23A 1FBIH 3C60A 2F19L 5EA0H 4EDXA 2AK1H 2OTPA 2DWEA 1F2XK 1OTSD 4R7NA 2H2SD 2ZPKL 1CVSC 4QGYA 1R3JA 1E27A 4NRZA 2VLJE 3QWRA 1EGJA 1JGDA 4HZLA 5IVXB 1AD0B 1AJ7H 1FZOB 1NAMA 5IOPB 2J8OA 5KJRL 2D7NA 1NFIA 2FDBP 4PLOB 2C3WA 3MCLH 4OZHA 5IMMB 3OZ9L 2J4WL 5FOBA 1UC6A 4D9LH 2CLVB 5F88B 3GBML 3WN5C 3MV7D 2CDFA 3ZKXC 1AFVL 2ITDB 5DK0B 1X4ZA 4Z77B 1F00I 1JF5A 2G5BB 2OQJA 2Y6SD 2UUDH 1ZHLB 4OQ1A 4Z7WE 3H9SB 4EBQH 3ARPA 3KPRB 4ZUVA 4XNXH 2IADB 1A7PH 1TVHB 3B5GA 3DURA 2AK4D 1T5XB 3HAEA 1BLNB 5CD3B 4KI5F 2YK1L 5IQ7H 1PZUB 5GRUL 3QJHB 4NFDA 1KIQA 4H5SA 1QSEA 3SOBH 2GJ6B 2BRRH 2EDLA 5BZWB 3N0PB 4WW2B 1EXUA 2IGFH 1HXMB 1GZPB 4NQXA 2QQLL 2P8PA 1WCBA 5IGXH 4OIBA 4LVOB 5D1QD 2NXZB 2AGJH 4FQ1L 1IC5L 1KEMH 3A6BL 3VXUB 4JREB 5IFAH 4JDTH 1X3DA 4I2XE 4PV9A 4MB4A 1Q9KB 3QFJE 4JPVL 2OR8A 5EBWA 1JPSL 4M7KL 2X1OA 2RCSL 2VTFA 2FEDC 1OGAE 3BW9B 1NGWB 3GDBA 4XMKL 5L2JB 2EH7L 4HWNA 3MNVA 4NQSB 3RTQA 1YEHH 3QFJA 4TOYL 4MZ3A 5J9PB 3KHQA 2XRAL 3SE3A 3BT2L 1VADA 4F37K 3AS0A 5TGBA 4BZYA 2Z9TA 2P7TA 1J1PH 2VXQH 4FG6C 5CZXD 2A73A 3NCMA 2ZUYA 4XNUH 1JL8A 2NW3B 4ETQB 1QR1A 4JZJB 4GH7B 4TSBL 4X8JA 3ULVD 2UZIH 3P9MB 1YYML 1WGOA 5F7UA 4IS6A 4OI9A 3LQAL 3PXHA 3P30L 3STLB 5GGVY 4O5LH 3O4LD 4HEME 3OKOA 3UBXI 1P69B 1G7IB 4YHPB 4PJ9D 3WIIH 3FB6A 2HFGL 3OKEB 5DK2B 3ZE0E 4M93B 3O3EA 5JQHC 3W9DA 3DMMB 1PQZB 1UB6A 2DIAA 5J1TC 4AEHH 1KFAH 3TA3C 1MJJA 4ELMB 3WKNA 1KELH 1ETZB 3TH4T 3GSNL 2BNUB 5I1LA 1J18A 4MQ7A 1XGPA 4CN4A 2A0LC 1CFTA 1KJ2H 2XWTA 4ZFGH 2W9DH 2Q6WB 2F8XC 1BM3L 1ROWA 3CAFA 1HE7A 1JTTA 4I0PB 4KTEH 1RFDH 3QO1B 2BNRD 4XWGL 1UH2A 3GRWH 2FATH 3VWJA 5ISZE 3P40A 1P2CA 4KJYA 1ZT4A 1G1YA 1BFTA 5BV7H 1LO5A 1AY1L 4PTTB 4BSWA 2R1WA 5GISH 5ETUA 2UWEB 3I75B 4PJHB 5HYFA 1CWVA 4AL8L 3B8SA 1DZBA 1I7TA 4GW1A 5CP3H 4DKFL 4OIIH 4BKLB 3P4OB 4ODTL 4YDIH 3QZWG 1OTUC 3SJVD 5DEFA 3TO4C 4U7MA 1KCKA 3WJLA 4U6TA 2HRLA 4PJAE 4ZSOE 1XIWA 3NA4A 1R3IH 2XICA 2Q8AH 1MEXH 2FECL 1EO8L 3FT4B 1E28A 3BGAA 1JGEA 4Y16D 1IAIL 4N0RA 4JQVC 1ZHNA 4ZSOA 4GW4B 4J3TA 2VAAA 5C9JA 3VG9C 4M43L 4ZNEE 5I8CA 2LTQC 1JYXA 1ZLUK 4CMMB 3HZVB 3TV3L 4UUJB 4MMXC 3V0AC 3ZKMD 2G9HB 1P6AB 2JJTA 4NUJB 1X5KA 2B1HL 5E9DE 3KPNA 1I8KA 2ED7A 4OTXH 1ZLVK 3ULUL 1NAKL 4Q58C 3RJDA 5FYJD 3V8OA 4QRQB 4XP4L 5CAYB 4Z5RB 1CU4L 3P11H 3UAJD 5H94B 3QYCA 5DT1H 4QRRA 2C3VB 2HT2D 4X6EB 2BSSB 3TT1H 4UU9B 5HI5D 4KK8D 3V6ZB 4GBXC 4PJ7A 4LAJH 4NSKA 3I2CL 3MJGX 1YECL 4L9DA 4HG4K 3OAYH 1RZJH 3MJ9H 4QRSA 1S9KC 1RULL 2AJ3A 1CYGA 2N7AA 1DFBH 4YNYA 3D2UD 2E9JA 1D9KC 4GO6B 3RWCA 1S7QB 4PGEA 2YA1A 4ZDHB 3AB0C 4F37F 3VXPB 3EJYD 3HNSH 3PGFL 1NLDL 5MENB 2MCPL 3HRPA 3ESUF 3RZCA 2RFXB 5IB1A 4HS8L 1MCWW 2BSRA 3ZDXF 1YPZF 4PJXF 4YE4H 5JLZB 3THML 3QEUB 2XG5A 1RHFA 3QH3A 4LPUA 5EU3B 3REVA 4EDWL 3QUYB 3EZJB 3H7LA 2VL4A 3L1OH 4UQ2B 3H8NA 2APBA 3WE6A 4QHNA 5ICXA 3G04B 4QRUA 4Y19B 5D7JB 2EEDA 1G9MC 3DVFA 5IEKA 4KJPC 1G7QB 4NM8L 3MRHA 3QDGD 3LS4H 1K8IB 3F58L 5JW4N 4XXDB 4GUPA 4YX2H 5AZ2L 3FZUD 4OT1L 4XCFH 5CZVL 3ECBB 5EBMA 2FD6L 2H8PA 3HAEG 1QZ1A 4WU5B 4HFUH 4N9OB 1Q9OA 1L0YA 5GRZA 1HCFX 2XG4A 4XNZC 4S1SH 2ZG1A 5JDSB 3EYQC 5DJXB 5FGBA 4X80H 4XAKE 1WIOA 4W68A 4EZMA 1BJ1J 1HHIA 3TC9A 1A9EB 3ORJA 4X99A 3P9LB 2P42B 3TH3T 5M94B 1PG7L 1T22A 4JFXB 4PJEF 3NCCB 3MRLB 3PG2A 4J3UA 3O3DB 5K93A 1X9QA 3W5NA 1TVBB 5C0JB 1MWAB 3LEVL 3O8XC 3MRDB 4Q2ZA 1AHWC 1DEEA 5TF0A 5EOQL 3ZT6A 1SYVA 1A2YA 3CFKB 4Y1AB 2VDML 3B4NA 4P4RB 3BKCH 2OR9H 4OZGF 4H8WH 5KSBE 3BSZL 4DVRL 4MA7H 3C8HA 2OL3B 3EBAA 2W0FA 3LKSB 2E3VA 4HH9B 5H8DA 4FFVC 5DD6A 4OLUH 5D72L 2RBLA 1SBSH 2MWCA 5H35B 3X11B 5GSRA 3MLWL 5DR5L 5KSBA 4HT1H 5HYSA 3HHRB 2EKJA 2HH0H 3VFVA 1M05A 1OF2B 2FL5B 1GGCL 4PGCB 1NKOA 3KYMA 5DK3A 3X12B 1FAIL 4JZNB 4ODXB 4Q9QH 5D5MA 2FGZA 4MHHI 3P77B 3PGCA 2RJMA 3DIFB 2HJLA 2DQHL 3CFEB 3E6FB 4PRPD 3WFHB 3BDYH 2QSCH 4D9QD 1JRHI 4URTB 1MHCA 4WFHE 1PSKL 4MZ2A 4CKVX 3UZQA 4PBVC 3WXVH 4X6DE 2BVTA 3DUUB 2WUCL 2VLRB 3CFBA 5LQBL 4R2GC 2AABL 5HHVL 1ES0B 4HS3A 2DICA 2EDYA 5F89B 4AIOA 2IQAA 5F7NC 5F6IC 3FQTB 4X6DA 2EC8A 3CU1A 1KTLA 3T3PF 1A5FH 2CXKA 3DV6B 3WKML 5DGRA 2IQ9L 4I3RH 1RD6A 4TVPE 2Z93A 5K9KB 3G6AA 1U58A 4UDUA 3DROB 4I5BA 4RDQG 1NC4B 3MMEB 3GUTB 4NIKB 4DKEH 4YFLF 1HIMH 4G42A 1YC8A 1TTUA 5B8CC 5D1XA 4DGYL 1BF8A 4NDMB 3B2UC 5KW9H 3U4EB 5F72S 4AT6A 1INEH 3BRGC 1A3RL 2HTKD 3PGDA 3ILPB 4JFOB 5F1KC 1JUFB 5DGQA 2NW2B 4QEGA 3MZTA 3TIEB 3E6HA 5LWYL 1IQDB 4OF7A 2JJVA 1S9YB 1JTPA 1KF9B 4P9HL 1UM6H 2NY6D 2R56H 2FEDD 5K9JH 3B6SA 4M8QA 4PBWD 4EN3C 4LKCA 2YD3A 4QHUB 3IJHB 3IDMB 2OBGA 2HP4A 5ITBL 4PJBA 5C0DB 1N59A 4DQOL 1FSKC 2QSTA 2E9IA 1JYVA 3EYSL 5TE4H 1DJSA 1BWMA 1WBYA 2YD5A 4XBEL 4LIQL 1XGTA 1MCLA 4CU6A 1MUJB 5GS2D 2X41A 6FABL 3QXUA 5ESVA 1Y6KR 1XGRB 1IC4L 3RA7L 3PL6A 5EO1A 4CRPA 4QOKA 1H3XA 3K2UL 1F4YL 1D5MA 3GMLA 4W6WB 5JOFB 1LGVA 2VQUA 3HFML 1AXSB 5EZLB 5GXBB 4KZEL 2EDRA 3LEYH 1MCFA 3GSUA 3QB7C 4P2RE 4PJ5B 5JW3L 1SYSA 1NGZB 4DFHA 5FA4A 1MF2L 4XCEB 1FIGL 2V5TA 3GIZL 3T77B 4X4XB 2DKUA 2Q86B 5MP6L 5T3XL 1KPRB 4P2RA 3KHOA 5I74B 1UJTA 5SWZE 5IK3B 1FO0H 3GSOB 5HHXL 3LS5H 3MLTA 5ICYB 1IGTB 3CH1B 4D3CL 4HHAB 3RKPA 2EDFA 3SKOB 4NJ9L 3WD5L 5FECA 1RJCA 1QYGL 3MBEA 2GI7A 4EOWL 3AGVA 4JHAL 4U31A 1HILB 3MGTA 3C5SB 2KDGA 5HGHB 1YEJH 1LK3H 3W11C 4GSDL 4PTUA 1J88A 3SDDD 5MEPA 1DQLL 1LEKB 3U1SL 5E2UH 5C0CB 3LKQA 3K0WA 3TVMB 3QDHA 1RZGA 4BH7B 4TUOB 4XCYB 4AIZA 1KENH 3QIUD 1NDGA 1DBKL 4P46B 4UDTB 1OTUD 4X4MA 3QG6B 2ZG3A 1WZLA 1C5CH 4Z9KB 5E2JA 5E6ID 1D6EB 3SQOH 1N3NA 1T5WA 4Y4FC 1EFXB 3QZWB 5F6HJ 2X70A 4BH8A 1OAZH 2Z91B 1Q0XL 1HH9A 3F6IA 1OY3B 1QFUL 2WM0A 4NQVB 5I0ZA 2VISB 1C12B 4Z7OE 3UC0H 5GS1C 2E9WA 2HVKB 3LVEA 2XYCA 1N0XL 2MCG1 1FFNA 3DX6B 4QF1B 5CUSH 2XY2A 1UWXK 2BY3A 4YXHL 1T1XB 1DQQA 1SEQH 3PWPD 1RZFL 3Q48A 2EDXA 1RIVH 1I3VA 2VR9A 3SN6N 2BP3A 5EB9A 4RMWA 3SKMB 4KMLB 4C83A 5TQ0L 3HPJA 2ZZUT 4X6CB 1EZVY 5ESQA 5E2WL 3CK0H 1JZ3A 1K85A 5SWSD 2MHAA 4PG2C 2AJUH 3BE1L 1AQKH 2ICEA 4KU1A 3BPLB 1XH3A 3IJYA 4DN3L 1S5HA 4P23A 4NKIH 4QRPD 2QQKH 2EEAA 5D93B 4Z76B 3HZKA 4YBQC 2ZUQB 4YXKH 3NFSH 3WJJA 2IPTH 3C60B 4HKJA 4EDXB 2DWEB 1D9KD 1UCBH 2YKLL 1JPGA 4R7NB 4NWTH 1R3JB 1E27B 3OXRA 4NFBA 3KXFD 4HZLB 4GJTB 1BF2A 1JGDB 3QA3A 3HG1D 3NIDE 1IKFH 2NQCA 2PXYA 5KANI 1NAMB 5MI0B 5CP7A 4HCRA 2H9GA 1NFIB 1F4WL 3QCUH 4P4KC 4OZHB 1OAXH 5FOBB 3T1FA 5BJTA 3RL1A 1AC0A 3KYKH 4KJPD 1X7QA 5HYQA 2CDFB 1NCCH 3GSVA 2CRZA 4ZO6A 3ZE1E 3RY5A 3T2NH 1EHLH 2OQJB 8CGTA 3QQ9D 1I1YA 4GRWH 4NO2A 4ZUVB 4YUEL 3V4UH 3C6LC 4YHOL 1BQLL 4U1GC 5JO5A 3DETC 4LSUH 4TSCH 5E0QA 3OMZA 3OKLB 3HAEB 1EVTC 3PQYE 3S34L 2JELH 2JK5A 5L88H 1KIQB 4H5SB 1QSEB 3KLSA 3FQWA 3MRQA 1XF5A 4NQXB 5I6XB 3SDAD 4KK6C 1WCBB 2A9ML 2WQ8A 5ALCH 2DN7A 2NZ9D 5TE7H 1Z2KA 5CSZA 1HOCB 4AMKL 1J5OH 1JF1B 1A7QL 2ZOLA 1B0WA 1OW0A 4K3GA 1YY8B 4PV9B 5HVGB 2NY5H 3BAEH 3PXJA 2OXHA 1KN4L 1Q38A 4IRZL 3VGEA 3EFDH 1DVFC 5EBWB 2WZPD 1CGWA 3T4AA 3FCTA 4O2CA 3IFOA 5DHYA 5BV7C 3OB8A 4QHKI 1D6VL 3N06B 2C1PA 4EIZC 1KG0A 3T0ED 3P9WB 4OLYL 1LP9F 3ARBC 5TGBB 5E99L 3Q0HA 2P7TB 2A73B 1C16A 2Q7YA 2OP4L 1YEIL 1ZLWK 4EI5C 2ZG2A 4KQ4H 5HVHC 2JJSA 4X8JB 1RUML 1C5BH 5I8KH 1EEQA 5HJ3A 4IS6B 1CLYH 2XT1B 4N0YH 5KS9E 1RI8A 1CLOL 4M1DH 4FQCH 2XXMB 5FGRA 4Y5YC 4K55A 3MOBH 1T1ZB 3OKOB 5CFHA 1HXYB 1OARL 5JR1H 5ACMA 3FB6B 4AQ1B 4HKZA 3FFCD 3W9DB 5MHSD 4O2EA 1UB6B 1T03L 4K2UH 5C0BE 1PJ9A 1YUHB 3GSXA 1MJJB 4G8IA 1Q9LA 4LSTL 4XNYL 2DQEL 3RL2A 4X7CC 3QEQD 3TNNA 1RZ8A 3GM8A 1O7VA 1CT8A 1JTOA 2DQTH 5I1LB 1XGPB 1A14L 2XWTB 1CFTB 1NBVH 3RZWA 5IR1A 3G5ZA 3U4AA 4S0TD 3ULSA 1C5DB 3N1PC 1PKQA 3D9AL 3INUH 3VRLE 4E41E 1P2CB 2LU7A 4KJYB 1ZT4B 4LSSH 4EXKA 3B2UD 3DJ9A 5EUKA 4Q97A 43C9A 2WBWB 2R1WB 4S1DD 4FRWA 1DBAL 5J13B 4WFFD 2VXSL 1K2DA 5FUZL 4YHZH 5EU5A 4OI7A 5IROA 2V9QA 1I7TB 2YUZA 2O5ZL 5CILH 2G75B 4NQDE 2LE9A 1KC5H 1G7PA 4HWBA 2FHBA 3ARFC 5I1KH 3NABH 4YBLB 5DEFB 5JDJA 2DQIL 3TWCL 1KCUL 5FAAA 3MNZA 3ARRA 1S3KH 1XIWB 5T5FH 3JTSB 2ATPA 3MV7A 1QOKA 4GLRI 3S36X 2UZYB 4JPWL 4MS8D 2YUXA 1RJLA 1N6QL 2RQ8A 1E28B 4K7FA 3MA9L 3RPIA 4KV5F 1AIFA 3HTLX 4WI9A 4I9WD 1ZHNB 4PJIE 5C9JB 1A6TA 4K3DL 5I8CB 4C57C 1NMAL 4KDTA 5E8NA 1MFCH 2AK4A 5C0EA 2JCCF 3VXTB 5J0BA 4YH6A 1RVFL 2OMBA 2BVEA 1P4BH 3H3PL 1SM3H 3KPNB 4PJIA 2BDNH 1WITA 3IU4L 1FORH 4UT6L 5CSBA 1ADQH 5DJCA 3NN8A 3OQ3B 1YEKH 4PGBA 2AEPH 2HT3C 1CL7H 3HC3L 4OD3L 4QRRB 1UYWL 4DVBA 2D7QA 3CVHH 4LRIC 1CDYA 2AI0H 4PJ7B 1TZGL 1CDIA 5F96L 4NSKB 4CJ1A 3WLBA 4QRSB 2D0GA 2AJ3B 4PJFF 2X4SA 4MCYA 3FONA 32C2B 4PGEB 5T1KD 3RWCB 5IW1A 2ZJSL 3HC4H 5CSGA 3S36H 3Q5TA 1FN4B 4IIQA 3GKZA 1K6QH 3RNQA 1J8HD 4H8WC 1CN4A 3RZCB 5KTEL 1R5WA 5IB1B 2BSRB 4KKNA 2QLVB 4IOFD 1R0AH 4FQ2H 3ULVE 2AJVL 2V5RA 3QH3B 2AJSL 3RDTB 2MSPA 3MV8E 5I8OH 1UWEH 2JKXA 3W11D 1OQXA 3WE6B 3O4LE 1LO3H 4QHNB 1V3LA 4RFEA 4TTDC 5ICXB 1WV7T 4POZC 4QRUB 1I3RA 5EG6C 2I26N 4RFOH 5IEKB 2QL1A 3VG0L 2I9LA 2WUBL 3MRHB 1Q1JH 5F1NA 4HJJL 4GUPB 3O4LA 1I3GL 4Y4FD 1MH5A 5JIHA 2H1PH 4OLZH 4PJ9A 2H8PB 4PUBH 3EDJA 1DQDL 1M1SA 1RUKL 1L6XA 4OBRA 1A7OH 1CICC 2EDBA 4ZUUB 4QWWD 3AUVA 3K81A 5JTWA 1EA9C 1Q9OB 4PJCF 1QLFA 2H6PA 2BNRE 3RVTD 3N9GL 5TF1L 3KR3H 5C6WH 1UCTA 3EUUA 1AKJD 2ENYA 1HHIB 5EZOL 3ALPA 3RPKA 1HQRB 3GZKA 3IDXL 4HEPG 2WLYA 4K9EL 4X99B 1J0KA 3L6FA 4ODSL 1T22B 2BNRA 3CIQA 1OVZA 4G9FD 3WS3A 2Q8BH 4J6RL 3E2HC 4UBDD 4ZAKC 4Q2ZB 1DEEB 4PP2A 1ZLUH 1SYVB 1A2YB 1ITBB 3GIVA 2VWEE 2YR3A 4YC2B 3H6JA 1I9RL 2DIJA 1MCPH 2GK2A 3K2MC 3B5TA 4ZPTB 5T33H 2ARJA 3QJFA 1A7NH 1IZJA 1MCIA 1ZLVH 3X3FH 4AEFA 3G6DL 5DD0H 4TQEH 1TLKA 5GSRB 4KK5C 5KSBB 3SJVA 1ZVHA 1BGXL 3VFVB 3WFDL 1M05B 1EPFA 3KYMB 3GHEL 5D5MB 3PGCB 1KIUA 2HJLB 3N85H 4BJLA 4ODHH 3S96A 4P4KD 3L3JA 1LMKA 3QHFH 1CK0L 5HDQL 3WO3B 1WZ1H 1MHCB 1GVIA 4Y16A 3VH8G 2DAVA 5KVGL 1QHPA 3CPLA 4FA8A 4E5XA 3H9YA 4NKQB 1BAFL 4P57B 3HRZA 2D7TL 1I1AD 2J3SA 2GK0A 4HS3B 4HWUA 3CUPA 2NY4C 2IQAB 4HAGA 3BKYL 3KJ6L 4YK4C 4XP9H 5ERWA 2OSLA 3BPNC 4DZBA 1KTLB 1MRDH 4F7MA 3FOMB 1KGCE 3DETD 3TEUA 1G9NC 2Z93B 2CK2A 2YC1A 3G6AB 1YYLL 1U58B 3IDNA 3L7EB 2BVQA 4XPTL 4LASL 4I5BB 4V2CB 5FM4A 4JDVB 5D70L 1WF5A 3STBA 5T3ZH 5DUPH 3B83A 4G42B 3V6OA 4NZUH 4R0LA 5D1XB 3QI9C 3HUJA 4RGNB 4UAOC 3X3GH 5EUOA 4B7IA 4LCCB 3PWVA 3D2UA 5SX4H 1RMFH 4AT6B 4HULB 1JGVL 1MFEL 3PGDB 1OPGH 3EOTL 3ZZ1A 5JW5A 4OLEA 1PW3A 3E6HB 4F9LC 1JZ2A 4P2CG 2BOCA 2EXWC 1IAMA 2PW2A 5KVMC 1H5BB 5JMRA 4KHXL 1DVFD 3IKKA 4TRPH 4HZAA 3QUML 3B6SB 5D2LF 4U6VH 5FV2A 4M8QB 1HQ4A 2NY3B 2ZCHL 3EIFA 1CF8L 3AROA 5CEXA 2F19H 2BHUA 4PJBB 3T09A 4DK6A 3D25A 3NACL 1RY7B 3UX9B 3QUMA 1SMOA 1KN2L 3QDGA 1WBYB 1FNEA 4FZEH 5E8DL 3C5ZD 4NN7B 5C7XH 4WEMB 4ELMF 4EI5D 5KSUA 1D5ZA 3PL6B 5EO1B 1BEYH 3QIBC 3TP4A 5IFJB 4QOKB 4LLWB 3GMLB 2Z8SA 4MJID 1H3VA 3AREC 3GBMH 3O9WC 5CLTA 5CINL 3UYRL 5HGGS 3GSUB 5A2KH 1SYSB 5FYKH 3ZHDA 2ZUVA 3MJ7A 5D2NA 3SY0A 4X5XA 5FA4B 4OD1H 4L8CA 2FJFA 2VIRA 2VE6B 4Z7VE 3UJTL 1K4DB 4PJHF 4GKNA 1J1XL 5C08D 2YK1H 4GQPH 2B8OT 3NBNA 2YPKA 5GRUH 4OF0A 1S8DB 2F74A 1AXTL 1LEGA 3JVGC 4Z7VA 4NZTH 4JM2F 3V6FA 2BSTA 3UBXG 4MAYC 4LVNC 3BH9A 5FECB 1IC5H 4C56D 3EHBD 3MBEB 1CGTA 3O6LL 5IVOA 3DX7A 4PRPE 2CJUL 4D9QE 4L4TD 4U7SA 2EE2A 1FL5B 1OM3L 3MGTB 1GYAA 1U8MA 1WBZA 2XTJD 3VXNA 2Y07L 2DJSA 1JPSH 2VXVL 4CN1A 5MEPB 3LKQB 1RZGB 4YIQA 1U41A 4AIZB 4XMKH 1CE1L 3ARFD 1NDGB 2EDWA 4ODUA 2EH7H 3MROA 2QSQA 5EDXA 4KI5C 4M7LT 4G43A 4TOYH 1CQYA 2XRAH 3BT2H 4F3FA 1N3NB 1T5WB 2X70B 3WN5A 4BH8B 3QXDB 4G6JH 1HH9B 4OZFH 5CS7A 5E5MA 3ZE2F 4LLUA 2R29L 3U7YL 2P4AB 4Y4KD 1D5IH 1MY5A 5IQ9A 4GRMB 4AEIH 1FFNB 4EQ2A 4K3JH 4HX1A 1VEPA 4OGYL 5FYKU 1JIBA 3MTRA 2MTPA 1DQQB 3MFGB 4PLJD 4U6YA 3P30H 4Q6YA 2OCFD 2ZNXA 2BC4A 5D1ZC 1ZHKA 4C83B 1TPXB 3HPJB 4ODWA 4DKAA 1D5BA 1R24A 1B0GB 3GO1L 5ESQB 3QRGL 1EO5A 3TPUA 4PY8I 3CFCH 2MHAB 3SDXF 2HT3D 2ICEB 4RMRA 2C5DC 3IJYB 1S5HB 3GSNH 4KRPB 2VDRL 5E2VL 4LK4A 4P23B 1Q94A 1QKZL 3WL9B 3TNMA 2NPLX 1U8IA 3HZKB 1BM3H 3MV9D 2VKWA 3UO1L 3C2AL 2J12B 4HKJB 5BVJA 1WFTA 3JSSA 3O2DL 3EOAA 5FHAL 2NY5C 4HJGA 5JW4R 3OXRB 5CHNB 3QA3B 3MLRL 2YWZA 3ETBF 1TQCB 5IM7A 2PYFB 3B2VH 1L4IA 2PXYB 4MX7A 3RNKA 2H9GB 4I3SL 1AY1H 4XPAL 1NMBH 1NCUA 5FCSH 4AL8H 2R2EA 2VDKL 4XBPA 3U4BL 3BN3B 4POZD 1AI1L 2DQJL 3TGXA 5BJTB 3RL1B 3V7AE 1Z3GH 1X7QB 1J1OL 5HYQB 3GSVB 2J7LA 2GYSA 2BXZA 4JVPA 4MA1C 1FE8H 1RJZA 3BHBB 2HTLD 2E8YA 2I60L 1I1YB 3LDBC 2DLIA 4NO2B 3D85D 1EMTL 5JO5B 3S3PA 4LFHD 1MAML 1CICD 3NOIA 4UTAL 4NUGL 2E9BA 3I3DA 1IAIH 2CR6A 4NN6C 4M8VA 4X7EC 2JK5B 3CLFL 2ZSVA 3FQWB 1Z9OA 5A40E 4MXQC 3S37L 1XF5B 1KCRH 1X44A 1WZMA 2Z31B 3TV3H 1CTOA 1A21A 2ZSWA 4NC1C 1A7RH 4MLIA 2WBJD 3F6LA 5CSZB 4Y2OA 2VN7A 5JA9A 2ZOLB 4MNHA 3ULUH 1NAKH 2ICWJ 3S4SA 1CU4H 9CGTA 1UWXH 2ICWB 2EECA 3C09C 5E1AA 1IM3B 4Z8FL 3T4AB 1OAKL 3I2CH 1YECH 4JFQA 3FCTB 4O2CB 5E8PB 3IFOB 5DHYB 1RULH 3L5WA 5K59F 3SDDA 4LU5H 4PJ8D 2C1PB 1KG0B 1RIUL 4S2SA 3RVUD 4GS7C 3QIUA 3V5KB 1B2WL 2XN9B 3MOQA 4KK5D 1YNKH 3BYTA 3PGFH 1VGEL 5C71A 5I1HH 5E6IA 1C16B 1PG7X 4K7PL 2Q7YB 3S3JA 4BZ1L 1WT5C 3QAZB 1RIHL 1TQBC 4C4KT 1FL3A 4LOUD 3SE4A 4RFNB 2GY7B 1HYSC 3AY4C 4I4WA 5HJ3B 3WUWG 1H3GA 1IRAY 4XPHL 1FYTD 5I73B 4NQTA 3WDIA 4UINL 1AGCA 4JJHA 3VH8B 1C1EH 1GZQA 1A3LH 3PWPA 4HXAH 3F58H 4OCMC 4CVWA 3FHQA 4HKZB 2Q20A 3HI1A 5SWSE 5AZ2H 2HT4C 1GAFL 1WJ3A 2FD6H 3BX7C 4O2EB 4I8DA 3GSXB 1F58L 3H9SD 4F7PB 3KPRD 1RZ7L 2VDNL 4QRPE 1RZ8B 3TNNB 1CT8B 3VU2A 4P99A 4GXVL 5SWSA 4LVHB 5IR1B 3ULSB 1NBYA 1CFNA 1V3MA 1XF3A 2GJ6D 3KXFE 5EOTA 3IAQA 3MUZ1 1NFDE 1PKQB 2AP2A 3TF7C 2VLMD 1IMHC 3VWKB 2CIKA 4JEGB 1PG7H 3FB8A 2BNQD 43C9B 1D9KA 2NXZD 1P5VA 2A74B 1SJEA 3AXLA 3T0AA 2AJYL 3VFUA 3KXFA 3BIKA 1NFDA 3DO3A 3LEVH 3HG1A 4U1NA 1K2DB 5EOQH 3JV4A 4FN0A 1G9ML 5EU5B 3ARDC 5IF0A 2VDMH 1N8ZA 3O3AA 3NGBC 5DA4A 2R0WH 3RWHB 4HFWB 1YMMD 5F9AC 2CKNA 3BSZH 3HR6A 3VXRE 1P4IL 2V2TA 5D72H 1XGQA 3MNZB 4JAMA 4NQEB 1QD0A 1QRKA 4J8RA 3C08L 3RU8H 3MLWH 2ATPB 3MV7B 3NIGF 5DR5H 5ID1A 4MAUL 3ZDXE 1YPZE 3UCRA 1S7TA 1RJLB 2W9EH 2YZ1A 4OGXH 4OZIA 4UIKH 4K7FB 1FAIH 1S7XA 3L5HA 3RPIB 1X5LA 1AIFB 5SV4A 4YR6A 2DQHH 3O3BB 1VA9A 4CJ0A 3T0VA 1A6TB 2ADJA 4JGMA 4OUOA 1QSFD 5E8NB 2AK4B 5C0EB 1IM9D 4KROC 3DUHA 3ZKSD 4YAQA 4K3EH 5LQBH 2FH6A 5HDBE 1I1CA 2AABH 1MQKH 1T89A 3BQUD 4OCYL 3SDAA 3IDGB 3NN8B 3OB0H 1ZLWH 5L6YH 4NT6A 5A2LH 4PGBB 1IZKA 4HQQL 4XP5H 1BFOB 3T3ME 1U3ZA 1KCVH 2IQ9H 2FIKA 4JN1L 1A6WH 2R0KL 3V4PL 4L1HA 2Z8RA 4MCYB 1SEBB 5ITFA 1DTUA 1BJ8A 1U92B 5IW1B 3QPQC 3TZVD 4BQ9A 3CLEL 4IIQB 3RNQB 3A0OA 3T0EA 1ZGLA 3HZMA 1BQSA 4HPYH 3RRQA 1A3RH 3KLDA 3V4VL 3EJJX 1J0ZA 1LQSR 2B0SH 5C0IA 1TDQA 1AGEA 1GGYA 3IFNL 4P9HH 4RFEB 5EH1A 5HI4D 4Q9RL 1I3RB 5HYJE 5C09E 5DMKA 2DRUA 3DNKA 4KI5D 1NGPL 2HFFA 2IH1A 4KGLA 4E42A 5ITBH 5F1NB 5ID0A 1K5NA 2EE3A 4P59L 5MHSE 4DQOH 1BD2E 5DSCA 5T1MB 1MH5B 3UTSD 1KBGL 3TLRA 2BY2A 4PJ9B 1BIHA 4NKDA 4XBEH 4LIQH 3QEQE 3GKWL 3EO9H 3FFCA 2KPNA 2R0ZH 4Z7UE 1QEWA 3TCXA 1E4WL 3DXAE 4P5MA 1JNNL 2Y5TA 4HJ0C 1IC4H 4MA8H 1QLFB 3FOLA 1TXKA 3RA7H 3QEQA 1LO4H 4OM0L 3K2UH 1F4YH 1ZT1B 5EIIA 1PAMA 1WZKA 4N0CD 4WIQA 5EOCH 1QG3A 3PDGA 2NX5D 5I16A 1LEIA 2J88H 1DBML 5DMGC 4KZEH 2BNRB 2ESVD 1FC1A 3T3PE 2XACC 5JW3H 2RAMA 2V17L 4WFFE 4DWHA 2VL5A 5BS0E 1MF2H 5J8OA 5GGVH 3T0DA 4PP2B 3HS0A 3B5HA 3GIVB 3NCBB 3G5XA 1RJYA 4WEUD 1XZ0B 2NNAA 5HHXH 3QJFB 4RZCA 5JZ7C 5J12B 1Y6NR 3QEGL 1M71A 3NFPB 3E8UL 3C87A 3G6JA 1G6RH 3SJVB 3O6FC 3WD5H 1S9WB 3MLUH 1CLCA 1JNLL 3ZTNL 4L3EE 1N4XL 1QYGH 4J3OC 4MA3A 5FYLE 5C0NC 1JWUB 1R5VA 4EOWH 3S96B 4JHAH 4G80A 5HVWA 3LN4A 3QUYD 1EH9A 4Y16B 1RSFA 1DQLH 3SE9L 2VDPH 3CPLB 2OZ4H 4FQLL 3PWLB 4WEBL 4WFEE 4Y19D 5D7JD 3WFZA 3HRZB 5BO1L 1IARB 2GK0B 3CUPB 3FQXA 5GHWL 1LO0L 4QXTB 2NY2C 5FM8A 5J57B 5ERWB 2OSLB 4UMGA 2H3NB 1CXLA 2D7OA 5DI8A 4X4ZA 5LXGH 1QFUH 1X5GA 2VDLL 3N1FC 1QRNB 3ET9F 2YC1B 2VZVA 4OFVA 2BVQB 5C6PB 4XNMA 4MXQD 4OBSA 3FO0L 3OR7A 4HK0A 2F53D 4PV8A 4U2YA 1J8HE 1A02N 3HUJB 4G7YL 1SVZA 5CKGA 1L7IL 5EUOB 1PVHA 4XT1C 4IMLA 3PWVB 3D2UB 5T1KA 3EKCA 5EA0L 1MHHB 3LD8B 3MLXL 2CKBA 1OP5K 5E2WH 5JW5B 1J8HA 4OCRH 2BOCB 3NPSB 2PW2B 3BE1H 4A6YL 3VMPA 1DEDA 1FNLA 3TH2T 4Y1AD 4FFWC 1HQ4B 3SDCC 4H1LH 3S5LG 5CEXB 1QVOA 4XAWL 3UXFA 3PV6B 4KY1H 3IXTA 2M1KA 3QUMB 3EYVA 3QDGB 5B22A 4GXUN 1AGBB 1RUAH 5DD1L 4WV1C 2C3GA 4Y4FA 2WW8A 4XP6H 5J3HC 3K4ZA 3WHE1 3WSQL 4ORGA 4S10A 1F4WH 2X6MA 4EBQL 8FABA 5KSUB 1D5ZB 1JHTA 3ZE0F 2F8VA 4JRYD 3KAAA 3GNMH 5GS1A 1NLBL 4WFGE 1A7PL 1MFNA 5IQ7L 5FO8A 4HS6B 4P2QD 3SOBL 4G8FA 5CGMA 2BRRL 3QULB 1GOFA 1AKJA 5D2NB 3SY0B 4X5XB 4PRBA 4L8CB 4YUEH 2FJFB 4G9FA 2AGJL 4W6YB 4YHOH 1BQLH 2VIRB 2O5XL 3QIWC 4RAUA 4GKNB 5IFAL 4JDTL 3W82A 1NH6A 3S34H 3VGBA 2YPKB 1BFSA 2F74B 1LEGB 2VYRE 5GGTL 1NC4D 4M7JH 3V6FB 2PTUA 2BSTB 1QR4A 2YN3A 3IFPA 3BH9B 3FN0H 3CZFA 1A7QH 3GMMA 3DX7B 5J6HA 2F54E 5DVLA 3IKCA 1F3DJ 1U8MB 1KN4H 4OV6F 1MJ7L 4U7KA 3VXNB 5C1MB 4FMFA 4X5LA 4X6BA 3QXAA 4XNUL 4YIQB 4P4KA 4PR5A 4P9ML 1F90L 4ODUB 3MROB 2FH8A 5DHVA 3RVXD 3TBWA 1D6VH 4G43B 1ZTXL 4F3FB 3OKNA 3QCTL 4Y5XC 3WN5B 5E99H 1V7MH 1EIBA 3PHQA 1I1AA 1WWCA 1NCBL 5IB3A 5E5MB 2B4CC 4LLUB 2OP4H 2ADFL 4NYLA 1UKSA 1QBAA 2YD8A 5IQ9B 2V5YA 4MNGE 3WEXA 2PETA 4HX1B 4JJ5A 5GS3A 3CXDL 4PJ7F 1NCDL 3PDOA 4AEHL 3SCMC 1T20A 2VN4A 3OR6B 5GZNC 3H42L 5DO2C 1JWSA 2XA8L 4U6YB 4JFHD 4KROD 4W4OC 1OSZA 5C6TH 4NC2B 2BC4B 3BRDA 1KJ2L 4ZFGL 1DQMH 4PBXA 2B20A 1ZHKB 4R4BA 4JFDD 5IJVB 4KTEL 4ZFZA 5GJTH 1D5BB 3IDJA 1R24B 1MLBA 3P4LA 2FATL 4M5ZH 4ZUTB 3TPUB 4FXGA 1T03H 5FM5M 2GT9A 1QUNA 1DBBH 4WGWB 3MJ6A 4G7VL 2DQEH 3W2DH 5BV7L 1WAAA 1U8LA 1ZKAA 5IP4A 3FN9A 1Q94B 1A14H 1U8IB 2CSPA 1DVFA 3GRWA 3QDMD 3SKJH 4EQ3A 4NZJA 2NY6B 2P8LA 5BVJB 4R4NC 1AR1C 1KLUA 2CUMA 3EOAB 3NAAH 4HJGB 4B5EA 4KGJA 2BOBA 1GCFA 1BVLA 3TBVB 1ZANL 4RMUA 5IM7B 4IRSD 4HH8A 4MJ2A 3RNKB 3OJDB 2VRAA 3RX8A 1PG7W 5J89A 5FGCB 1BIIA 1R3IL 5CP3A 2VXSH 5FUZH 2OTWA 3C5ZA 2R2EB 4LGPB 2O5ZH 5D7IA 3F5WA 3OJVC 4EI5A 5HPMA 2VXTL 4F9PC 1MOEA 3TWCH 2HN7A 4MJIA 3CXHK 4N68A 1RJZB 2WSKA 3ARYA 2BHZA 2IANE 3MPCA 3P0VH 4LNVA 4R3SA 3T8XA 3FAWA 5C08E 1U8PA 1I9IH 1IC7L 4OTXL 1MI5B 2OS7A 4ZS6C 1WTLA 1MAKA 1KCLA 1M7IA 3EDEA 3WIHA 1ZA3A 3ARUA 5C70A 4K3DH 4P5TC 5F9OH 1P1ZA 5DT1L 1NMAH 3UYPA 3DO7A 2H2PC 3BWAA 5E4IA 5C08A 2ZSWB 1RVFH 3AC0A 4C56E 3MJ9L 4KUZL 1QBLH 2J1KA 2G2RB 3IU4H 5F8QC 4UT6H 4CADA 5KSBF 4MNHB 1J7VR 2A9NL 4NNXA 1EAJA 3MGOA 3BGMA 5D5MF 3HC3H 4OD3H 4C56A 1UYWH 5E1AB 3MJ9A 4L4TA 1TZGH 2EDTA 5F96H 4JFQB 3CFJB 4D8PA 3L5WB 4Z7NE 1T0NB 3RGVD 4S2SB 3ARFA 3C60D 3QIUB 2GW5A 5FOJA 5HPOA 4YFDB 4N9GB 5IMLA 3A6OA 3O6FD 4PRIE 3F7PC 3MX0A 2NTSP 5E6IB 3QWRD 4X6DF 1P6FA 4JN2A 1FL3B 1FPTH 5C0ND 2AJVH 1I8IA 3EOBA 4OCXL 2AEIT 1MNUH 1S7WA 4I4WB 2FNBA 2NXYC 4HFUL 4Y4KA 3RY6C 4RAVA 1KLFA 1RQ5A 3VG9B 1MJ8H 2WUBH 4C55A 3PWPB 5EU6E 2DMKA 4S1SL 3T0WA 4HJJH 2UY6A 4MSWA 1I3GH 5CJOL 4P0DA 4EUPA 4KV5E 1DQDH 1KXVC 3QWOA 4N90D 1RUKH 1NEZA 4LSQL 4F15B 5SWSB 5DEZA 3BJLA 4KVCH 3N9GH 4BFBD 2QADC 1NBYB 1CFNB 1XF3B 2HLAA 3BKCL 4H8WL 5LKNA 1CGSH 1IL1B 3D39A 2E7LC 2W07A 3IDXH 3MV9A 4MA7L 2CIKB 4ODSH 1T0MA 4NNYA 4TUJA 3FB8B 1D9KB 4I3GA 3AB0B 4U1LA 1TZIB 4KTDL 3OXSA 3VFUB 1SBSL 3KXFB 2BMKA 3BIKB 1NFDB 4U1NB 3HG1B 4HT1L 3JV4B 1U0QA 2I5YL 5IF0B 2YS4A 4F7EA 2PYEE 1I9RH 3O3AB 3LAFA 1WC7A 1AE6H 5F1OB 4HC1H 3HR5A 3PJSA 1XGQB 4JAMB 3QUZD 4X8XA 4J8RB 3M1BA 2IAMC 2MMXA 1IGCH 3UYOD 4F57H 3HNTL 1BGXH 1OQOA 4OZIB 3GHEH 1S7XB 1X5FA 4V2BA 4YR6B 5GJSH 2YMXH 2C26A 1I9JL 2JB5L 3D85A 4GKZB 2DQFA 3SBWC 1CK0H 2ADJB 5HDQH 1ZOXA 1CICA 1A5FL 4PP1C 5KVGH 4M6OL 4YAQB 2IH3A 4XNZB 3DYOA 5FXCH 2AAVA 2D7TH 4MDJA 1VB9A 1F6LL 2IWGA 4NT6B 3BKYH 3KJ6H 2WBJA 1KYOK 5CLWA 2WIMA 4NBYB 3F8UB 1Z5LA 1QNZH 1FZKA 1F02I 3L5JA 4NQUA 2EO9A 2FIKB 3O8XB 4FFZL 4MQXD 4XPTH 1HWGB 3R0NA 4LASH 1TJGH 1ONQA 1VERA 5ITFB 4OFDA 3KPMB 5K9JL 1I8LC 1KB9K 4O2FA 3IXAA 1I3UA 3BP7A 3BH8A 4K8RC 5IVXE 3L3GA 4PJ8A 4GQ9H 2D7MA 3RKDD 3T0EB 4GRLD 1ZGLB 1MFEH 5KOMC 2HFEA 2Y1VA 3TIDB 2BVOB 3EOTH 4AENA 1W8NA 4LVOC 5C0IB 5TE4L 1CFSA 4IRJC 1SY6A 4I18A 1AGEB 4NWUH 2VXUH 4MGXA 4KJQD 4RX4D 3ZDZF 5DMKB 2ZCHH 1CF8H 4UQ3A 3LEXA 4XWOC 2HFFB 2IH1B 1FYTA 3Q3GA 4KKLC 1K5NB 2X9YA 5DSCB 3NCYS 3KS0H 1QP1A 3H9SE 3KPRE 2CLVA 5F88A 4NKDB 1G9NL 4Q6IC 3ZHLA 2HJFA 3FFCB 1CR9L 5E8DH 1QEWB 1P4LB 5FHBH 4ZO8A 3IDUA 4P5MB 4N8PA 2Y5TB 4PD4K 1CGUA 5L8LB 1UZ8A 3H3BC 4GG6B 3H9SA 3KPRA 2GJ6E 4PRHB 4JFFD 3SCMD 1A64A 5DO2D 1YA5A 4JZJC 4HSQA 2VLME 1JYWA 1TVHA 5EC1A 5EIIB 2GIYA 3B9KC 2J8UE 5I16B 4NQCD 5CINH 3UYRH 5AYUL 5F3HB 4KKAC 3VXUE 5B8CB 2BZDA 3V0WL 2VL5B 2EZ0C 4JHBA 4JR9L 3ARWA 2DOCA 2BNQA 2MQ0A 1OP3K 2J8UA 2GTWA 1FO0A 1YMME 1EV2E 4WWKC 1JRHH 4ODBD 4JGJA 2NY1D 2QKIB 1KEGL 1J1XH 5CJXC 3NIDF 1PX3A 2NNAB 3CC5A 2XQYG 2QQNL 1DLFL 3ULUD 4WHCA 1YEJL 4RZCB 5F97E 3IETA 1YMMA 4G6AD 1M71B 3V52H 5E2UL 3G6JB 5C3TA 2VO5A 1KENL 3H9HA 1IFHH 2J6EL 4LEOA 3NPZB 4NQSA 1FSKB 1F3RB 3O6LH 1T2JA 1C5CL 2OXGA 3SQOL 5J9PA 2W60A 4ELKA 4L5FL 1R5VB 4PGDA 4YXLL 3ZE1F 4G80B 4G8GD 1QSFE 1OAZL 4NFCA 2P24A 2HWZH 3RDTD 2R39A 3LN4B 2Y07H 2VXVH 2DL2A 3HZYB 3UC0L 4UV4H 5DRWA 1MQ8A 3BEWA 3X17A 4PJDB 3RVVC 5T1LD 1HKLH 1QSFA 3H9ZA 4OV5A 1IM9A 1DUZA 3RWFB 3FQXB 1EEZA 3G9AB 4ZTOH 1A4JA 1RIVL 3O9WA 1P5UA 1NEZG 3HE7C 2DMCA 4QXGH 4JM2C 5IJKC 4TUKL 3WNMA 4ELME 2BY0A 3BQUA 2R29H 3U7YH 4OGAD 2EC9U 4ZS6D 3AU1A 1II4E 5D4QA 4XNMB 1BMGA 4P5TD 1SVCP 2AJUL 3FO2A 1AQKL 4XTRD 4H0HB 4HDIA 1VFOA 1FVDA 4I77L 4HUNB 4NKIL 2QQKL 3JVGA 3BIBX 4IMLB 3MRJA 4R7DA 5T1KB 3NTCH 3GSRA 1EK3A 3VFGL 3TZVA 3GO1H 3VA6A 2CKBB 1UCBL 1FQ9C 3QRGH 4Y2DC 2UWEE 4AM0B 2PO6C 4F7CA 3FQNA 4PJHE 3ILQC 2O61B 5CD5C 4XVSL 1LILA 4KUCD 1OGTA 1V05A 3HB3D 3HC0A 2VDOL 2VDRH 4CUCA 3UTZB 1QKZH 4LQ1A 4LCIL 1QLRA 3QCUL 5HGAA 3I75A 1S5IL 4AH2A 3UO1H 3C2AH 1OAXL 4X0KA 1QVOB 3S37X 2NCMA 5DRNA 3O2DH 4PJGA 5FHAH 3IXTB 3MR9A 3EYVB 3KYKL 5AWNL 5KS9F 3MLRH 4J2XA 3Q5OA 4S0SD 3T2NL 4Y4FB 3UTSA 2Y36H 4I3SH 1VSCA 3C8KA 3EAKA 4F80A 4FQXD 8FABB 2IPKA 1JHTB 1WFOA 3V4UL 5JPNA 2A2QT 5GS1B 2VDKH 5FO9A 2DQJH 3ZSTA 4LSUL 4TSCL 2VKXA 4JKPL 2IALA 4MXVE 1CE6B 3JWNC 1VEMA 4G8FB 5KAQF 5F70A 4JVUA 4J4PD 3LQMA 2D9QB 2YUVA 3L9RA 2NX5A 1A1OA 2I60H 2VQTA 4PRBB 5TE7L 5ALCL 2ESVA 4G9FB 5DJZA 1EMTH 3VRLF 1MAMH 4K7PX 5MERA 1MFAH 4NUGH 2ZCLL 3LKNA 4UILL 3FRPA 1BHGA 5HI3C 4Z5RA 1T2XA 1UWGH 2NY5L 5H94A 3BAEL 3CLFH 2QADD 3S37H 1EBAA 4UU9A 5GS0C 3LHPH 1UM4L 2CRIA 5MENE 3IFPB 5D1XD 4RGND 3CZFB 5DVMA 2ZP0T 2IF7A 2GSGB 2P5WB 2BFVL 3HPLA 3IKCB 5K9QI 4IDLA 1JGLL 4GFTB 3VXPA 4QGTA 2XQBH 5JHDB 3BFOA 1T7XA 4RIRA 1PDKA 4X6BB 4Y19E 3QXAB 3Q1SH 3VGFA 1OAKH 4P4KB 4PR5B 4U0RB 4KQ4L 3QUYA 1AGDA 3TBWB 5CEZE 2NY3D 5I8KL 3BGFC 2W1NA 3LY6A 1RIUH 1CLYL 1OP5H 1WQVT 3OKNB 2XI9A 4PJIF 5A3ID 4M1DL 5D7JA 3MOBL 1I1AB 3PHQB 1VGEH 5IB3B 1EERB 2MPAL 3GI9L 4BZ1H 1NBQA 4K7PH 3F65A 3ESVF 4NYLB 4YDKH 1DQTA 3C6LB 3I85A 3PDOB 1QACA 4ZOEA 2CLZB 4K2UL 4WUKL 1T20B 1KXQE 3B9VA 4XPHH 3M8OL 1ODAA 1OSZB 4UINH 4KHTL 5H2BB 1S7SA 7FABH 3GBLA 1X5IA 2WV3A 4R4BB 1NBVL 3NZHL 2F53A 4ZFZB 4KI1A 3IDJB 3LRGA 1MLBB 3SGDI 4LLMA 4D0BA 1KJMA 5L9DL 4BSVA 4ZG1A 2R0LL 1W0YT 5F7WC 1A9EA 2GT9B 3PP4L 4Y1AE 1F58H 1KJ2B 2HMIC 3U6RB 1RZ7H 4J7RA 2VDNH 5IMOB 2LV4A 1U8LB 1TTGA 3RUGA 4ZO7A 1BBJA 5C0JA 3IVKA 2NY0C 1DVFB 2CH8A 1SJXA 3QFDA 4N1HB 2VZUA 3ULVF 3EFFA 1JP5A 4UOW0 4YHZL 1GHFH 4Y1AA 1MREL 3CSGA 1KJ3H 4P4RA 4YZFF 3WNNA 5EORH 5A16A 1KC5L 5BV7B 1A22B 2BOBB 5T3XD 1BVLB 2OL3A 3NABL 4X6FA 3ARBB 2X89D 1UACH 2AEQH 5IKCB 3ZT7A 4IMKC 5T5FL 1QPXA 1BIIB 3QDJD 5AEAA 4U1SA 2YXMA 3FFDB 2OTWB 3P0GB 1IAOA 2LABA 4NHUA 5D7IB 4EI5B 5HVHB 3IF1A 3W0WD 5HPMB 4JRYA 4MVBD 2IMMA 2HN7B 4YDLC 4MJIB 1U42A 4Y5YB 3L5IA 4LRNL 4G8EA 4MAUH 4P2QA 3ARGC 1SM3L 2ATKA 4MNQD 4R3SB 2BDNL 5EIVA 4WY7H 4NBZB 1ADQL 2MKWA 4D9RD 3VGAB 3MNWA 1U9KA 1M7IB 4DOHB 3JWDH 1CL7L 1P1ZB 3DO7B 3BWAB 4PJXA 5C08B 2AI0L 4LSPL 2ZUUA 5IBTL 4E0RA 1DQJA 1XT5A 1QFWI 3EJZD 1NC4A 4KKAD 4CADB 2X9XA 3BESR 3X13A 4NNXB 3TBTA 3MUGA 3PIQA 4ZODA 3OAZK 2WBKA 3CVHA 3MGOB 4M7LL 3BGMB 4JO4H 4M6MH 5DHXB 3U83A 1G84A 3TT3L 4HXBL 4JN1H 4L4TB 3WO4C 2R0KH 3ILPA 2XTJB 2NW2A 3D18A 4D8PB 4AQOA 1OTTC 4X9HA 5CCKH 2QBWA 2N4IA 1MAJA 5I74C 3ARFB 3F7VA 3CLEH 5IMLB 4RFOL 1CFQB 1MRFL 4LLQB 4YWGL 4LLDA 5GRWA 3IDMA 3BP6A 3I6GA 1PYWB 2YPVL 5BOZG 3V4VH 4B53A 5IB4A 3EOBB 3TCLA 1U91A 4JFHE 4PUBL 4PJEA 5KVEL 4Y4KB 1KB5L 1RK0A 5JXEC 3WS6C 4JFDE 2DBLH 2ORBH 4O02H 4ZFOL 3RVVD 4OB5L 4PJ5E 3RBSA 3TVMC 3HUJF 3S9DB 3KR3L 4P59H 1E4KC 4MSWB 4OZGA 2APTA 1KBGH 4HBCH 4JFDA 3SO3C 1AXSA 3GKWH 3VD9A 2Y9RT 3FRPG 1NEZB 5IHZB 3KLHC 4PS4H 1JNNH 5AYQA 3T77A 3ZL4L 1BZ7A 3M07A 2FJHA 2HLAB 1MCPL 1KPRA 1T1WA 4ISVA 4XMLL 2DD8H 3UTOA 5GRJL 3D39B 2Z31D 4Z7QE 3QDMA 4KKCD 3MV9B 1DBMH 4GLRH 5T33L 4NNYB 1YJDL 1J12A 1FYHB 1IGTA 1XGUA 3CH1A 2V17H 3OXSB 3DX9A 4Y2DD 2BMKB 4APQD 5CJ5A 4HHAA 3DECA 3SKOA 4IRSA 3HE6C 3ILQD 2J8HA 2HRPL 3FB5B 5C0CE 1WC7B 3VRIB 5EPMA 3KYAA 5F7DB 1FAKT 3C5SA 3QHFL 3HR5B 4N5UA 1IKNC 3PJSB 3QEGH 1DSFL 4LPWA 3FN3A 3E8UH 4XVUD 3CDCA 5D93C 2XN9D 4UDTA 3UP1A 4XHJD 1JNLH 3ZTNH 1N4XH 3DOSA 4ZUSA 1KTKE 3QG6A 1EEYA 4M03A 1D6EA 5BVPL 5FYLL 4YHLL 5E6YA 3D85B 5JHLH 1MCDA 3RIAK 2DQFB 2Z91A 5C0AD 4M4PA 2FJGA 1CICB 5MI0C 2EXYD 4BFGA 1HHGA 5TE6H 3SE9H 4FQLH 1C12A 2IH3B 4HGWA 5D6DA 1M6OA 1DL7H 2GY5A 4OCSL 2WLZA 4Z7VF 1CDCA 4MDJB 2YD7A 3P4MA 4OQTL 4QHMA 4X6CE 4OM1H 4E9LA 3WLWC 3VD4A 4UTBL 5T3ZL 4OI8A 5DUPL 4K94C 4NZUL 2WBJB 3KPSD 3PWUA 3X3GL 1FZKB 2VDLH 3EYUL 4Y5VC 3C6SA 5JW4Q 1P84K 3QRFM 1HDMB 1ORSA 3ARZA 4U49A 3LIZL 1ONQB 3UTTD 5AG8A 5BRZD 2B7DT 1CXIA 1HZHL 4KJWD 4Y4HD 4U6VL 4N8VG 1X4XA 1R5IB 3BP7B 3BH8B 1L7IH 4PJ8B 1FGNH 3RGVA 5DYOA 2F5BL 2VLKD 3VWKD 1EFQA 5LG1A 2HFEB 3MLXH 4AENB 4Z0BL 1T83A 3VFPB 3O6FA 2NLJB 3PABA 4FQQA 4JANA 1CFSB 4OZHE 4I18B 1B4JL 4FZEL 4A6YH 1KT2A 3MRGA 3O3UN 1O0VA 4OCWL 5C7XL 1KLGA 5L2KD 2E5EA 2YD2A 2W92A 3K1DA 4XZUA 4UQ3B 2B2XH 4OF5A 3LEXB 3D1MC 2CDEA 5CGYC 1FYTB 3Q3GB 1BEYL 4XAWH 1LO2L 4KC3B 3TJHD 4LSRL 4NQED 5TPWL 2P48B 4N90E 3RTQC 1U2HA 4HLJA 2HJFB 5DD1H 3SE3C 3D87B 4PGZA 5FYKL 3WSQH 3BPNB 4JQIL 1OT2A 1UZ8B 3PV7A 4OD1L 1QSEE 1JWMA 1RURH 2EICA 4IOIA 1FNSH 1NLBH 5EC1B 5JOEA 3OKLA 4S1QH 4UOJA 1XMWA 4UZGA 4GAFB 4HIXH 5I66A 2R9HC 4X7SL 15C8H 2HG5B 3QI9B 4UAOB 1RV6X 4NZTL 3KG5A 2R1XA 4OUUB 1PFCA 5EC2A 1RU9H 3NIFE 2BNQB 2J8UB 2GTWB 1HOCA 3C5JA 1FO0B 2O5XH 1JF1A 4WRLA 3I6LD 4NM4L 3MRPA 3E1F1 2BJMH 3RI5F 1YY8A 3CC5B 4MDIA 3EOYG 3UPCA 3IETB 5GGTH 1YMMB 1EHAA 3SDCA 4BZ2L 2CQVA 4KQ3H 2P44B 3O2VH 1RUPL 1HK6A 4XI5C 4H25A 3GB7A 3H9HB 4PY7A 2C3HA 4LEOB 3QUZA 1OAYH 3GJFK 4M9OA 5EWIL 3VWJC 1ACZA 2W60B 4ELKB 2ENSA 3OKMA 4PGDB 1CI5A 4C54A 4EI6A 4G6JL 2P24B 5L8KB 3RIAF 1MJ7H 3SGEI 3ROLB 3JTTB 4O4YL 4B0MM 5J13C 1D5IL 5DRWB 4P9MH 1F90H 2W9LA 3BEWB 4UT7H 3WFEL 4AEIL 3QIBB 1MCSA 4K3JL 4L4VD 1QSFB 4BQ8A 4EEEA 4OV5B 3WV0A 1IM9B 1DUZB 1ZTXH 1EEZB 4KK9C 3AREB 1A4JB 3FO1A 3MODH 3O9WB 3QCTH 4W4NA 1T7WA 1YEDB 1H9VA 2FEEL 4YBLC 4GAYA 1T1ZA 4CMHC 4FP8H 1NCBH 3ARGD 3U7WL 3WJLC 1HXYA 3BQUB 2R4RL 4DEPC 1JHLL 2ADFH 1XIWC 4QRTB 5E08L 3AU1B 3CFCL 4K23H 2LFGA 3CXDH 3ABZA 1NCDH 3TBYA 3FO2B 3MV11 1YUHA 4GKOA 4HDIB 3H42H 2XA8H 4C59B 2GCYA 2FB4H 3BUTA 1VFUA 1FVDB 4A2LA 2DLFL 1IEHA 2CD0A 5HHOD 4R7DB 3MRJB 3GSRB 3OPZL 3MLYH 1C5DA 3TZVB 3RX5A 4GAJH 1LE5A 4MAYB 4OJFL 4RMQA 2HKHH 4LVNB 4F7CB 3FQNB 3GSNA 4GRLA 4G7VH 2OM5A 3B2VL 5FF6A 1OGTB 3HC0B 1NMBL 3MLVH 4NCC1 1QLRB 3VXQA 5HGAB 2NR6C 3VXMB 4AH2B 3UDWA 4CU7A 4YFEA 4X0KB 2EKSA 4RX4A 5DRNB 4PJGB 5DC4B 1CDGA 1GPOL 2ADGA 2G75A 3GMQB 2B4CL 3MR9B 1Z3GL 1OP3H 1ZANH 2ZKHL 2RR3A 1A1MB 3UTSB 1FE8L 2W91A 4RGMB 3C8KB 3JTSA 2XZQH 2IPKB 3RZCC 2DM4A 3WHXB 2R8SH 5JPNB 1LHZA 5FO9B 1JF6A 3JWOC 1KACB 4NQCE 5I1GL 2IALB 2VXTH 4JFFA 3SCMA 1U3JA 1X5XA 2Q3ZA 4GRWB 1KCRL 1YNTA 1IEAB 2DKSA 3L9RB 3DRQA 1HKFA 3VXTA 2NX5B 1A1OB 2QHRH 4NQCA 5D1ZB 1A7RL 4NC0B 2ESVB 4QRRE 5IWLA 5DJZB 1NFDF 5MERB 5I18H 1IC7H 4PJ7E 3LKNB 3O6KH 3ULUE 3LH2H 2X2YA 1QRND 3GBNL 6CGTA 2YPLD 35C8L 4HKXA 3D3VD 3OG4B 1MJUH 1YEFL 2EIZB 2JIXD 4U1MA 4LEXH 4H20H 2IFFL 1RAMA 3OJ2C 4RRPA 5FUOH 4KUZH 4LU5L 2A9NH 2Z35A 5AAWA 32C2A 3HPLB 3I3EA 4OZIF 4Q0XL 3QUXD 1RPQA 1FN4A 3HE6D 1YNKL 3BDBA 5DURD 1ZSDA 5I1HL 2AQ2A 5D8JH 4RIRB 2GTZA 4JFZL 3DTXA 4G8GA 1WK0A 3ZKQD 3R8BB 3RDTA 1AGDB 4YC2C 2GFBA 3JV6A 3VFWA 3WIFA 4L29A 1FCCA 1MCKA 4JY5L 5H37H 3RAJH 3P0YH 5T1LA 3DPBA 1C1EL 4WNQA 1KULA 1A3LL 1W72H 4MA1B 3MC0A 4N0UA 2N7BA 4HXAL 1JE6A 4LDEB 5HDBF 1CZ8H 3IGAA 3LDBB 4OCXH 1LDSA 3S98A 5DVKA 2CGRL 4R4FH 4TPRH 3VI4E 2FBJL 2YUWA 4LP5A 2FO1A 3BD3A 5B39A 4ZUUA 3UPAA 1S7SB 4P5TA 2VLJD 3T3MF 2H26B 3WFBL 1HWHB 1RZKH 4CGTA 2F53B 1TTFA 1MRCL 5IUSA 5F7HA 3JWDC 4LLMB 3KPQA 4D0BB 5CJOH 1KJMB 4F33B 3EGSA 4BSVB 1HQRA 5EZJA 2YA2A 1T1YA 2F58H