4Z7WB

T316 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
187
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 180
sequence length 187
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7wB01
1F6AB 3EZJB 4R4BB 4F3FB 2IQ9H 2D7OA 3FTGB 1XR9B 5IG7B 1O7VA 3OR7B 2F54E 4I0PC 1CFSA 3QP3A 3ECBB 3NFNB 4O02L 3KXFA 5EULV 1VADB 3C6LD 4F15B 5JUEH 3KPMA 2Y36L 3SOBL 4EDWH 4H0GA 4J7RA 1UM6L 4LLYB 3D5OF 4DK6A 2HT4C 4H26A 2IANB 3QUYC 4WFGE 4MNQB 1KLUA 5I1IH 5BZWB 4G8GA 4YIQB 3SKOB 3QI9C 3CJJA 2DLTA 1XF3B 3V4UH 1BZ7B 4PV8B 1FGVH 1QRKA 1U8JA 1ZT4B 4ZTPL 3BO8B 3TIDA 4ZYKB 3EW3B 1F3JB 5ACZA 1N0XH 2UY6A 3GSUA 3WFHA 1KCSL 3HI6L 2X70B 5F21B 1FL5B 2VXQL 4G42A 2C4FU 5HDBE 3QUZB 4XCNB 1YMMB 1N8ZB 3T3MF 2HFEB 4WV1B 5JW5A 2JELH 4WW2B 2D7PA 5INCB 4KRNA 4RBPH 3OB0K 4GRWF 3OJDA 3D0VB 4RA3A 2NY3C 2EIZA 5KZCD 4NQUA 2E9IA 3NA9L 4WFHD 4D9QE 3N85H 1EZVX 2V7NA 1BEYH 3HG1D 4U1LB 2A0LC 5FUOH 3GJFK 5E8PA 3EAKA 5JPNA 4WUUA 5DTFB 3B6SB 3X11B 1LK2B 5F7EH 4JFED 3W5MA 4I0KA 2NX5B 5BCAA 1G0XA 3QQ3A 3D48R 3HZVB 4OF6A 5SWSD 3DV6A 8FABB 1CR9H 1TVHB 2HVKA 1IILE 3P0YL 3DUUA 2EDDA 4PR5B 1RZJH 4PY7A 3UTSD 4LCUA 4JRXB 1EERB 4MJ4A 1JPTL 2EEAA 4NC1C 3TN0D 4IOFD 5TE7H 5E08H 4RMRA 4Z7UE 4XWGH 3D2UB 2UUDK 2NYYC 4UT6L 5CMAA 5CJQH 1D5IH 3RL2A 4Y19E 4PJ8B 2QADC 2HLAB 3LQAL 4R4BA 4PJ5E 1B6UA 4ZO7A 2A6KB 5IG7A 1FZOB 3GJEA 4ISVB 4OCSH 5LXGL 2XNAB 2DIJA 4Z5RA 2O5XL 2W07A 5HVHB 4X4ME 4LSVL 1CDCA 3HN3A 4PUBH 4Q6IA 3ULVL 2R4RL 2P1YA 3U9PH 3UBXI 2WQRA 3TESA 2UZIH 3QG6A 4D9LL 5C0DB 3FB6B 2DQCH 1MFAH 5B4MC 1NDGB 2XY1A 5T1MB 3SKOA 1A22B 3QEQB 1A9EB 1DBKH 2OL3H 3TJEL 1BZ7A 1SMOA 43C9A 3VD9A 2BY3A 1VKXA 5GS1C 4K3GA 2DMKA 3B9DA 4EN3B 2PXYA 4F33B 1FORL 1F3JA 5IVZA 5IMLB 5J6GA 1QFWH 4PRHE 3AXLA 4QXUH 1IKNC 3RPIA 1FL5A 3LKNB 4BFBD 4NQDB 5T5FH 3MRBA 3QUZA 4XCNA 1I3RB 2EZ0D 4WV1A 3NH7L 2X4PB 1HOCA 4HJGB 4IMLA 1EBPA 5EA0H 1XIWD 3H42L 4A2MA 4PLOB 1Q94B 3D0VA 3UTPE 4R97B 1QPPA 5GGSA 3PV7A 1Q8MA 1T83A 3I02B 5DZOA 1K5NB 1E4XL 4G6KL 3RAJH 4PJXB 2C3HA 2DWEA 2YUXA 1ZVSA 3U6RA 2QQNL 5T1DL 2R2HA 3LEVH 3MRIA 4H1LH 3VH8G 5E5RB 1E4JA 1L7IH 3GK8H 4QRQA 2ZSVB 3I3DA 4IRSD 5FOBA 1TVHA 3HMXL 3ZKND 2CDGA 4P2RA 1CE6B 1CFTB 3PWVB 2PO6A 4K3JL 3FJTA 2X9YA 1FN4B 1BQUA 4WI8A 4JRXA 4TSCH 5MEOB 1YEGH 4MD5B 1NCCH 2ICEB 4ZAKD 1JV5B 1PEWA 3GNML 5J12B 4P48A 4YZFF 1KPRB 3CX2A 4Z7VE 1DCLA 2VN4A 4APQD 3FOLA 1CCZA 3HA0A 4NKMB 1BD2B 2VKWA 5IR1B 1ZSDA 1NGYB 3FRPA 4TVSa 3VGDA 4KAQL 3Q1SH 2I07B 5BVPH 1EA9C 1FQ9C 1MEXL 4PB0L 4OV5B 4M5ZL 1NCAL 4U6XB 3VFPA 1T5WB 4X7EC 4ZNEE 4J4PC 5C0DA 2QLVB 2EDRA 2HTKD 3RFZC 1MFDL 1NDGA 1I1AA 1XGYL 4PJAF 4QNPE 1YQVH 2H9GA 3QEQA 5C08D 3WS6C 1YEDB 1WAAA 2CLVA 3MV9B 1A6TB 2V5SA 3JWDC 3M45A 5HXMA 1Q1JL 4UV7L 1WCBA 3TVMD 1FZJA 2R23A 3LS5H 2EC9T 4IIQB 1ZANH 4CN1A 2IBBA 5E5UB 3WFZA 1HE7A 2FX8H 1RMFL 1WJ3A 3L3JB 2EDTA 4ETYA 1AFVH 4S2SA 3HC4H 2BERA 2CJUL 1LE9B 1I3RA 3DYPA 4U6HB 2X4PA 4YBHA 5GRUH 2JIXB 5I1HL 3KR3H 3L3GA 5ACMA 4YHOH 4ZUTB 3N1PC 1RIVH 4QRPB 2ID5A 1AE6H 1JGEB 3AM8C 2Y23A 1NEZG 4X7FC 1NFDB 1KEGH 3STZB 5FHAH 2O5YL 4NN5C 3OAUL 2VABB 2R2BA 3DGGB 1U8QA 5F1SA 1VCAA 3D1MC 5IB5A 4RQQB 4H88H 1CFTA 3MPCA 1P1ZA 2DLIA 2VQ1A 3ARED 2AJZB 2VLJD 5FV1L 4YHMH 5T3ZE 1Z9MA 2WLZA 4IIQC 5DVKA 3REVA 1FNFA 1DEEA 4AG4L 4MCZB 4X5WA 4JRYB 5ID1A 3HI1A 2O93L 1ED3B 1NGPH 1TQBC 3OSKA 5CKGA 4P3DB 4G9DA 4WNQB 2GHWB 4UQ2A 1F42A 1A1NB 3RTQB 3G6JB 5D5ME 4Q9RH 5I71C 3VG0H 3RBSA 3VFGH 4G6JH 5J3HD 2NTFA 3PDOB 2Z4QA 4JY6B 2MTPA 5KS9B 4OV5A 5HDQH 4U6XA 4UDUA 1DVFC 4JFQB 5E8NB 3GSNB 4K94C 4EIGB 5L2JB 5I8OL 5SX5H 4C56D 3WDIA 3QAZC 3C08H 3FAXA 2BVTA 3FZUC 3VGGA 3VI3F 5DFTA 1Q0XL 1KJ2B 1YEJL 1BBJB 4LAQH 4L8BA 1E4KA 1HWGB 1NEUA 5F9DC 5KSUB 4LEXL 3MLYL 4ETQA 3F7RA 1RK0A 4P9ML 5D70L 1V7NH 3L3JA 5F1IB 3BN9C 3S7GA 1G7IB 4NKDB 5EBWB 2XV6B 1LE9A 1QBBA 3VWJB 3HNSL 1MWAB 4U6HA 3RUGF 4JR9L 4UIMB 1JMZA 3IAPA 4ZSOB 5H2BB 5IFAL 4QYOB 4Y4HC 5MENB 4ZUTA 3EOYG 4HCRL 1I7TA 3WNNA 5BV7H 4S1SL 2VLKB 4OZFB 3U0PB 2UVEA 3X3FH 1MJ8L 3VXMD 2R0KL 1MFNA 1CGUA 2AEPH 3SBWA 2FSEB 1J8HA 1KUMA 3HI5L 1KBGL 1NFDA 2ATKB 3STZA 3ARBD 3WJLC 1IGTA 3O3DB 1GIGH 2VIRA 2VABA 1KFAH 2VAJA 4UILH 4RISH 3FONB 1QLFB 3DGGA 3CD4A 1B2WH 4ERSL 4RQQA 4NO0B 5TQ2L 1KGCD 1R0AH 4V1DD 3GMQB 4CVUA 2G2RB 2DAVA 4XP6L 1FV1A 3QRFM 3VWKB 4QXWA 3D85A 4EQ2A 2I9LB 2AJZA 2DWDA 4XWOD 5JNYA 5I74B 4LGPB 2P49B 3IETA 1NAMA 1J12A 4MCZA 3TPKA 4JRYA 3QQ4A 1OGTA 3KG5A 4P4RA 5GPRA 2GK0B 4QOKA 3B2VH 4RAVA 3WUWG 1DSFL 4NC0B 1IGIL 3MLRH 2GCYB 3FN9A 3LSOA 2G5BB 1J1PL 1ZLSL 1CXLA 1JHTA 4IMKC 4DQOH 2NY5H 5DJ6A 4UOW1 2CKBB 1MJ7L 4U2ZA 3RI5K 5E8EB 1DL7H 1X7QB 3BIKA 3VCLB 4JY6A 1G6RA 4EUPA 5KS9A 2P42B 2APTA 3PL6B 4WHYH 5C09B 5E8NA 1FNEA 3IJSB 4P2CG 3GSNA 2ZPKH 3X17A 2P8MA 1A3LL 2MCG1 3IU4H 3FT2B 3SDYL 4PG2A 2ZG3A 3BE1L 5SX4H 3SDAA 4HKJB 1PFCA 1BBJA 1I9IL 1T3FA 3G08B 4ELKA 5KSUA 2XWJA 2CDFB 4ZUUB 1B4RA 2OYPA 3IJYA 4WW1B 4NM4L 4NKDA 5T1LB 5IMMA 1X5ZA 3KLHD 1QA9B 3K7UA 1CXEA 4AEIH 4MQXD 4ZXBA 1SJHA 4QXTB 3FB8B 5B38A 4OF5A 2GTWA 4X80L 5DXWA 3ARSA 5SV4A 2NNAA 4G8EA 5L7XL 1FZKA 4N8CL 1I3UA 4TUOA 3SKJH 5MENA 3W5NA 2NQCA 1AXIB 1K8IB 4XP1H 5JHDD 3WCYA 1R3KB 2VLKA 4OLUL 1MQKL 2EYTA 2VDRL 3E3QE 4N0YH 3VA6A 5I1EH 3BPOB 4LLWB 5E8DH 4OAWB 4QRTA 4XH2A 4PRID 4F9LA 1IMHC 5HJ3B 4XXCA 5EPMB 2ATKA 4R2GD 4KZEH 5F7LB 3UBXG 3O2DL 2XTJB 1QSEE 1F6LL 1QLFA 1X5FA 4U1NB 1RZKC 4KDVA 7FABL 1FYTE 4NO0A 4TRPL 3PABB 5EORL 4RZCA 4PJ9D 5J0BA 1UCBL 2X2YA 3DVNB 3EYQD 3VWKA 4JN1H 5F7KC 3KPSD 4XI5D 4LF3A 2EDEA 3RA7H 3MGTB 1WV7T 4DOHE 1NC2D 5IGXL 2VDKL 1S7VB 4LHQB 4C4KO 1CGSH 1QO3A 5ADPH 1ZLUH 2X4NA 1BFOB 1N6VA 4RX4D 2KUTA 1OTUC 5C9KA 1ZTXL 4HBQA 4HUXB 2JF1A 4DN4L 3GKWH 1KLGA 2GCYA 3BSZL 4JQXC 2G5BA 3O6FA 1I8MB 3F7YA 3PQYA 3MV8D 3KWWB 2OI9C 4LHUA 5ADOL 5D7IB 4GUPA 1G9NL 4RAHA 1E6OL 3IKCA 3DMMC 4JAMA 4JO1H 4M7KH 3STLB 5IHZA 2H32A 4KKCC 3VCLA 4U6VH 5HI3C 2BY1A 3OKNB 3PWPD 4DN3H 2F74B 3JTTA 3EOTH 3IJSA 4FQXC 1Y18A 2V2XB 4BK5A 1IC5H 4K2UL 4NRXB 5KZCB 3QDGA 5JMOC 4N0FA 4XCCL 3MNZB 4P9HH 4G9FE 4LPXA 3SQOL 4YWGH 3N1GC 3BW9A 4PRBB 4LCWE 3HG1B 1FO0B 2WM0A 5F97E 4XBEL 4K07A 2WWMD 1RUKL 4JFEB 2CDFA 2GT9B 4OM1L 2YSSB 1INEL 5SWSB 1EO8L 4O2EA 5EZJA 4KXZI 2OJZH 3UJTH 4MQTB 3OKEA 3FB8A 1WISA 5F1NB 2PW2A 5CBAA 1RI8A 3IYLW 5EC1B 3UTSB 2NW2A 4GAGL 4M02A 1UGNA 4M43L 5AZEH 2W59A 5MERB 3S8WA 4ODSL 3VRIA 4CAGA 5I1CL 2HJKA 1GAFL 3QFDA 3QXAB 3S6CA 1JZ6A 2VYRE 4NM8H 1R5IB 1LEIA 3T4YB 3U0TA 4K7PL 4IRJD 1FPTH 3CFDA 3FQTB 3OX8A 3CH8A 4MWFA 3WLBB 4GQ9H 1N6QH 1WZ1H 4J3XA 4R26H 1FNHA 1RHFA 3PABA 5T3ZL 3HMWL 1MPAH 1NJ9B 4WENB 3VFMB 1NAMH 4JFFB 3C6LA 1T4KB 4L1DA 3BH9B 3BKCL 3C5SB 5CJBA 3RWFB 3OB8A 1OAUL 3MNWA 5C8JB 2ZCHH 1NSNL 1S7VA 4OM0H 4ZO8A 4X6EB 3TWCL 3MUGB 3WNOA 3LPGA 3DYOA 5DQ9A 2A6DA 1N5AA 4HXBL 4D2NA 1EAJA 3T8XA 2N4IA 2NY4C 4K3EL 2E27H 4UINL 1G6RH 4EUPH 2UWEA 3KWWA 2ORBL 1EFXD 2HRPH 5EOQH 3GSNH 3UTZA 4DUXA 3HNVL 2FH6A 5JDJA 4OLWH 1NGWB 1KSRA 2VDOL 3GB7A 2F74A 12E8H 3S4SG 1XIWB 3AU1B 5KG9A 3H3PL 1KJ2H 4HWZA 4X7SL 1RHHA 3H7BB 5EU5B 1A21A 4PLJD 4S1RL 4C4KT 3VFWB 1GGCL 2AERT 1RUAL 2X4SB 3P0VH 3TCXA 1RVFH 4JFEA 3K81A 5FA4A 2GT9A 3HS0A 4PGDB 1FDLL 2J5LB 4IRSB 3LEXB 2BVOB 5JO5B 3IDMA 3MRQA 1EEZB 3JXAA 4D0DB 5HDBF 5F1NA 3Q3GA 4AENA 5HYIA 1T1ZA 3IFLL 5DT1H 4JPIB 2MPAH 4KUCF 3UTSA 4MAYC 5EIVA 1WUNT 5JW4N 3TN0A 4FFZH 1HSBA 2FX9H 4NUJB 2IWGA 4ZAKB 5MERA 2OJEB 1BWWA 2VNCA 4HUVA 1DQQA 5DMIL 3ARXA 2FGWL 1A5FL 2I60H 4APQB 3V6OA 4JDTL 1LWRA 2A74B 4PS4L 5L2KD 3GSVB 4RGMB 3RWJA 2R9HC 1GOHA 3VFNB 3DO7B 1MRFH 1UVQA 1KPUA 1W72L 4WFED 1MVUB 3VXQB 3MX0A 4MVBC 5KANG 1JGVL 4PJDE 2IG2L 4JGMA 1T4KA 3BH9A 3C5SA 4QXGH 1S5HB 4BZ1L 1QFUH 5GISL 4FXGA 1JK8A 3QDMD 4FZEL 2IPUK 2ICWJ 3V0WH 3QCTH 5C7XH 1DE4A 4Z7UF 3NPZB 1R5VB 5C86A 3BZFB 4XX1E 3QXUA 4NWTH 1JPSL 3TVMB 2H32H 3FFCA 1H3UA 4GAJL 3MQIA 3PWJB 4YK4B 5ILTL 1JRHH 4D8PB 1QLEL 4HUNB 4ZFGL 4DW2L 4RAUB 3E2HB 2Z35B 3LH2L 3PG2A 5D7SH 5GIRA 3VXSE 2RGSA 3WIFB 3RIAF 5KW9H 1N2RA 3LRHA 4M7LL 3RX7A 2ITDA 1HKFA 5DJDA 5ESQA 4P23A 5AEAA 3AU1A 5MHSE 2DI7A 4WO4B 1N4XH 1RJZA 1YZZA 1I9RH 3H7BA 4X6CE 1LO0L 4G7VL 4L5FH 4R4NC 2D0HA 3QXTA 3DV4A 3NAAH 2NR6D 4X8JB 1S9KC 4NNXB 5FB8A 3MJGX 5FGCB 3QO0A 5EU4B 5FYKD 1IZJA 1T7VA 1P6FA 1PKQE 2AXGB 3GMMB 3BKMH 4NQXB 4KHXL 4PGDA 1HHIA 5IVXB 5GJSL 4HULB 1TITA 3VXPA 1WBYB 4UT7L 5I8EA 3F7VA 4IRSA 2ATPB 2BVOA 4KTEL 4QY8B 3T2PA 1FCGA 4FFWD 1XGRA 1RUMH 4D0DA 4M00A 3TEUA 3WFBH 2BMKB 3FAWA 1L9MA 3G6DH 5I15H 5FYJE 1NCNA 4XBGB 2JJSC 3AREB 1U3HA 5ESVA 1JGUL 3NA4A 2DDQH 1U58B 3RZCB 1ACYL 1DBJH 4XVUD 3BI9X 3SDXE 3P73B 2F53B 1YUHA 4S11A 4DZ8A 1FH5L 2Q8BL 3PWNB 2GITB 4WU7B 3KGRA 4WO4C 3RVTC 4KZDL 4PJIB 4XPFH 4DUWA 1IKFL 2VH5L 5DS8B 3B2UD 1FSKB 5F9JB 5EU7C 3DI2B 1V05A 4K9EL 5GRZA 1FIEA 5L0QB 1MREH 1RZJC 2OS7A 4C56B 2DKMA 2NXYB 5C08A 5SV3A 4W4OA 3RWEB 1Q72H 4YBQC 1QR1B 3MLZH 5ICXB 2W0FB 1KXVC 3G9VA 5CSZA 3UTTB 1EEYB 2P47B 3LN9A 3ZTJH 3QULA 3OB0H 5IQ7L 4D8PA 1CF8H 2YRPA 4CW1A 3VRJA 2IANE 2Z35A 4MNQE 1OSPL 4JCLA 4QHUA 3WIFA 2Y06H 4MDJB 3OL2A 5BOPA 4NCC1 5JDSA 3RZCC 5IVOA 3UDWA 4OFDA 4XNUL 3DVGB 5D7KE 3RQ3A 1TZHA 4FQ1L 5DMGC 4JREC 1FAIL 3JTSB 4WCYH 4UIKL 4NC1E 4YNYB 4ONFL 4RMUA 4MXQD 4QNPF 2MWCA 2W60B 5J9PA 3EYSH 2NY7H 4Y4KD 1KN4L 3MRDB 1D9KC 1CICA 1OB1B 4FQIH 4RRPG 5EU4A 5TFSL 3ARBB 3DHJA 5MEQA 5IFJB 4ONGH 3WJJC 2DQJH 1WBYA 4M8VA 2YD3A 3O6LL 4NWUL 2GK2A 4Z18A 4Z7WA 4QY8A 3VI4E 2B4CL 5F7UA 1EIBA 1ES0A 3STBA 4H20L 2NXYC 4CRPA 1CIDA 4LSPL 4V1DB 3ARDD 2ADIB 2NPLX 2A1WH 2VLJA 3DOSA 2VZTA 1A0QH 5CEXB 1F2QA 2ED7A 2NX5E 1R3JA 1KTDB 1PZUB 1ROWA 3TYGL 3ZDXE 4JANA 2Y07L 4EJ1C 4AEFA 3SGJC 2CDEA 2IAMC 1IEBA 4GKNB 1A7PL 4M62L 1FNGA 3PWNA 1OAQH 1BGXH 4PJBB 4KI1A 1FLRL 4XNZB 3IAQA 4O2FB 4OI9A 15C8L 1J18A 3MV7D 5ALCH 3SE8L 1H3GA 2V2WB 3NIGE 2OP4L 5TDNA 5KVEL 1KCKA 4AYFA 2QSTA 1E6JH 4ZO9A 2BX5A 2V17L 3HZKA 4ZDHB 3TNMA 3H9HB 2D9CA 2F58L 2R29L 4J3SA 5I9QB 3MR9B 2EH8L 1WWCA 2H6PA 4BSVA 2ZSWB 2CO6B 1VA9A 1Z5LB 5EWIL 3S35L 3O3EB 3BDBA 3BGAA 4I18C 2PN5A 5IF0B 5IM7B 2F19L 2I9TA 4GJTB 4LRIC 4NKIL 5GS0C 3BD4A 1OGAB 4Y5XB 3BRGC 5GZOD 2Q8AH 4MD0A 3HZYB 2E9JA 3VXOB 4BH7B 3LDBB 1D5MA 4MDJA 2HFGH 3L5WA 2VISB 4UU9A 5DQDH 3KNBB 4XP4L 5I66B 2GY5A 4WI9A 2P5WD 2VQTA 4GFTB 4HXAL 5BOZG 3KJ6H 2V2TB 2NY2C 1IEAB 3P9LB 3JTSA 1K4CA 1IGCL 5FECA 2HP4A 5JHDB 1ZE3C 1R24B 1SJXA 4YR6B 2W60A 4GAFB 4HC1L 1T2QL 3HUJB 3VXMA 3W2DL 1TETH 3O6ML 1GSMA 4NQDE 1G7QA 4P2QB 3ARBA 4GW1B 2AJYL 5IFJA 4R2GB 1S7TA 4ODHL 1NBVH 4JO4L 4S1QL 5FM5O 2BHUA 4NFCA 4LQFH 5HGGS 4O00A 1JN6B 4K3DH 1BIHA 5JQ6L 4PJ9B 2D4DA 3QB7C 5CJOL 3SJVD 1S7RB 3K2UL 4PJXE 4Y5VA 5F8QC 3LB6C 4RNRA 1FL6B 3MBEA 2BJML 5CEXA 4UT9L 1NC2B 2JB5L 1RZGA 3DSFH 4BSWA 5F6IB 3ULVD 1J1OL 5EBLB 2JJTA 2J88L 1I7UB 1ZLVK 3WNLA 4KDWA 4YGAB 4BH8B 1RZ8B 1M05B 1I1FB 4U0QB 4EDXA 4LVHC 1P7QA 1Z3GH 5CUSH 1QYGH 3U0WL 4XP5L 4JQVC 4ZPTB 4O2FA 2I5YH 1CLZL 3JV5A 1EGJA 3QFJD 2V2WA 5ISZD 3RVUD 3ZKMC 3CU7A 5CIPB 5FF6B 1NCTA 1A7RH 3PWPB 4TPRH 1G0DA 3QH3A 1JPST 1YEFL 4M1GH 1MRCH 1FBIL 2J8UB 2WBJD 1JBJA 4HLJA 3RL1B 3MR9A 4P5MB 3BMVA 3H3KA 3GI9H 2R8SL 2NZ9D 4HUWA 4JPWL 2XQYK 4K23L 2XRAL 3O3EA 1ZEAH 2AV1A 4OIIH 5HHXH 5IM7A 4JPVH 3ELAT 1YYLL 3KJ4B 4Y5XA 1TIUA 3OJMB 1A7NH 4OT1L 5FO9B 3MXWH 3HZYA 2HAZA 5GJTH 5I19L 4GG6E 4Q6IC 2W9LA 4YHKH 1T04A 5I66A 1FJ1B 3UO1H 3MV9E 2ERJB 2N1KA 2HFFA 3WMSA 2V2TA 1RU9H 4P5TD 4PTTB 3VFRB 3P9LA 3TBSB 5INDB 5IKCB 4PB9L 2BNRA 4XC1L 4KRPC 4U2YA 4U0RC 1U8PB 3ILPA 5FO7B 1S78D 2BSRA 1RFDH 1OHQA 2PXYC 3G5ZA 1G6VK 4PRIA 5AUMA 1HK6A 1NUFA 2G60L 1T03H 4HKZA 4PJCE 3OKMB 4IRJB 2D03H 3RDTC 43CAA 1AGCB 3ARPA 3WFCH 2HKFL 3N1QC 4XAKD 2X4UA 3QA3A 5FYJL 3OGCB 1LP9B 3SCMD 2QHRL 5CILH 4KQ4L 4QRPE 4OD2B 5BMFH 5BO1H 1SEBB 5GRVK 5K9OA 4AIXA 3KPSA 4RGNB 3LIZH 1FL6A 3GSWA 3MREA 3HLAA 3RNKB 4EBQH 1KJMA 4PBXA 3REWB 3SO5A 1CQYA 1NC2A 35C8L 5I8CB 2A6JA 5BW7A 1MCPH 3IDGA 1TCRA 2C3XA 3HE7A 4J23A 5IESH 1I7UA 4DZBB 5D7LE 5D1XB 1CU4L 1M7DA 4RX4A 4L3ED 1RZ8A 1M05A 5IMOB 4M6AA 2CK0H 4OLVH 3MV8A 4XTRC 5KSBA 4B41A 5MI0C 1EFXB 1LHZA 4HIXH 2PO6C 2BHZA 3FB7A 4QO1A 3MLWL 4JKPL 3VXRD 4GXVH 1F4WH 2OTWB 2AI0L 4DGVL 2DQUL 5CIPA 1BQLL 2FJHB 3L1OH 1IGFL 1B3JA 3ESVF 4JFHE 1SMAA 4PGEB 4XX1G 4LASH 3DRQA 3GI8L 2DIAA 4M7ZC 5C0IB 3V6BR 3G6JE 5E6YA 5DUPH 2A9ML 5KAQG 2Y7QA 1D5BB 4PJEB 4KHTH 4XXDB 1QBMH 3SDDD 3FQWB 2ZNXA 5D8JH 1JUFB 5AG9A 4RGNC 5CFHA 3TCLB 2Z93A 4NQSB 2ESVE 2Y6SC 3CDYA 2C3GA 3MLSL 1GGTA 3BQUD 1FJ1A 2IH1A 4Y2OA 3THML 3MRPA 4M6OH 5D1XC 4X6BA 1I1AC 2XA8H 5INDA 4OGXH 3L7FA 1RULH 2F9BT 2MCPH 1B9ZA 2XWBA 1QLRB 1U8PA 3GGWB 1JP5A 5GZNC 3OKLB 3D0LA 5DJ0B 1TPXC 2BNUB 4P57A 2ZOKA 2YWYA 3CXHJ 4RFEB 4XBPB 2ZCLH 1NCBH 4PLKD 4QCIA 3T1FB 2X4TB 4AH2B 1MCBA 2P24B 3WHE1 2VDLH 1NFKA 2APVA 1A7BA 3S37L 4R8WL 5FAAA 5TGBB 2F54D 4X9IA 4S1DD 4IS6B 1F2XK 2AS5M 2XQBL 3GMLB 3N1MC 2R0LL 2H26A 1UXSA 3OXSA 5CJXA 4LSTH 3V6ZA 1CFQB 1FFPA 4GMSL 3ARQA 2DJSA 5IROA 2APXA 4WFGD 4XB8A 4OCXL 4P59L 2GJ6B 3RWCB 4WHDA 4KK5C 1F13A 2DJ4A 3EBAA 4NHUA 1A14L 1ITCA 4P46D 2ADFH 3F65A 2X05A 2OR8A 2YPKB 1DLFH 3HAEG 3UP1A 5JXED 4UNUA 1UA6H 4XMPL 1A1OA 4R3SB 1EGJH 5IMOA 1ZHLA 3EYVB 4PBWD 4ZS7L 3HRZA 3IRPX 3O8XD 4QTHB 1U8OB 5GS2D 3CZFB 4CVWA 1YEHL 1LDPL 2VMFA 4FP8H 2OTWA 1QFPA 2H2SC 1P4LA 3GSRB 1MHHB 2FJHA 1G7JA 1BZ9B 4B53A 1F3DH 4LVEA 4ONHA 4WFFE 3F5WB 4D9QD 4TUKH 4NJAL 1YJDH 4GKZA 4WIQA 4LNVA 1X5AA 5FK9B 3M17B 1D5BA 4HH9B 2OZ4A 2Q6WB 1V7MH 4XXDA 3BMWA 4S10A 1N64L 5DF0A 3U46B 2CMRL 5EIIB 2CPCA 3LKRA 3EDKA 1CL7L 5HPMB 1EVTC 2EXWD 2VXTH 3IGAB 2XYCA 3QZWA 5L6YH 2VZOA 4NQSA 2ADJB 3W11D 4GG8B 4BZ2H 4ZFZB 4QHNB 4L8DB 1ZA3B 3ZYIA 1EUUA 4XPGH 2E6PA 2P5EE 1MCIA 5FM4A 4OCWH 1IBGL 3VGAC 5AAWA 4PJAB 1HH9A 1W2KT 1GGIL 3RGVD 3AAZA 3EJZD 3QG7L 2K7PA 5LGKA 4E0RA 1EJOH 4FQPA 3ALPA 5DO2D 1E4KC 4Y19D 1QTYT 4HV8B 1FGNL 2P24A 5FO8B 4PJ5D 5L2KA 5IHUH 2FBJH 3GSQB 4L4JA 1PZ5B 3C8HA 4MXWL 3RIAK 4IDLA 1IARB 5KTEH 1YN7B 3CXDH 2HTLC 3DYMA 3QIWD 1CFQA 1HYSC 1CT8B 4NUGH 3T4AB 4YE4H 3JWDL 2AK4D 4ODXA 4MD4B 1JTPA 1P53A 4GW4B 1KF9B 3SDCD 3QDMA 1BBDH 4BQCA 5TE6L 2BOCB 1S7WB 3ZL4L 4LNRA 4JPKL 1A8JH 1BP3B 1BJMA 1S7UB 3MJ9A 3KYNA 3L9RA 2YKLL 4BFIA 4YDIH 4PRHD 3UJJL 2MFNA 3BHBA 5CIPH 3LZFH 5CP7B 1T7WA 3NFSL 4QTHA 2YD1A 3HPJB 3RKDD 5FUZL 5IB1B 5E2VL 1G7HB 4PJGF 1L6XA 2AW2A 2C4XA 1AJ7H 3S5LG 3T65A 4MNGE 1EEUA 4W6WB 4G8FB 2FL5B 4PJDF 3UTPD 1R3LB 3LMJH 3SGEH 2KL6A 3T2NL 3F5WA 5ERWA 3IXAB 3WXWL 1KEML 1QRNB 1NLDH 1VFAA 4Y8DC 2XKSA 1B4JL 3OKDB 2VL5B 5LCVL 1J5OH 1CDHA 2ZUYA 4M8QB 3VD7A 2VZUA 4YC2B 3QHFL 4TTDC 4Y4KB 5J6HA 1NDMB 5LGHL 2EIEA 3RKPA 5EIIA 1Q9OB 1D3CA 1T1YB 3MACH 5E5MA 4LRNH 2NLJB 4ZFZA 2YEZA 3QUKB 5HGDB 3UC0H 4RCAA 3HG1E 2QR0B 5D4QA 1PSKL 3AFLA 5CBEB 3B3IA 3FQUB 4PJAA 1I1RA 2C3VB 3DX9B 4ALAL 3NVQA 2V7HB 4YDVA 3Q6FB 4PG2C 3KS0H 3ALWA 3IU3A 3SDAC 3X3GL 2HN7A 1KCLA 5GGVY 3FL7A 4HJ0D 4XVTH 4FXKA 3SE9H 2VDQL 1LO5A 3MRGB 4HIHA 5FO8A 3O41B 1VGEH 4GRWH 5DA0B 3GSQA 1RV6X 4ZXBC 3T0VA 1PZ5A 3NFPB 3TZVB 4NPYA 1UB5A 4PJFE 5A3IC 1YN7A 2R1WA 3MV7B 4K94L 4OZGF 1K4DA 1CXIA 2CIIA 1SY6L 1O0VA 1YY8B 4PGCB 1OP5K 4HWEL 1D5ZA 2O61A 4LLVB 4HFWA 4WDIB 3INUH 1A6PA 4C83A 1Z0NA 1D5XB 4UBDD 2DQTH 4F9LC 3BAEL 1NANI 1URLA 3TH3T 1G9EA 4XXCC 2EH7H 4WGWB 3S34H 5HBBA 3LCYA 3P4MA 1JYNA 4KI5F 3PGFL 3SDXF 1X6LA 4JFFE 1IGJB 1IJ9A 4M6NH 4LLQA 3CFBA 3M8OH 3B9KD 1AIFB 3V5HB 3QUXB 2FIKA 5E6ZA 3U9UB 4PY8J 4TNWF 3CSYB 3VH8B 3P0GB 5LBSH 2XZAL 2P5WB 4HBCL 4DKAA 1Y6MR 2OZ4H 3VFVB 4J6RL 3L3HB 2B0SL 4ZFOA 3OKDA 2VL5A 6FABH 3TZVC 5C0EA 1IAKA 5GGTA 4Q9QL 3FT4B 2GTZA 1E27A 3UJIH 1XFPA 1HHGA 3K74B 3QCUL 1IQDA 5ITBL 1FVEB 1IGMH 3K1DA 2AQ2A 2B1HL 2FZ3B 3H6JA 1C5BL 2EE2A 1VFUA 3BT2H 3I2CL 3X12A 2NLJA 4XNQB 4DVRL 3AS3A 5HGDA 2VDPH 5K9JL 4LCYA 2V5TA 1DDHB 1OSZB 3VW3L 2QR0A 3ARDA 5H37G 5CBEA 3VXTA 1XEDA 1XF2A 3T09A 5T3ZD 3OZ9L 3CFJB 1AGEB 4NZDA 5I17A 3L95B 1CS6A 1O7SA 2BVUA 5E9DD 2CH8A 5EOTB 1NMCB 2RQ8A 2AQ3A 1MI5E 1ZHNA 5T33H 4MDIA 3U36B 5ANMA 1EAPA 3O41A 2VDNH 3C09B 1WT5A 4I48B 1T5XA 3U82B 4WW2F 3RUGA 4QLRA 5FOJA 2FECI 3EUUA 4OGYH 3VI4F 1YY8A 3GDBA 1X5LA 2FATL 1F4XL 2IFGA 4NP4L 3EFDH 1OT1A 3L5XL 3MJ9H 1D5XA 2WBJB 4I2XB 3A6OA 4PREB 3AB0C 1BIIA 4M1DH 4TSBL 4XPAH 2HMIC 3T0BA 3V6FA 1YEIH 3MJ7A 2WINB 3GMRB 3B8SA 2XKNB 4FNLL 5JW4R 2DM3A 1IGJA 4LSSL 3ZDXF 2VN7A 4JDVB 4UTAH 2PTUA 3UX9B 1NEZB 4OIAA 3QCVL 3VH8A 1A6WL 4OZIE 4GRLB 4OUUA 3DO3A 1YNTA 2VJXA 3NIGF 3CFIC 4JHAL 1K3ZA 2CKBL 3ZHDA 2IQAA 5C07D 4UUJA 2UV3A 3FO9B 2N7BA 4MSWB 1RZKL 2DQIH 5HI5C 2ZUWA 1BM3L 1FVEA 1MHPH 4DGYL 2ICWI 3MTRA 1LO3L 3O3BA 2APWA 3FQNB 3OWEA 4ORZC 3OBAA 2R4SL 3GIZL 1FNSL 5EU7E 1SVZA 2DB8A 3SJVA 5F7MC 3DXAA 1YYML 4MA7H 1K6QH 3NCEB 2DD8L 2HJLA 3CFJA 5FGCE 4HHAA 4O4YL 1HIML 1MIEL 2EEBA 1I3GL 5IVXE 3W39B 3P4OB 2VLLA 3ZMRA 3E6FA 3EDDA 3FO2B 1C5CL 4L3EB 3D69A 1IM9A 1WK0A 2X4QB 3V52L 4GRLC 5E00A 3MLTA 4LU5L 3P11L 2Q3ZA 4JRWA 3QFJA 4JFOB 3T0EA 4Z9KB 5ISZA 5DK2B 1DN0B 1R3IL 1GYAA 5H94B 4ODUA 4PJXF 4WI4A 4XVSL 1UZ8A 1RURL 1GH7A 2LAGB 2F53E 1CBVH 4PREA 1IT9L 4CU6A 1SM3L 4ODVL 4PJIE 5GXBB 1CD1B 1HXYB 4YO0B 4HAFA 4PG9B 1AI1L 1FFNA 4JE4B 4YH6A 4L3CA 3SDDB 1JWUA 1WFNA 3FO0H 4JKLA 1L7TL 4TNVK 4JDVA 1YMHB 4XNYH 4FG6C 3PHOB 1BREA 3O11B 1OPGL 4MA3A 5EZIH 3QQNA 4MMZC 3BQUB 4C56E 5EO0A 3HMXA 5I1AB 5F7WC 5GRJH 3ZTNL 5DLMH 3BDYL 1YNLL 4P5TA 5F8RC 1PG7L 3UTTE 3QIBD 3WXVL 5ICZB 4XAWH 1MELA 1GPOH 4MSWA 3P30H 4UV4L 1OAYH 1U8NB 1A6ZA 1X5KA 5I6XC 4H8WC 4ENED 4Z95H 3W81A 2YWZA 1QSED 4LARL 3W82A 4HEPG 3SE3C 4Y0GA 2DQFB 4POZC 1AP2B 4ZS6D 3ILQD 3C60A 4U6YB 2F54B 1FYTD 4GSDH 3C9NB 3WUWB 4P23C 5EBGA 3SCMA 1AD9B 3IRZA 2Y36H 1XMWA 2R2EB 2FYYB 1AY1L 2UYLA 1HZHL 4RFNB 2IALA 1LVEA 4AK1A 5DJ2B 4Y1AA 4P46B 3PP4L 4YQXL 1I9JL 3W39A 1LEGB 1K2DA 2JE8A 4NRYB 1BQHG 2GY7B 2IF7A 3LS4L 1P7KB 4ZTPH 4GO6B 4L3EA 5DD3L 4NCC2 1MCRA 5B8CA 1XCQA 3RP1A 4OZHB 2X4QA 3PXHA 5JIPA 1KCSH 3HI6H 3O8XB 2OQJA 1DBAH 3JUYA 1CI5A 4G43A 3JWOH 3VXRA 1P4IL 4P4KB 2C1OB 4R0LB 5DUML 1U3HC 4CUCA 3IFPA 3MO1B 1LO2L 3O3UN 3QNYA 1FVCA 1OAXL 5D7JD 3WNMA 3S36L 5CLTA 4Y89A 4P2OC 4YAQA 2BSSA 4LCWD 4NQCB 5JHLL 1S7XB 5C0AB 3BWUC 3H8NA 1HXYA 5FGBA 4JHBA 5FYKU 4Y4FD 5DD5L 2DTML 3TT3L 2OM5A 3I3EA 5GRXG 5F89B 4P2YA 5HTSA 4U4BA 5F88B 3NABL 1L0QA 4OBRA 1J05A 1RPQA 3P0YH 3O11A 1X5XA 3BQUA 3UBXB 5DK0A 1ONQB 3SE4A 4WUKL 4ODWA 3MODL 3CVHB 1JPTH 4F9PA 1EXUA 1U91B 3MGOA 3I50L 3RGVB 2A73B 4WUUE 4M5YL 5F6HJ 5ICZA 1OGAE 2FWOA 1T66C 4FMFA 4UT6H 2XZZA 4HWBL 2MQ0A 1QBLL 3G6JF 4P4KC 3LQAH 1I85A 5D9SB 3OKYA 4R0LC 1P2CB 4HQQL 4MQSB 1BVKA 2DQFA 5F3BA 2R2CA 3C8DA 5LXGH 1UH3A 2F54A 2EDWA 3WUWA 4PYGA 2V5RA 3CLEL 2HLFC 4LSVH 1IFHL 3EJYD 5JHDE 5D2NA 3ULVH 3LN5B 1VENA 4L29B 2DI8A 2R4RH 5F1KC 5JW4M 3QIWB 1QEWB 5HGHA 2AJ3B 3GBML 3HUJE 4D9LH 2ADGA 1LGVA 1KIQB 4LCCA 4P2QE 5HYEA 2LQRA 2AK4B 2EC9U 2VXVL 3SDCB 4YGVB 3VFSB 4YXHL 5K9KB 3TJEH 2R1XA 4NRYA 3U4AA 4Y2DD 4B5EA 1CICC 1VACB 5JXEA 3KPLA 1MH5B 1JWMB 5DUBA 1F4YH 4PBVC 5IVNA 1FORH 4Q97A 4XNMB 1AGFA 2HA1A 2DBJA 5GSRA 5K59E 1P9MC 4PRHB 1OOAA 5C0RL 1MJUL 3DVFA 3VFTB 3WIIL 3O8XA 3KPRE 4KVCH 1G9MC 4F58L 1B0RB 4F37F 1HDMB 4POYA 3NH7H 4MJIE 4O9HL 2C1OA 2AABL 3H42H 5IW1B 1A1MB 3OKOB 4JZNB 5LAXB 1U3ZA 1I8LA 3N9GL 4LPWA 1VDGA 3A6CL 3FFDA 4MLSA 1X4XA 3BD5A 4XMLL 1SVCP 1XGUA 2EE6A 1E4XH 1KYOK 4M6ML 5I76B 1OD9A 3D25B 2P7TB 4HCRA 1CLYH 4K8RC 3BRDA 5T1DH 2B2XL 1CG9B 1W8OA 4KROD 3M07A 1KCVL 3HMXH 4JY4B 1V5JA 1CGXA 2P8PA 5F88A 4KKLC 4LGSB 3QPQC 1WWBX 1X3DA 3D3VB 5JORA 3UBXA 5I8KH 4V2CB 3NCJL 3UPRA 4K3JH 2J4WL 1N59B 4H0IA 4NGHL 1QPXA 4KFZC 2H8PB 3QQ9D 5J13B 2A73A 3GNMH 4Z7UA 4M1CD 1TTUA 3MRHA 4ZOEA 3ZKQD 4NN7B 4Z7VB 4FZ8L 3AROA 1ORSB 4Y19A 5EU6B 1ZS8B 1PYWA 4X6FB 3TFKC 3NOIA 1NCWH 4NSKA 1RZ7H 4JFXA 4PJ5A 1RZFH 4X5XB 3ZYOA 2YD6A 4JZJA 2OK0L 1CR9L 3KPNB 1JNLL 1HI6A 2HT3D 4KAQH 4XCYB 3ZE1E 5FDWA 3HE6D 2QV2A 1MEXH 4PB0H 3LN5A 4M5ZH 1NCAH 2CXKA 4OCLC 3JV4B 3QIWA 2YD8A 4K71B 1BHGA 1U8LB 1OW0A 1MFDH 3QDAA 5TE7L 3R4DA 1XGYH 3HFMH 4L3AA 3MV01 3CSPA 3EYUL 5D1QD 3JUZA 4WWKB 5CJQL 1D5IL 1MAJA 4OLZL 4NHCL 1I1YB 1Q1JH 4UV7H 1MH5A 3SGKA 1FCCA 1JWMA 2IPTL 2AKRA 4KPHL 1LP9E 1OARL 4JFDA 2EDHA 1N3NB 3FT3A 4XNMA 4XP9L 4OZ4A 4EI5D 2IPKA 4KTYA 1RMFH 4I5BB 2WAHA 5J11C 1HEZA 1OF2B 4RGNE 5J89A 4HS3A 3VXSD 1HDMA 4NKOB 3WE6A 3B9KB 1K3IA 2CJUH 4JKKA 2COQA 2E3VA 4PD4J 1Q9LA 2WBWB 3QO1A 4Z7OF 4HS6B 3D39E 3LVEA 3MBEC 4CJ1A 4EVNA 5I1HH 3OKOA 5LAXA 3I6GB 5BXFA 2X1OA 5CCKL 3T77B 4U7KA 3SKNB 1WAAE 1DBKL 4OQTL 1TJHL 5IW6A 4FABL 5JXAH 3D25A 3EO1B 2O5YH 1CG9A 1M6OB 3OAUH 1ZOXA 1P5UA 5E1AA 4JY4A 1R5WB 4DKFH 3F58L 4P0DA 3MCLL 1NC4B 4PRDA 3O2DA 4I0PD 4MA8L 4WWKC 3EGSA 3UMTA 2HT4D 4PJEE 5FYJD 2V9QA 2NY6C 2VLME 3QUYD 3C6SA 4KRMB 4ACPA 3C87A 4AG4H 1IL1B 3RAJL 5AZ2L 3LKPB 3QI9D 1YJDC 1ORQA 4OV6F 1MY5A 3G04A 5E9DB 3F8UB 5D7IF 4X6FA 4ELMB 1I7ZA 1QSFD 4W70A 2VO5A 1L7IL 3GK8L 4X5XA 4EOWL 3BPLB 1BPVA 4Y5YC 4NN6C 1QOKA 5D5MB 4XCYA 1SBBA 1Q9KB 2JJWA 4ZUVB 1F00I 1MCSA 4N0UA 3V0VB 4TNWK 4HIIA 3MRJB 2RR3A 1MCOL 1U8LA 4HGWB 2E7LA 4TSCL 4ZNEA 5DJ8A 2NY3D 5J8OA 2J7LA 3O4LE 3BZEB 2VERN 5I8OH 1BJ1H 5IK3A 5IMKA 2AJXL 2A0LD 5E6IB 5LG1A 3S4SA 1Q0XH 2ZUVA 5GS0L 1YEJH 3W9EB 1KJVB 1YDPA 1SJEA 5GS2H 1FFOA 1ZT7B 4JFZL 2DM4A 1N3NA 4NDMA 4P3CL 2BVEA 4LEXH 4P9MH 4MHHI 1OF2A 4OLXL 2IAND 3BFOA 4MNQD 2H41A 3B9KA 2GJ6E 4TOYL 3HNSH 4PJFF 5C0BA 4JR9H 5C9JA 3V4VL 2YK1H 5A40E 5DMKA 3I6GA 1DJSA 4J3WA 4HCRH 4EKXA 4QGYA 1YQVL 1HILB 3HE7C 3T77A 3R8QA 3MFFB 4S1SH 4IDJL 3BPLC 5SX5K 3K4DA 2NYYD 3KLAA 4OFYD 1AGDB 5C07B 5TE4L 1INQA 2R0KH 1KBGH 2QADD 4UI2A 3GSOA 4KKNA 2YS4A 3NBNA 3VXNB 1S7SB 4FQCL 3ME0A 4KJQC 1R5WA 4ERSH 5TQ2H 4NC2B 1JWSA 4GAYB 1CN4A 2Q76A 4OB5L 1Z9OA 1AD0B 4XP6H 5E6IC 1VPOL 2BRRH 1W72B 5IQ9A 1UWXH 3QWRA 2CUHA 3PWUB 4JHWH 3C5ZB 2G9HA 5B4MD 1IL1A 2NX5D 3OKKA 5FGSA 1J8HE 4IBLT 1T0MA 1JVKA 1DSFH 4Y16A 4WGVB 1OCWL 1IGIH 3TO4A 5BZDA 2NW3B 1AQKH 4NBXB 3D9AL 1J1PH 4U1JA 2DLGA 1HSAB 1LO4L 1ZLSH 5DVMA 5E2TH 32C2A 5D5MA 4H88L 5IJVA 1MJ7H 3S35X 2GFBB 3WO4B 1CGWA 2XACC 3IVKB 3D2UD 3MRJA 4QF1A 2YZ8A 1UG9A 1C08A 4PRPB 4X4ZA 2QL1A 4Y7MA 1QUNA 2V5YA 1A3LH 1DQJA 4BK4A 3BE1H 2OLDA 3SKMA 2XN9A 5BQ7A 3MNVB 1KJVA 4RGOL 2GW5A 3QJHB 1I9IH 5EBMB 1Z9LA 1T1XA 2R1YB 2L0DA 4NM4H 1G7MA 4NJ9L 3VFGL 3MYJB 3RU8L 3C5ZC 3TBVB 4BJLA 5CJXC 2GKIA 3L3DB 3QNZB 1UYWL 4X80H 3EJJX 2X9WA 3OF6D 4R90H 5L7XH 3FQRB 4N8CH 3C5JA 4LVOC 5T1KD 1KELH 5HHNB 3OHXA 4JZOA 1F5WA 2LTQC 3CUPB 3DUSB 3C08L 3MFFA 3QIBB 1MQKH 2VDRH 4HWNA 5TQ0L 4M9OA 4LAQL 5CHNB 4LLMB 1WBXA 1T0NB 4NQDD 1U3YA 2W9DL 3ZE0E 3WO4C 3O2DH 5DJZA 3VXNA 1QSEB 5HYQB 1S7SA 1EBAA 3OAZH 4PRAA 7FABH 4HDIB 2ZOLB 1FYTB 1XR8B 5C70A 5EORH 4R7DA 4X0KA 4BQ8A 1QRNE 4BQ9A 2WWKT 1QQDB 1UCBH 4F80A 3T3PF 4X4YA 1T7XA 4I77L 5F3HA 3PWUA 4J4PD 3BPCA 5IGXH 4DOHB 1XGQA 2VDKH 4YPGB 4DEPC 4X9GA 2A6IB 5DD1H 5F9AC 1IAIH 5KVGL 1BOGB 3HR6A 1CFNB 1QR4A 1ZTXH 2FEDC 5GSVB 1H3XA 4DN4H 2WIIA 3BXNA 2NW3A 3ZKXB 1KFAL 1RJLB 3BSZH 1OP5H 4HKBA 5HHQA 1G9NH 1JPGB 1TTFA 5GGUB 2OXGA 1P4BL 3MROB 3G6AA 1A4JB 3IVKA 4XRCA 5DR5L 4N0RA 4Q58C 1IEHA 1DR9A 1IAOB 4L8CB 4DCQB 4K2UH 5D7JB 2VUOA 5TDPA 4K7PY 3L7EB 4LSQL 3GIVB 4LCWB 4Z77B 2R56H 1ZLUK 5IVXF 5EBMA 3HB3D 4XBEH 3MLRL 3BP4A 3LV3A 1RUKH 4KVNL 3V4PH 4U1IA 5IB3B 1ZGLP 4Y4FB 4OM1H 4GKSB 4QTIL 4RDQG 5C71A 2YZ1A 2XZQH 3E1F1 1INEH 4WU5A 1EO8H 1SYSB 1HNGA 3PWLA 3IXTA 1NMAL 3MRNB 3QPXL 3JVGC 3KDMA 3MV9D 3F6LA 4NQTA 4QKXB 3NPSC 3FRUB 2EXYC 5L9DL 4GAGH 4GRMB 5CD3B 4M43H 5C6PB 5TH2A 5KN5B 5IBLC 4U1HB 5JA9A 4ODSH 2EYSB 5GGVL 1ERNA 3CFKA 5I1CH 1A6AA 1GAFH 1T0NA 4ZPVB 2FHFA 4PJIF 1QNZL 1VHPA 1N6UA 2EDBA 3DRTB 1QSEA 5HYQA 3L3IA 4WI2A 4CN6A 3QXWA 2Z8WC 2P5WE 4H25B 5DGRA 4WY7L 3SQBA 5T3ZH 1JNNL 3HMWH 1EUTA 1AR1C 1IM3A 1B0GA 3BKCH 2EECA 1SYVA 1TVBB 1DVFD 2CIKA 4U31A 1OAUH 1ZHKB 1HKLL 5J57B 1NSNH 2KPNA 1F8TL 1J88A 2QQLH 5IJKC 4PGBB 3TWCH 4N0YL 2IH3A 4GT7A 3CFEA 5E8DL 3FZUD 3BWAA 1H5BB 5D7LD 4Y2DB 3O81A 2IBGA 1YN6B 4HXBH 4JQIL 3ZYJA 1CFNA 4HJJL 5EN2B 4K3EH 4M61A 4HIEA 5HDOA 4LPVA 1OQXA 2AP2A 2ORBH 4Z0BL 1SJVA 3BN9D 3WEXB 3QUMB 3SY0B 3N0PB 4HSQA 5GGUA 1UJTA 3HNVH 3VGBA 4FMKA 1P5VA 3MROA 4LOUC 2FR4B 2VDOH 4D9RE 4E41B 5DD6A 3AMLA 4YDLC 1NUGA 1UQSA 1IC4L 5D6CB 5FXCH 3BRFA 3H3PH 1LMKA 4X7SH 3DETC 3KYMB 4Y4HD 3L7EA 3QJFB 4PTUB 4G9FA 1LEKB 2XT1B 3KYAA 1XZ0A 2P8LA 1A4KA 4Q74A 4OKDA 3QWOA 4E42A 1LILA 1KXTB 3RVWC 2UWEE 4NYLA 4W6YB 2P46B 1MJJB 4Y4FA 4GKSA 1U6AL 4I9WE 3QDJB 1QP1A 4I3GA 1L0XA 1P84K 4KGLA 1Y0LB 4KV5E 5DJAB 2ESVD 4LEOB 3AS1A 3MRNA 2C7UB 4I2XE 4MJ5B 3WDJA 4WJ5B 2FJFB 3N50A 2EC8A 3IFLH 3A0OA 4HF5L 4UOW0 5I1GL 1CYGA 1JPFA 4XNXL 5CD3A 3MUHL 3VDAA 3L6FB 1H15A 3GSXB 3H7LA 4BZYA 2Z9TA 3OXRA 2GSIB 1A5FH 4JGUA 4PJBF 2RFXB 4NT6B 4JDTH 1CFVL 3T0WA 4PS4H 3DRTA 1OTTC 2AEQL 1EV2E 2GUOB 1S9XB 3C8KA 5I75B 2X41A 1W72H 4I4WB 4I8DA 3RHWF 3WIHL 4F37K 1J0KA 1EJ6A 1AC0A 3QXVA 3HCVB 3HE6B 5D71L 5IEHA 2IG2H 1NBQA 1DTUA 5LKNA 3A67L 5GISH 2ITCA 4XCFH 4C59B 4MHHG 5AZEL 4FZEH 5EUOB 5D1QB 2YC1A 1H5BA 4D0CB 2DBLL 4Y2DA 4L8SB 1YN6A 5SWZB 1JPSH 1YC7A 2FNBA 5KSVA 4IHOA 4GAJH 3X13B 5ILTH 4Y8AA 3T0XA 4EI5B 4GQ9L 1QLEH 1WZ1L 4ZFGH 4DW2H 2VSCA 3VXSB 4AMKL 4F2MA 1NBZB 3DSNA 4DTGL 3EDFA 5D96C 2O5ZH 2ZCHL 4JVUA 4BUHA 4TUJB 4WFFD 1LO0H 3MMEB 4X6CB 3HUJF 3QJFA 5C0CA 4MNHB 5DHVB 3PGCB 5I75C 1BVLA 5BVJB 1MNUL 3WN5B 1I3VA 5LVEA 9CGTA 1UJ3A 2WZPD 1T20A 2BNQD 4AT6B 4CNIB 1A47A 4YFLF 1WT5C 1G6RL 2MSPA 1U8HB 1KENL 2JB6B 1RIHL 4KHXH 4QRSB 4HT1L 5GJSH 4HC1A 4UT7H 3CDFA 2Y72A 3KPPB 3MXVL 5K59F 1Y0LA 2XFXB 5DJAA 4JB9L 4KTEH 4LEOA 2P5ED 2FJFA 4JHZA 2P43B 4L8SC 3JWOC 1J1XL 3QXDA 4LLUB 4RDQF 1H8NA 1JGUH 1A9BA 3K1KC 4YDJB 1ACYH 2JCCB 1U8MB 1GRWA 1MCDA 3QI9B 5DJCB 2GSIA 2SEBA 2Z31B 4RA0C 2ZG1A 4WHCA 1Q9WB 4MAUL 1OTUD 1WFTA 4Z0XB 3EYOB 1FH5H 1QSFB 2Q8BH 1S9XA 3GUTB 4KZDH 4I4WA 1IKFH 1WFUA 2YUWA 2VH5H 3DMMD 2DF3A 4C58B 3HE6A 4PJDA 4KKCD 4RSVA 4K9EH 4AM0A 5EU3A 2QTEA 3U2SA 1KACB 2J8UF 5HI3D 1IC1A 3H9ZA 1PKOA 3BZ4A 5F7DA 1J10A 1U8IB 2EKSB 4FQXD 4QHLB 3RVVC 4BKLB 2NY3B 5EFIA 4KXZH 1A6VH 3PE9A 4D0CA 4LLDB 4FQLL 1JZ5A 4NQEA 1JGDB 5J7CC 1RIUL 5IV2A 5IQ7H 3O4OB 4EI5A 4J1UB 5ITFB 2CGRL 3VXSA 1OSPH 1MHCA 5DFWH 3ULUC 5TDOA 2VC2L 2FGZA 4WWID 1NBZA 4MX7A 3L3KB 1ETZB 4XNUH 4YHIA 1IVLA 3AUVA 2Z31C 2UZYB 1CVSC 1UM5L 2DQEL 4HX1B 3ROLB 4X6CA 3QYCA 1FAIH 4J3VA 3PIQA 4UIKH 4OZHE 3K80A 3DVIA 2BVPB 3UTQB 4MA1B 2MHAA 4MNHA 3PGCA 4LKXA 4ONFH 3LHPL 5HVGB 4AT6A 5C6TL 1KN4H 3P9MB 3S96B 5TFSH 4F7EB 2QADB 1PKQA 1RJYA 1J0IA 1JNHB 1LP9F 3I3BA 4QRSA 5E7FA 4ZOCA 3IDXL 4NWUH 3T0EC 2G75B 1SEQH 4OZGA 2B4CH 4OIBA 4XHQA 4I0PA 4LSPH 1CXKA 4L4VE 4NQCE 1JGLL 1L0YA 1HQ4A 5C0AE 1F58L 4LLUA 1NGZB 3QUYA 5F96L 1IGYA 1X44A 3NAAL 5FKPB 3O4OC 4PGZA 1KPVB 1CLOL 3QI9A 3FQXB 1F02I 1JYVA 4ZUWA 3SDXA 3HKFA 1MCFA 4N8VG 2Y07H 5GS1B 5HGAB 2JKXA 2NY4D 3LN4B 4M62H 4GS7C 3HAEA 5EG6C 1QBAA 3H3BC 5J56B 1PX4A 1Y6NR 4U1KB 3TC9A 1BX2A 5EOCH 3CGTA 3WFBL 1SBSH 4MA1C 3SE8H 3WS3B 2W92A 4GQPH 1FVDA 3G6DL 1A6UL 2OP4H 5KVEH 2Q86B 4E5XB 1WEJL 1U8IA 4QHLA 3CAFA 4ZODA 4PJEF 2ZUTA 2F58H 2R29H 1CZ8L 2YPLE 3S5LB 1F6AA 4EXKA 4LSRH 4F3FA 3IJHB 3OV6A 3FTGA 1XR9A 3OR7A 3KHOA 3HC0B 3ARFC 5EWIH 3S35H 1NFIB 3MSPA 4L1HA 2F19H 3ECBA 3NFNA 3C60C 1RUPL 4JFFD 4NKIH 1VADA 5HYSG 1Z2KA 4LLYA 4YXKL 2CD0A 5F6HI 2IANA 4LBEB 5EZLB 4G7YL 4MNQA 5FDYA 3OPZL 3DX8B 3WD5H 2LFGA 5IOPB 3U79A 1UWGH 4DKEL 2AK4E 4I3RL 5BZWA 3RBGA 4TTGA 1NCDL 4YIQA 3L3KA 4XP4H 4WTZG 3VE0B 2IGFL 1XF3A 25C8L 4HXAH 5CJ8A 5KVFL 4PV8A 2CO7B 1A7OL 5T1KB 1ZT4A 4MAYD 3BO8A 1IGCH 4ZYKA 2D0GA 2XXCB 5MP6L 4HC1H 4OFYA 2X70A 3MLZL 3W2DH 3CDGB 3O6MH 1AGBB 4P5KB 1OAKL 3S96A 1YMMA 1N8ZA 5I1DB 4XPBL 1Q38A 2HFEA 2OMNA 4ODHH 1CF8L 1JNHA 4JFPB 4WW2A 4JO4H 2R9HD 5INCA 4X7TB 1F45A 2Y06L 4N9GB 5EC2B 3FOMB 5CZKA 1NGQL 3WFDL 1GZQB 4MVBD 5JQ6H 3IF1B 5CJOH 4PLNC 1CDYA 2HH0H 1KTLB 4L4TB 3BESR 4U1LA 1AHWC 3K2UH 2W0KA 3HZMB 5DTFA 2Y5EA 3B6SA 3X11A 3T2QA 1LK2A 3DX7B 1MF2H 2BJMH 2C9AA 4UT9H 5FCUL 2JB5H 2HG5B 1Y6KR 2ZKHL 5FKPA 2NX5A 5FKAB 3HZVA 3EYSL 5FGBC 8FABA 2NY7L 5MEPB 1KIRB 5DURD 2XTLA 5HGBB 5HD8C 1MI5D 4ONGL 5GS1A 3D3VE 1CE1L 2OTUB 3U0WH 5CAYB 4PR5A 4XP5H 1IKNA 2NMSA 5BJTB 5DHYB 1CLZH 5DHXB 4HKXB 3WLWC 3SE4C 4TVPE 3CX5K 5DJXB 5DZNA 3D2UA 3U1SL 1K85A 4KK9C 2ENSA 1YEFH 1N7ML 1BJ1J 4PJ8A 1R6VA 1G7LB 1FBIH 5EU6E 3E8UL 2HLAA 3ARUA 2AEWA 4KJPC 2R8SH 4MZ2A 4R4ND 2A6KA 1FZOA 4PLKC 4ISVA 4J3UA 3ABZA 1GVIA 4K23H 2XNAA 2XRAH 1NFIA 4JG1L 1YEEL 3BP6B 3MRLB 1LDSA 3VFUB 3MA9L 1KIPB 4HEME 4NN5B 2VTFA 4OT1H 3GO1L 3BIAX 5AAMA 5EZLA 5D2NC 5I19H 5BS0B 3RVXC 1PY9A 4GG6B 4UTBH 3FB6A 5T1MA 3LQZB 3D18B 3MLXH 3DURB 1VB9A 3OF6A 4JM4L 1A9EA 3MBXL 4GLRH 4LCCC 5JR1L 1PY4A 4IM8A 4LMQI 1MFBL 5HYFA 4HK3N 4PB9H 1QFWM 4LCIL 5DZLA 4EN3A 5A16B 4F33A 4H8WL 3QHZL 5IMLA 3V2AR 5M7QA 1LNUB 2E8ZA 1TQBB 3LKNA 3TNNB 1ODAA 4NQDA 2G60H 4H0HB 4OCRL 4GKOA 1AC6A 4HJGA 4PJCB 5LGJB 2Q8AL 3KLSA 1CDIA 4X7TA 4WO4D 1Q94A 3RVTD 4N9GA 3FOMA 5FYJH 1J86A 2X4OB 5DEFB 5I71B 1L9NA 3I02A 2QHRH 1FZMB 4X7DC 4KQ4H 4B7LA 1DFBL 1K5NA 4RIRB 3ZLQC 4NZTL 3J8F7 3RGHA 5D72L 1E4WL 4PJXA 1NKOA 1DVFB 2BNRE 5DQJB 5EB9A 1HWHB 1V8HA 3R06B 2G5RA 35C8H 1TENA 4X5LA 4QWWC 1HHKB 3QAZB 4OD3L 1DLHB 2ZSVA 3HAEH 4C57C 1S8DB 5D7LB 2OTPA 1CU4H 3TH2T 5HGBA 4YBQD 2Z8RA 1UZ6E 1CE6A 3PWVA 1LK3L 3ZE0F 4HFUL 5D6DA 1FN4A 2YD2A 4KRLB 1J11A 3MLWH 5JOFB 5MEOA 3UZEA 4MD5A 2AJSH 3FO1B 2ICEA 2XG5A 2AI0H 5A43C 1JV5A 1DQLL 2OX5A 3RZCD 4LP5A 1KPRA 1IGFH 4OF3A 5E9DE 3CCHB 3ZT7A 2F53D 1OM3L 5DMGD 3GI8H 4Y4HB 4ELME 2DTSA 3DPBA 4NKMA 1BD2A 3IDYB 1GZPB 2A9MH 3E6HB 3CH1B 5IR1A 3ZDZF 1MLBB 1NGYA 3I9GH 3BP6A 3MRLA 5I2IB 2I07A 1ZGLB 4JZJC 1JZ4A 1KIPA 1D9KD 1PG7X 1T1WB 5KSBE 1WGOA 4D3CL 1T5WA 1BLNB 2VXSL 2Z91B 2AV7B 2ESVB 3MLSH 3SPVB 2FH8A 1W0YT 3D18A 2D7TH 2NXYD 3THMH 4D0BB 1YEDA 3GMNB 3MV9A 4UMGA 1A6TA 4XC3L 1VERA 1MRCL 1FG2B 3BX7C 4N0CC 5HY9B 3UTTD 4IIQA 3OG4B 5C2BL 2J6EA 3ZZ1A 1LNUA 4HPOL 3O2VL 4NZRL 1FL3B 1ZK9A 2ZUQC 2EIBA 4OIIL 4BSJA 5JZ7C 3I6KB 4FQJL 1NPUA 4KMTL 3NTCL 5KVDL 3S98A 2IAMD 4R8WH 3LD8C 2JIXA 3PV6B 1JIBA 4OKVB 4IOIB 5DEFA 4OJFL 2XQBH 5HYJE 2WSKA 4FFYL 2R0LH 2LU7A 4RIRA 4IRZL 4QRPA 3V5KB 3IDYC 5DA4A 5C07E 1JGEA 4GMSH 4YXLL 5KSAC 4OSUL 5DQJA 3MRRB 1MAKA 4OCXH 4P59H 5L8LB 4FQHB 3R06A 3H9SE 4U49A 1SY6A 1HHKA 2A83B 1DLHA 2ZJSH 4LAJH 5D7LA 3SGEI 1J7VR 5DC4B 5FM8A 1G9ML 4X4XB 3CVHL 2D03L 3S36X 4ZS7H 4HK0B 1KB5B 3T3ME 5GS0D 4ZQKB 3GFUA 1WZMA 1YEHH 1LDPH 2NTSP 5JOFA 5BO1L 1KCRL 4R9HA 3LKOB 3LIZL 1ED3A 2LU3A 1D6EB 4BM7A 4N5UA 2KZWA 2NY2D 4NJAH 3ZE2F 4P3DA 4DUVA 3QHTC 4K8RL 4WNQA 3SN6N 1JE6A 2EE9A 1A1NA 4KQ3L 3RTQA 3CH1A 3E6HA 3G6JA 3Q5YA 1MLBA 4JLRB 5J1SC 3QNXB 2BNQB 1N64H 1ZGLA 1L4IA 5A2LH 1YQ2A 3PDOA 1IZKA 2CMRH 1T1WA 1CL7H 1T6WA 4PRPE 3LEYL 4JFQA 1BLNA 1X4YA 4KK6C 3SGDH 1G7PB 5I73C 2Z91A 2AV7A 2ENYA 1PG7W 2ESVA 2Z8VC 5L2JA 1X5IA 3KPOB 5SWQB 3L1OL 4M3JA 1C12B 2HYMA 2P5EB 2LABA 3LB6D 3ULVF 5FYJU 1IBGH 1KJ2A 4NO5B 5CJ5A 1GGIH 1UEMA 3QG7H 1F90H 4WUUD 4JY5L 1OGAD 4KWUA 4CKVX 5AD0B 2X4RB 4KHTL 1GGBL 5F1IA 1G7IA 4J3OC 5EBWA 3VWJA 1FGNH 5D8JL 1MWAA 4UIMA 3W9DB 3KYOB 2BRQA 4CDGC 3O9WC 4ZSOA 1BQHB 2OI9B 5H2BA 3MFGB 4QYOA 4MXWH 5IFHL 3EO0B 1NAKL 3DMMB 2CR6A 4KV5F 4KTDL 5E95B 5DMJB 3ZKMD 4OZFA 3U0PA 1FRGH 1QACA 3VGFA 3DROB 3MRRA 1RULL 4O58L 1WF5A 2C3WA 3JWDH 1FYHB 2FSEA 2FX7H 4P2QD 5E2JA 2XWTB 4FQXB 2DYPB 1S9YB 3O3DA 4XVJH 1DQMH 4KKBC 5TE6H 2A83A 3ZL4H 3FONA 3P4NB 1DUYB 2VDLL 2DM7A 4JFYB 4X4XA 2YKLH 1PLGH 2PW1B 3GMQA 4OF0A 2G2RA 4TVPL 3NMEA 3UJJH 3MA7B 3NFSH 2L7UA 2E7BA 3H9YA 3KPRD 5FUZH 3ARGB 2X40A 1JTTA 2E7CA 2I9LA 3VRLF 4MJID 2EDLA 4MNGB 4M3KB 3OQ3B 1T22B 2GK0A 1NL0L 1CDJA 3NIDE 5DRNB 1HH6B 3T2NH 3WXWH 2OXHA 1KEMH 2ADFL 1EO7A 4KRPD 1B4JH 5I16B 5LCVH 1E28B 4Y16C 3TO4C 4HLZG 5CEYB 3QHFH 2PXYD 1DEDA 3QNXA 1OT2A 1ZT1B 2CKBA 4DGIH 5E8EA 1X7QA 3PJSB 3PL6A 3PF2A 3RDTD 5C09A 5T5NG 4G5ZL 4IJ3C 3S88L 2GEEA 5JLZB 3KPOA 2EKJA 3FT2A 2J6EH 1ZMYA 1PSKH 4HKJA 3QR2A 5H37H 4ALAH 4YZFE 3BKJH 3G08A 4H5SB 4W6XB 1TNNA 3X3GH 2XPGB 1HINL 3ARGC 4ZUUA 2QKIB 2HFTA 4WW1A 3M1BB 5T1LA 2VDQH 4BFGA 3VU2A 1QA9A 2HJFB 4O5LL 1RD6A 4UB0L 4QXTA 3EOAB 4G6AC 2BXYA 2NY4B 3W9DA 3UYRL 4TSAL 3RY6C 4P2RD 5L6YL 4XTRD 2BP3A 3LKQB 4PJFB 2EYRB 2PO6D 1A3QA 3TT1L 1K8IA 4K94H 4JDZB 1SY6H 1R3KA 4LSUL 4HWEH 4LLWA 3W0WB 3PHQB 4OAWA 1ZLWK 5HJ3A 4IEFB 4G3YL 2XWTA 5EPMA 4JN2B 3MLPA 4JJ5B 5ALBH 4U1NA 3IS0X 3QEGL 4OF7A 2PW1A 4LK4A 3BKYL 5IHUL 3DVNA 3TBTB 4RGND 4I3SL 3MGTA 3FN0L 2W0LA 2IADB 3KYKL 4HAGA 2Y6SD 2J12B 2VLRE 4O2CB 1S7QB 5FUCC 1T22A 3D39D 3ARRA 1ZWIB 4U1GB 4G6ML 1S9VB 1QVOB 5HHPB 4DFHA 2XZAH 1BFOA 4HBCH 5D1XD 3NCYS 1I1AD 4LPCA 4J6RH 3TGXA 1S3KL 1EMTL 4HUXA 2B0SH 4MAYB 1P69B 4OF8A 1E28A 1T7YA 1I8MA 5GZND 5D7IA 4Q9QH 1JHLH 2X10A 3STLA 3QCUH 5ITBH 5FYLE 4E41E 2B1HH 3OKNA 1C5BH 1I8IB 5A2KH 1KNOB 4NRZB 2MKWA 5LQBL 4QRRE 2NXZB 3MC0A 4QHMB 3I2CH 1AJ7L 5IB4B 4YBLC 2V2XA 4NRXA 4DVRH 2YA1A 5K9JH 1U8KB 3MNZA 4UDTB 1UKTA 3VW3H 4PRBA 3HG1A 2P48B 2BCKB 1FO0A 2VLMD 1TZIB 5H35B 2BDNL 3JZ7A 3PGDB 1MWAH 4KK5D 1VFBB 3BP7B 2XPGA 3QDJE 3Q6GL 4OZHF 5IW3A 2QKIA 3M1BA 2YSSA 5SWSA 4NKQB 5IBUB 3MYZA 3I84A 4L9LC 2RHEA 2HJFA 2Y5TB 5DURB 1GGUA 1MI5B 4N5EC 1KN2H 5IB2B 4U1GC 4FOMA 4JKMA 3GHEL 4OZFH 3ZHLA 2IBZY 3BD3A 1JFQL 2C1PB 4PJFA 5CSBA 5EC1A 5C6WH 4POUB 2VQUA 4NNYB 4X6DE 4MQ7B 2CRMA 4XB7A 1YA5A 2H2SD 2FATH 4NP4H 3PHQA 1DQTA 3QXAA 3VI3E 3O4LD 3L5XH 2OMBA 3BGFC 1R5IA 1CIUA 2GQHA 3LRSB 4LIQE 5J4MA 5IP4A 3T4YA 3X14B 3FQTA 4TSBH 4RMQA 2NXZC 2EDNA 4J3TA 3WLBA 1UT9A 3IFOB 3IFNH 3TBWB 2ICWB 1NJ9A 3ARZA 4LSSH 1K8DB 3VFMA 4JFFA 3TBTA 2FIRT 1T2XA 5DEGB 2OSLB 3RWFA 5DRZB 3BIBX 5C8JA 2GJ6D 4FFVC 5ICYB 2IADA 4X6EA 3ALXA 3MUGA 2OR9H 2HWZH 1S7QA 3QCVH 5EUOE 1AXSB 1ZWIA 1A6WH 3VXUE 1QVOA 5HHPA 4OZIB 3AY4C 2WNGA 2ZUUA 1ZHBB 5SWZE 3R0NA 1FNLA 2CKBH 4MAYA 3ET9F 4NZUL 2O26U 2W91A 3BOVA 1NMBL 5B39B 4RFOL 1B0WA 3ETBF 4MCYB 4MZ3A 1BM3H 1NGWA 2PYEB 4YUEH 2RIKA 4DGYH 4NRZA 1W0WB 1I4FB 3M8OL 1LO3H 1XIWA 4MS8C 4HWBA 3ES6B 2R4SH 5EU5A 3GIZH 4UDTA 3VFWA 3N06B 2HTLD 5CEZE 3UZQA 1YYMH 4BQ6A 1ACZA 2BCKA 1HYSD 2OZ4L 3JSSA 3CPLB 5D1ZC 4NQVB 2X4SA 1TZIA 2DD8H 1EEQA 5T5NF 6FABL 3MRKB 5KJRL 1TQCB 1HIMH 1MIEH 1VFBA 4O4YH 1I3GH 4OCNC 1J8HD 3OJVC 4JM2C 3LEXA 1C5CH 1JZ8A 5HHME 2GJZB 5JO5A 3RPKA 1EEZA 3GMOB 3V52H 2VAAB 1LD9B 2C1PA 4JPIA 1DQDH 4LU5H 5EOCJ 3P11H 3DECA 4FQ2L 1XGPB 1NUDA 2WV3A 2W9EL 4NNYA 3ULUE 3FB5B 4MQ7A 2FCBA 1A3RH 3D85D 4NUJA 4ZAKA 2OJEA 1R3IH 2JCCE 1MRDH 1EDQA 3CMOL 4XVSH 1RURH 5GS3A 5F44A 4ODTH 4APQA 2GIYA 3LRSA 3VFOB 5DVNA 2LV4A 3JBG7 4JREB 2A74A 5TF0A 3U4BH 1QSFE 1IT9H 3GSVA 2GYSA 4U33A 4ODVH 3VFNA 3DO7A 1X9QA 2DMBA 4OCYL 1MVUA 3VXQA 3BISA 3IFOA 1AI1H 2X89D 1ZAGA 2ICWA 2OL3B 2WUCL 1K8DA 5E2WL 4HIJB 1D9KB 1A2YB 3U4EB 4WHTB 3ARVA 3MCKB 1S5HA 3TA3C 3T0EE 1KYOJ 1TQCC 1OPGH 3F12B 1T21B 3ZYZA 5HVFB 1LE5B 2CXGA 4PJHE 1R5VA 3EFDL 3ZTNH 1DBBL 3BDYH 3VDBA 2NY0C 1YNLH 3BZFA 3MJ9L 4EXPX 2JJSA 1PG7H 4Z7VF 3TVMA 3WXVH 4XGZB 3SDAD 3PWJA 1EHXA 1IQWL 3HC3H 3UYOD 4UV4H 4RAUA 2FO1A 1DP0A 4MCYA 2D31B 5ESAB 4JEGB 1PD6A 1YPZB 4CVZB 5L88L 4S0SD 5J1AB 3P77B 2IAMB 5D93B 1XF5B 4ZXBD 1FO0H 4WO4A 3ES6A 5JOPE 4GBXC 5A3ID 1QRND 4H1LB 3BVNB 1WC7B 3EFFB 4NO3B 4X8JA 1AY1H 1HZHH 2X7LB 4NNXA 1NQBA 2WK2A 3PDGA 1BFVH 2Y1VA 3ISWA 5KBNC 5LWYH 2AXGA 4NQXA 4YQXH 1UJ3C 3GMMA 3PP4H 5B3JE 1I9JH 3TPUB 2CLRB 1W0VB 5IVXA 1WSST 1HHHB 2ATPA 3QIUB 2YN3A 1MHPL 3D6GA 4I18B 3Q48A 2BMKA 1E4XI 5CGYC 1INDL 1A7QH 4XBGA 3AREA 4KDTC 3S97C 2EDQA 1P4IH 3QDHA 4PJ7E 3KPMB 5DUMH 5JW3H 4H26B 1U58A 3RZCA 1AO7E 1LO2H 4PP1C 3B43A 4Y1AE 1BAFH 3DUHA 3P73A 3S36H 3VFOA 2NY2B 2F53A 5D93C 4ZG1A 3VMOA 4WU7A 2GITA 5JHLH 1I9EA 3TZVD 4PJIA 1U8JB 3TIDB 5DS8A 3ARWA 4M03A 1MCLA 3PQYD 4OQTA 5F9JA 3GSUB 3WFHB 2HT3C 2IJ0C 3TT3H 1KCUL 4WHTA 4G42B 3WJJA 3MCKA 1JF1B 3MOAH 5JW5B 3AC0A 1EHLL 4C56A 1JMXA 1OTSC 4ZTOL 3EO9L 4WUKH 2AVGA 3QDGD 3RWEA 3QIUC 3MODH 1QR1A 3T0DA 3QUML 5ICXA 3TBYB 2V7NB 1YY9C 2W0FA 3UTTA 3I50H 5HHOE 1EEYA 1MOEA 5E8PB 5JPNB 5FYLL 4WUUB 4NO2B 1CGYA 4ELMF 4HWBH 1OY3B 3QUXD 2D31A 1X5GA 3QQ3B 5D5MF 3FO0L 4HQQH 3DV6B 3SGJA 2IAMA 4LVHB 3DVGA 2HVKB 3R1GH 2AQ1A 4MGXA 4AEHH 2QSVA 1U36A 3DUUB 4NBZB 3RY4A 2D4FA 3O2WL 1IFHH 5F7YC 4ZFOL 4D94A 1QZ1A 4YJZL 2K9UA 1HCVA 4YNYA 5GGTL 3SO3B 1YEKL 4PY7B 3GBMH 3B9VA 4Q6YA 3MRDA 1OB1A 2VXVH 4XAWL 3RZWA 5CZVL 4YXHH 1FIGH 2CLRA 5CMAB 1W0VA 3RL2B 1HHHA 5GGQH 4F7PB 2HMID 1U42A 2YRLA 1UH4A 3UCRA 4I18A 4L4TE 3GJEB 4V1DA 5C0RH 1MJUH 4LRIA 3WIIH 4TULL 4FTVE 4GSDL 3QT2A 4F58H 2ADIA 4Z5RB 3KPRB 1MCWM 5D2NE 3EHBC 4M7JL 4Q6IB 4O9HH 5HI4C 4D9RD 4LIQL 1RK1B 4MJIB 1MFCL 1KTDA 2AABH 4MB3A 2B7DT 3QG6B 5EZOL 3N9GH 3KPTA 3A6CH 1PDKA 4KI5C 4XMLH 2Q7YB 4GKNA 3GM8A 4KRPB 4M6MH 2ED8A 4PJBA 4M93C 4U0RB 2FB4L 4WTXA 4ODBD 43C9B 1VKXB 1YNKL 5GGRY 5F9WB 2PXYB 2B2XH 5IVZB 5J6GB 5HI5D 3AXLB 4ZD3L 3SO3C 4I9WD 2DQDL 3RPIB 1XH3B 1JF1A 1KCVH 1DBAL 3RDTB 3MRBB 5DGQA 3JWOL 4ZDHA 1HOCB 3H9HA 4IMLB 3NCJH 2J4WH 5GGSB 1T80A 4ZFFB 4QHKJ 2ZSWA 1Z5LA 4NGHH 3TBYA 4M7LT 4HZAA 5T3XE 5IF0A 3PP3K 2IEPA 2DWEB 4NO2A 1OGAA 1ZVSB 4KKAC 3U6RB 2RB8A 4FZ8H 4F15C 2H3NB 2ZNWA 3VXOA 5BS0E 4BH7A 5BV7B 2R2HB 2VISA 3MJ6A 3MRIB 3TIEB 3ULSB 3KNBA 4QRQB 4GRLD 2OK0H 5FOBB 2FJGB 4YHZL 5CEZL 1JNLH 2CDGB 4P2RB 1UM4L 4JQVA 1IEAA 5MI0B 3ARYA 1UXWB 3NGBB 2PO6B 3MUY1 5JHDA 1R24A 4YR6A 5F9WC 3HUJA 3C2SA 4P2QA 3NCFB 4GW1A 3EYUH 5TF1L 4M7ZB 1E0OB 4OLZH 2X1XR 4NHCH 1KG0B 3IDUA 3QUZC 2APFA 4F7PA 3FOLB 2WP3T 4WV1C 1JI2A 2IPTH 4KPHH 3TYFB 4WW2C 1OARH 1JN6A 4XP9H 1QHOA 4PJ9A 3ULUL 2JJVA 1S7RA 1ZSDB 1T83C 3KPRA 4FG6D 3R8BB 4HGMA 2QQKL 1RK1A 4MJIA 3CZJA 4YDKL 3NCCB 3VFPB 3GRWL 5EBLA 1G84A 3D39B 5JIKA 1X5YA 5JIIA 2Q7NA 5BV7C 1I1AB 4BH8A 2H9GB 5CCKH 5I1KL 1I1FA 1JYWA 4OQTH 2Q7YA 1TJHH 2CLVB 2R0WH 4FABH 1WCBB 4ZPTA 1FZJB 1TPXB 1F4YL 2R23B 3FFCD 4JFDE 1IE5A 2DICA 3CLFL 3NGBC 1CK0H 2BXZA 2RCSL 1OAZL 3WKML 1XH3A 5FF6A 4KVCL 3QISA 3PWPA 4POZD 4S2SB 3RDTA 3F58H 3MCLH 5F9OL 2J8UA 4P23D 4MA8H 4YPJA 3GBNL 3RL1A 4P5MA 4PJ8C 4WI3A 1C16B 4ZFFA 3G5VB 3L3GB 2NZIA 3UROR 3BDXA 3JV0A 3U83A 3NIDF 3K8KA 3FKUS 2YOCA 3TM6A 5GQBA 1IC7L 5AZ2H 2AK1L 3O6KL 5CD5C 5FO9A 5GHWL 5HVHC 3WNPA 1CLYL 4XCEB 2H3NA 1I1CA 1TJIL 1DANT 5A2FA 4KJYB 3TIEA 3I6LE 3CU1A 1JHKL 2BC4B 3ULSA 5E0QA 2R2BB 2NY5C 4EOWH 2FJGA 4HG4K 1U8QB 5IB5B 3OAYK 4PTTA 3VFRA 5IKCA 3TBSA 4QRUB 1UXWA 5I8KL 1P1ZB 3C2AL 2ARJB 3LPFA 2VQ1B 5FO7A 4CL7A 1U3HD 2BOBB 1MCOH 4EN3C 3REVB 5IBTH 3A6BH 4CU8A 1DEEB 2YA2A 1XAUA 3O4LB 4X5WB 1CWVA 5ID1B 3HI1B 4P2OD 3OKMA 2AJXH 4IRJA 5BRZE 1KG0A 1AGCA 5GS0H 3TYFA 1D7FA 4G9DB 5GRVL 1NCWL 3OGCA 1LP9A 1RZ7L 4JFZH 4UQ2B 4P3CH 1PGRB 1RZFL 5C0FB 4OD2A 4R97C 1SEBA 2ZG2A 4HW6A 4OLXH 1ADQA 1V3LA 3VMPA 3QSKB 2NTFB 4N0UE 3RNKA 3REWA 4TOYH 1YECL 2Z4QB 4KY1L 5I8CA 5CP3A 3FHQA 4UDUB 4CMHB 3V4VH 3D39A 1H3PL 2B1AL 4DZBA 3DHMA 5LJYH 5D1XA 4ZOAA 3HFML 5DFVC 3VGAB 5C0GB 2F5AL 2K1MA 3VD3A 1G0YR 4IDJH 5K9QI 2L4OA 1Z9SA 1T66D 5TE4H 1WCQA 4L8BB 5CINL 1EFXA 4ETQB 5M94B 1RK0B 4P4KD 5D6DC 2YMXL 4LDOB 4JO2H 1IAII 2IC2A 5E2UL 4FQCH 1AXTL 1QHPA 2RBLA 3H2WA 4E9LA 5J12C 4PGEA 4AL8H 5FFLA 3UAJD 4X7CC 5C0BE 2XQYG 2HLFD 2V6HA 2VXUL 4OB5H 2MMXA 4GXUN 4U7SA 4WEUD 5C0IA 1C16A 1VPOH 3G5VA 4L4VD 4NQCD 5C0AD 3GZKA 3AS0A 4PJEA 3DWTA 4KUZH 1I7TB 2BNQE 3T1WA 3FQWA 1JUFA 1JF5A 1VFMA 1FE8L 4BELD 5JMRA 3HB3C 5JXAL 1FFRA 4WRLA 1J8HB 4XCEA 3TCLA 1CICD 1IGTB 1OCWH 2VIRB 4KJYA 4CMHC 2BC4A 2BY0A 4ZNCD 4M9PA 3D9AH 1B6DA 1V3JA 4M48L 1MUJB 1LO4H 4DKFL 4YHYB 1UCTA 4QRUA 4F57H 1FV1B 2ARJA 3B5TA 1QLRA 1KC5L 3UEZA 3GGWA 3D85B 1MFEH 3OKLA 2BOBA 5DJ0A 2DWDB 5JNYB 4K55A 2XIDA 2BNUA 4P9HC 4XBPA 4RFEA 5IWLA 3IETB 1NAMB 1UWXK 3T1FA 3O4LA 2X4TA 4AH2A 2YPLD 3QQ4B 1NGXB 1OGTB 4P4RB 4QOKB 4ZUSB 4LVNB 5GGSY 4RAVB 5TGBA 4RGOH 1NLBL 4OD1L 4AJ0A 1PJ9A 4IS6A 4M4RA 2B20A 4K8RD 2VWEC 2PTVA 3GMLA 5C0FA 3LSOB 1S5IL 1JHTB 4NJ9H 5DJ6B 3H0TB 4LPYA 1MCCA 3RU8H 4WI7A 3BIKB 4KKLD 4U6TA 2GJ6A 5FV2A 1G6RB 3QPQD 3RWCA 4EUPB 2P4AB 1DZBA 1CGTA 4NNPL 1UYWH 2YPKA 4X6DF 1FNEB 3SBWC 1SHMA 3K8MA 2P8MB 3O0RL 2DLEA 5C0GA 4YFEA 4R3SA 5KANI 3EYVA 1P84J 2XN9E 3SDAB 5TQ0H 2DRUA 1CVRA 1KJ3L 4YHYC 1J0JA 4LPUA 1T3FB 1U8OA 2W9DH 4PIRF 2PNDA 3CZFA 4ELKB 3WL9B 2XWJB 1WZLA 2HT2C 2R15A 5DC0A 3TFKD 3GSRA 3IJYB 1MHHA 3QRGL 4N90E 1BZ9A 1KIUA 5IMMB 4ZXBB 1SJHB 4I0CC 5B38B 4N8VB 3MV11 2GTWB 5T3XL 2YK1L 4LVNC 2NNAB 5AWNL 4G8EB 1FZKB 5FK9A 3MLUL 3TP4A 2WBKA 3M17A 5EUOF 3WIHA 4TUOB 4I77H 4HH9A 2Q6WA 5I1LB 3RTQC 3V7AE 3U46A 2EYTB 5KVGH 4Q9BA 4QRTB 4XH2B 4CBPA 5HPMA 4CJ0A 1OP9A 3IGAA 2A77L 2ADJA 3PUCA 4GG8A 1QSZA 5KAQF 2YPVL 3D3VD 4QHNA 4L8DA 1ZA3A 1MUJA 1X4ZA 1ZLWH 4RMSA 2XXMB 3IDJB 3OAZK 1QD0A 4RZCB 1P4BH 4EI6B 1JJUA 4TVPD 2XZCH 1UEYA 5DR5H 2BRRL 4X6CF 5HYSB 3AS2A 5FUCE 2HKHL 4LF3B 2BHYA 3MBED 4JHWL 3S3PA 4HV8A 4XHJC 5EU6D 1NGXA 4LSQH 1QO3B 5AYQA 2X4NB 4ZUSA 3VWJC 1ADQH 4MYWB 2DQHL 1P7QD 1KLGB 1AQKL