5DMKA

Crystal structure of iag7 in complex with rlgl-we14
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
IEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-D alpha chain
publication title N-terminal additions to the WE14 peptide of chromogranin A create strong autoantigen agonists in type 1 diabetes.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 171
sequence length 171
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmkA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5dmkA01
1A4JA 1P1ZA 3O11A 4QY8A 4QKXB 2EIDA 4YZFE 4C56E 3MUHL 1CGSH 3U7YH 1HHGB 1DEEA 4ZDHB 4Z6AT 1TVHA 5T1DL 3MRKB 2QADB 4F9PC 3GDBA 5JDSB 4HIEA 1ZLUH 2J6EH 5DUBB 1WEJL 5IB3A 3PF2A 3W39B 3ES6A 3O4LB 1QSFA 4OCSL 1A7NH 1WFUA 5JORB 4QTIL 4NO0D 4ODSL 2C9AA 4JG1L 5E6ID 5IVOA 3W11D 4TSAL 3B9KA 4C59B 4JHAH 2FLRT 4HXBH 1PY9A 3MREA 4JRXE 3RDTB 4QRRB 3TLRA 3CSGA 1J0IA 5JTWA 2ZCKL 4RISL 1RQ5A 4JPWL 4NKDA 1TXKA 3KPLA 1J7VR 2EO9A 5CSBA 2CIIA 2OL3B 4XP6H 3ZKSD 2XWJA 3EFDL 2A74B 4KAQH 4WU7B 4PJDB 5CJQL 1AXSA 3DURA 4HUNB 4TSBL 5EUKA 1MEXL 3LHPL 2B5IC 3GBNL 1LDPH 3A6BH 4RMSA 3ROOB 5DJCA 1IC1A 3ARWA 3L3OB 3OF6A 4U7SA 5IEKB 1EEYA 1KNOB 4PJEA 1W0YT 5E2TL 2J88H 4KROC 4ZTOL 5F3BB 3WSQH 3K2UH 3MCG1 3V2AR 3PV7A 1NCWL 2WLYA 2Y36L 4WWKC 15C8L 5FYJU 5MENA 5ERWB 5IW6B 4KJPC 4YX2L 3PGCA 4OTXH 1NUGA 4AG4H 2J12B 5F9OH 1QFPA 5EU5B 3KLHD 1DVFB 1HYRC 3L6FB 1HKFA 3BEVA 1F3DH 1F4WL 3E3QC 5I1DA 3T1WA 2B4CC 2O5XH 1S7QB 4EI5A 1U95B 1DUYB 1KB5B 3G5ZA 5F71A 3VXTB 1JV5B 5HYSA 1NFKA 3PE9A 5EU6E 4UDUB 1TFHA 5T5NG 4WW2A 4O4YL 1GRWA 3D3VB 1UXSA 2B5IB 4PJ9A 1S7XB 3OJVC 3RTQD 5SWQA 2P44B 2LTQC 1MQKH 3QEQB 1PGRB 5EOQH 3VDAA 3MZTA 2QSTA 1W0VB 1LK3H 1K4CB 4KROB 3OGCA 2ILLA 5EU7E 5GGTA 3SN6N 2ZOLA 2DLHA 5DJYB 1FBIH 5D1QD 5KSVB 4QHNB 5DJXB 4P2RB 5F9WC 1DBBH 4NRYB 5DGRA 2BOCB 3C87A 5KSAB 1JUFA 4WJ5B 2Y6SC 2A6IA 5KSBE 2HH0L 2V17H 4OLXL 1CQKA 1ZHKB 5DJ8A 1I1AA 1VFBA 4JFDB 2E27H 2YKLL 1F13A 1AI1L 1WZMA 4KK5D 3OSKA 1C7SA 3OKNB 2APFA 3VMOA 5CGTA 2PXYD 3OWEA 4NOBA 4B50A 3QG7L 1PW3A 3O0RH 3Q5YA 4L4VD 4K7PY 3I9GH 2J8UA 1IQWL 3NTCL 2ATPB 4LP4A 3LD8C 2VDRH 3O3DB 3LKSA 4JREC 1HKLH 4XVUD 5JO5A 3QDJE 4MDIA 2LTQB 1ZLWH 1IL1B 3ARXA 3KYNB 2YEZB 3QSKB 4LNRA 4MVBD 2CDFB 1BLNB 3L5WB 4OZIA 4UBDD 5GGTH 1SEQL 3I6KB 4V1DD 2DQCL 4ZFZA 1BGXL 5GS0D 2BNQD 4IRJA 3S3SA 3BAEH 2JIXB 1YMHA 1EHLH 2AK4A 5F9WB 5T1KB 2GTZA 5EBLA 3QIUD 3WUWG 2R56H 1KPVB 3LEYL 5IMMB 4WTXA 5F1OB 3OKOA 3HMWL 1IGIL 3C5SB 4OSUL 5GGUA 3VD5A 3MYJA 3B6SB 4OZ4B 2IFGA 1V3MA 3ZT7A 3QNXA 5I1LA 4PJ8A 2VLJA 1X5IA 1AHWC 1BD2E 4NWUH 5E6ZA 1TVDA 2C1OA 1H5BA 1EBPA 1R5IB 4K55A 3AU1A 2EDOA 3LD8B 3WNPA 5DQJB 4JREB 5IGXL 5J1AA 3FB7B 1AKJD 5CP3A 3UTZB 1F00I 3SKOA 4XNQB 2P48B 2EYTA 2P8MA 1KV3A 3VG9C 3O45A 3KYMB 3MUY1 2XWBA 5K9OA 1BHGA 4PB9H 3N85H 2DJ4A 4HDIB 2APTA 4Y19E 3F6LA 1I9JL 1FNFA 4GQPH 4NUJB 5JLZA 3T2PA 4CN1A 3DTXB 3EW3B 3D0VB 3X3FH 4MXQD 1CD1A 1XZ0B 2ZUVA 3QO1B 5FA3A 2H32H 3JWDC 3LRGA 3CVIL 3QBTB 3OXRB 4NO2B 1C08A 1NL0H 5FHAL 4PJXA 4Y5VC 1AJ7L 1AHWB 2ICWB 1PEZA 4HZLA 1S8DA 4YHMH 2CR6A 4NCC2 4QGTA 1H3PH 3CVHH 4U0QB 5SX4I 5DEFA 5HBBA 3FMGH 2FJGB 3IU4H 1A7BA 4ZO9A 2FX9L 3QG6B 3TCLB 1TZHB 4U05A 3TN0B 3T77B 1LO4L 4TULH 3K1KC 2CJUH 4K71B 2X4UA 5CP3H 3AGVA 1KENH 1FH5H 3MXWH 4D0CB 3MUJA 5CSGA 3L95B 4HG4K 1KCKA 3QCTL 4KUCF 1LEIB 2XYCA 4TUOA 1S9YA 4WO4A 4DZBB 4EDWL 1UM4L 2ARJB 3FRPA 4NZTH 1ONQB 1UM5L 3IDUA 1ZOXA 1EHXA 5K33A 2LU4A 5AYUH 5HDBF 3IDIB 2CLZA 2NX5B 3CXDL 4YE4H 3EYUH 3HC4H 5CJ5A 3UTSD 1SYSA 3BKML 1TJIH 3AAZB 5GRYA 3DUSB 4DAGH 4RWYL 3TBVA 1A9EA 3TBYA 3T04D 3QNZB 5DD3H 3GRWH 5KVFH 4MWFB 4OZHF 4Y5VB 4OD3H 4ZXBD 1II4E 3O9WA 5I1HL 4H1LB 3BZFB 4LQ1A 3T0WA 4DN3H 1KCVL 1JYXA 4M1GL 5FM5M 3U83A 1CGSL 2HLFD 3U7YL 2DTML 3P0VH 1J0HA 5F7YC 2A6KB 4F3FA 3QIBC 3PNWA 3QCVL 5IWLA 1T1YA 4O00A 4E5XA 4ELMF 1H8SA 1MH5A 3PWNB 2JB5H 4KXZI 1FL6B 1T5XB 5GISH 1Q38A 3CFIC 2MJWA 4JFOA 1YNTB 5HHNA 5B22A 3ARBD 2VZ1A 2JB6B 4RNRA 3VRIB 3NA9H 3S3PA 1UB5A 3FB5A 5CBAB 1CZ8H 3CC5B 3RZWA 3GSXB 1SMOA 3SDDD 1FVCB 1Q9WB 3VH8B 3RNQA 2WWKO 4H8WC 5KBNC 1G84A 3BGFC 5B8CC 4ZUSA 1GZPB 5DJ0A 3MJ9H 4K8RH 1CL7I 2A1WH 4WI8A 1IKNA 2MWCA 4LKCA 2A77L 3I6GA 5EU4B 2FYYB 3RA7H 3PQYB 5BVJA 5C0AA 1P84K 4ZFGH 2WP3O 3WE6A 4WEMB 1E28A 3VWJC 4NQVA 3TBSA 3LSOA 3SQOH 2IH1A 4KQ4H 4QOKB 3QUZC 3WLBB 2VIRB 3RJDA 5GJSL 3QIBB 5EZJA 5FK9B 1PKQA 1U8KB 2J88L 2AXFB 4F7CA 4OGYH 4TVPD 4YK4B 2HJLA 5EG6C 3WIHA 3IXAA 5E8EA 5FUZL 3RX7A 3MRFB 3EO0B 3MR9A 4GMTL 1HEZA 1X4YA 3O6LH 4AG4L 1GCFA 4K3DL 2C3XA 5F9OL 3LQAH 3DI2B 3F7YB 3HI6L 1S7SA 3L3HA 2O5YH 2GUOB 3ROLB 1NC4A 5TQ0L 1YQ2A 5BZDA 2OJZH 2P47B 4OCWH 2DQTL 5K9QG 5IBLD 4M4PA 4YBQC 2UV3A 3DRQA 4QRPA 4NQDD 1HXYB 4ZG1A 1QHOA 2BNQE 2VLKA 1RZ8B 4KRPD 5D7IA 5EZIH 4MJIB 4NUGH 3KPMB 3ZKMC 1NCAH 3VWJB 5KZCB 1JZ8A 5F1SA 1U2CA 5F89B 5K9JH 4JO2L 4OQTH 5MEQB 3GK8H 3B5GA 4BZ2L 4NHUA 4JM2C 5EOQL 3T65B 3C6LA 2AJUL 4PUBH 1D9KC 2VDKL 4ONOA 5CEXB 2JCCA 4Y4HC 4L4TB 1N5AA 1ADQH 1OSPL 2BXZA 4PJ5B 4Z77A 3QNYA 5HHVH 2W0FB 1FBIL 1HWGB 5KVDH 4ZS7H 4Z78A 2E7LC 4HUXA 4HIJA 5HI5D 2MCPH 5EN2B 2H2SD 4XB8A 2V17L 4JG0L 3QO0B 3MODL 4LPTA 1GGBL 2H8PA 1MWAA 5C09D 2NY3D 2FO4B 3QWOB 3IAQA 3SDCA 1MI5D 1MY7A 4D9RD 1EGJA 1ZLUK 1C16A 4YPGB 5DC9B 3ZO0A 1MVUA 3HC0A 1GYAA 2VLRA 2IGFH 3DO7B 5C0DA 4B7LA 12E8L 4YQXH 5IOPA 3K80A 3OAUH 4NNXB 1KJMB 4PV9A 4RGNC 2VZ3A 2IWGA 4HIXL 5F7NC 1GC1C 1X44A 2V9RA 2NXYC 1I7ZB 3MROB 5DURD 3IXTB 3HPLA 4X4ME 1CICC 2LE9A 1HI6A 3BKCL 4HS3A 1NEUA 5KSUB 1HKLL 1U8MB 5DQ9A 4BM7A 3GMRA 4O51B 2NY5C 4U1SB 2X4NA 3BP6B 4JM2B 2ATKA 3ARFC 2OI9C 3A6CH 1D9KB 1XT5A 4Y4HB 5ALCL 1TTFA 4KI5F 5D7KE 5GGRA 1BZ7A 5GGTL 2P8LB 4LLDA 2DQUH 5ICYB 5JOFA 1NGPH 1FNAA 3MA7A 3U46B 3EYOB 4YWGH 4PJIA 2E9IA 1QFWL 2AEPH 4BK4A 5D7JC 2EECA 1EFXD 4NRXA 4UUJB 1NGXA 3H9YA 3GSVA 5CGMA 2BNRB 3TO4D 2DLGA 4G5ZH 5BJTA 5JW4Q 1JE6A 4U6VL 1V8HA 1M4KA 2LABA 4HIHB 4RMRA 1FNSH 4R3SA 5AZEH 4KTYA 4K9EL 4LPCA 2MKWA 5L9DH 5E08H 4FFZL 5F6IC 1U8IB 3VXPB 3P4LA 3CFEA 5IQ7H 4LCWA 5JIPA 5BS0E 4RGNB 3QAZB 4LGRB 4YR6B 1U58B 3JWNC 4IOIA 3NIGF 3T0BA 2APVA 4V2BA 4NWUL 2NXYB 3CMOH 2VDNL 5INCB 3PWVB 3ULUD 2FL5B 2W60B 3IU3A 5IEHB 1CICB 1E4WL 5C71A 4DKEL 4LBEB 1EJ6A 4FQQA 3TF7C 4Z18A 3UTSE 3NMEA 2OI9B 5HY9A 4YDKH 4OD1L 4M7KL 5E9DE 3IFOB 1YMME 3N85L 4P5TD 1PQZB 3D69A 2OL3H 3ZE2E 1KB9J 3ZMRA 3KYKH 3V7MA 1Q0YH 4P9HH 4HULB 3WIIH 4QXTB 3B83A 4FQXA 5C0EB 2XFXA 3S98A 1XCTB 5FYJD 2EH8H 4MQ7A 3ECBA 5F6IB 5A2FA 3NH7L 4ZOEA 5LCVH 1NL0L 2ORBL 2DAVA 5E24E 1Z3GH 2CLVB 4QCIA 3OR7B 1H3PL 3CVHL 3IU4L 3T0XA 1P7QD 4HFUL 4PP2B 4JRXB 5HPMB 1MAJA 1H3TA 4TULL 4I2XE 1F3JB 4R97C 5ACMA 1TZGH 5BXFA 4ZS6D 4GS7C 3MXWL 4I13B 4AL8L 5D1XA 5T1LD 2HAZA 2AJVH 3HZYA 3WFBL 4PBWD 2RGSA 2P5EA 3MRIA 4QHUA 2VDMH 2ZOKB 2D2OA 1MCJA 1KJ3H 1Y0LB 4UOJA 4HLJA 1KB5H 4ACPA 5I2IB 3MLWL 4S2SA 5ALBL 2HFTA 3KPRA 2AJZA 1D5ZB 1T5WA 1YN7A 5AYUL 2NLJA 3OBAA 1NCBH 1KOAA 1ZLWK 4PJEF 5DFWH 1BQHA 1YYMH 4HAGA 4YE4L 2R2CA 4XPGH 1D5MB 1QRND 5J11C 5D7LB 5EU7C 2VE6A 1NDGB 3O2WL 4KKCC 1OWRM 2HVJA 5DD3L 1CFNA 2BSED 1JPTL 5D8JH 3T0EA 4F7EA 5I76B 2ADGA 1GGIH 1X5GA 4TVPE 4AH2B 3TYFA 1VACB 4GUPA 1NCUA 1Y6MR 1QEWB 3CNKA 3QFJE 2D7NA 3FB8B 2IAMC 3D2UA 4JR9L 3BFOA 1MIMH 4HK0A 3TNNB 4GS7B 1CXIA 2HFFB 1C5DB 3KLAA 4W81A 4GBXD 4TUKL 3RGVC 3ULVC 2EIZB 1IZKA 4J4PC 5E2UH 1T20A 5DJ6B 1OP5H 1A2YA 4WW2F 1B0RB 4YHPA 4MA3A 5SWSA 2UWEE 2VXTH 3MRGB 5I8KH 2JB5L 2VXSL 3EYFB 3CFJB 5I16A 3TPUA 3BZEA 1AQDA 1L0XA 3LN5B 1T0NB 5E2VH 4NQDE 1CXLA 5HI4D 3I75A 5IIEB 4PJFE 2PW2A 5D2NC 1RI8A 2PYEA 5J11B 4N8CL 1A7QL 3D18B 5E8PA 5IVXE 3H42H 4QHKI 1SVCP 4JZJB 4K8RL 5JIKA 2A1WL 4IOSD 2FRGP 2GCYB 5EBMA 1KIRB 4M93C 4CKVX 3KS0H 3RA7L 2YPKA 4WV1C 4PRHA 3BH9A 1W0WB 5HGHA 3F7RA 3X17A 2MQ3A 4QT5A 5JOPD 2IAMB 2DM7A 4Z0XB 3P2TA 1OW0A 1FV1B 3SQOL 1NC2A 4P2CG 3VFVA 4P59L 4HC1A 3HG1E 4B5EA 3RGVB 2VERN 1MI5E 4ISVB 1V05A 3QEUA 2P24A 2VDOL 5LQBL 2J8UF 4OGYL 3VFTA 3E0GA 4D8PA 3GBML 4UT7H 3T8XB 3IVKA 3LKRB 3LRHA 5JW4N 3GI8H 1CG9A 4NT6A 1QVOB 3VFUA 1Z9OA 4OZIF 4X6DE 2YD3A 4MA8H 3O6LL 3KDMB 3L3DA 5D2NB 1AO7B 3LQAL 1BQSA 4J2XA 4JFED 1F4YL 4G9FA 3TVMA 3MV9A 2F74B 2VSDA 2YMXL 3BH8B 3S4SG 3V6BR 4M5YH 3NIDE 4KV5F 1J5OL 3DHJA 3Q6GL 5EZIL 2NNAA 3RWFA 1CYGA 2XNAB 1T7YA 4POUB 2NQCA 4J3UA 5C6WH 4LIQE 1RK1B 5L2JB 5M7QA 1N3NA 4OQTL 3GK8L 5CJ8A 3QI9B 4N90D 5BO1L 1CDBA 3KNBA 3R4DA 4PUBL 3REVB 5IQ9A 3ZLQC 4YXKL 3X13B 5CEZD 3G08B 3HAEG 5C7XH 5GZND 3FFCA 1GGYA 4U1GB 3DX8B 3WIHL 4F7TA 4NC0B 5DC4B 5DD1L 4X6CF 5KVDL 2B20A 5E6IC 4E0RB 3ILPA 3D1MC 1YUHB 2DICA 1T7VA 3GMOB 3L1OL 3OG6B 2DKUA 4JN2B 3RVUD 5CILH 1NCDH 4YEEA 4OF7A 5JR1H 2XG5A 3S9DB 3D39D 3HZVA 2DQHL 3W9DA 4MD0A 3IDXL 5TF1L 3I02A 4RDQF 1J05B 2VL5A 4JFQB 4Y16D 1CFVL 2CK0H 3QPXH 1L6XA 2FH8A 3LKOA 4XCYB 3QDGA 3GHBH 5CLWA 3N1GC 1XGYH 4HZAA 4KQ3L 2NZ9D 2XQYK 1UB6A 5D72H 4LQFH 4GMSL 3SKNA 3TO2A 3MFGB 2XZQH 3HC3L 3P73B 4OV5B 3FONA 4JCLA 5JW5A 1H3WM 4PJXF 4PJCE 4HUMB 4R26H 4CVZA 4ZSOA 2CUMA 2BVPA 5B3JF 5FYJE 1JJUA 1G0YR 5M95B 1HIMH 2H26B 3JWDH 4MQXD 4GXUN 3VDBA 1NGPL 4OFYD 1FL5B 4GW5B 5HGBB 3OKMB 3ALXA 3CMGA 1EJOH 2VABB 4NO0B 3GMQB 1P2CB 4NO3A 2BRRL 1TPXC 4H1LH 4G5ZL 5EFIB 1BWMA 1F45A 1FNSL 3KLHC 3KPSB 4FHBD 1EGJL 1UQSA 4LLYA 4Q0XL 1KN4H 4HS8H 1IGMH 1U8PB 5L9DL 3LEXA 5ELIA 3MLTA 1XGTA 2EYRB 1M1SA 4DFHA 4KJYA 5CHNA 4E42A 1RJLA 4PRBB 5ESQA 3R0MA 4LK4A 1A7OH 2DIJA 3QDMA 1A5FL 3RTQC 5JW3H 1WICA 3IFNH 1KTDA 1KPUB 1IILE 3U0TB 2COQA 1AP2A 4HH8A 5T33H 1XF3A 3GSOB 1QRNE 3VWKD 2BVYA 3RI5K 1T1XB 5A2KH 3IDJA 4KJWD 2R15A 4BKLB 5D1QC 3FOLB 4TTGA 3RWCB 3LRSA 5E5UB 4D0BA 3QIWA 1YPZA 3SKMB 5MEOA 1TZIB 3U6RA 4ODTH 5GSRA 4P9HL 1TPXB 4I5BA 4LLVA 4N0UE 3WFEL 3VFOA 3FHQA 5DD6A 4EXKA 5AAMA 1G7HB 3P9MA 4CVWA 1HCVA 1NEZG 4KK5C 3BD5A 5F88A 4ZNEE 1X6NA 4OLYL 5EBWA 5ID1B 2ZSWA 4KWUA 4ZUUB 5FCUL 2XN9A 4DFIA 2PXYC 3EZJB 3UZQA 3V79C 3S36X 4KUZH 1J8KA 4OV6F 4LSSL 5DRWB 4FABL 1OARL 1E4KA 1UKTA 3FO0L 5INDB 3TH2T 4YHZH 1QKZH 2W91A 4RRPG 3RTQB 4XVUC 4NKOB 4ZUTB 1TZGL 1XF5A 5LGHL 4R8WH 1QBMH 2R2HB 3WUWB 3WCYA 4UDTB 3GSNA 4RSVA 4UBDC 1K5NB 2VL4A 4O02H 1AGBA 1R24A 2V7HA 2VDML 5GS0C 4Y88A 1NUDA 1KJ3L 3PP4L 4K3JH 5D1QB 1IM9A 2X40A 3D0LB 1LO3H 2ZPKL 5C6PB 3QIUC 1GOGA 1JPST 4AYFA 4GAYA 3BVNA 1OM3H 2ZUUA 4Y2OA 5DFTA 1TQBC 4ZPVA 3QHFL 3TCXA 3O3AB 4BH7A 4AEIL 3OB0H 2FHFA 3RUGA 2PCPA 5JOPE 2FB4H 3G6AA 3VFSB 2EDFA 1CTOA 2A38A 4S1SH 3FO9A 1H15B 2AABH 3L9RB 4FXGA 1D5BA 2V5YA 4JN1L 1ZWIA 4CDGC 3GUTB 3VMNA 1H0DA 2PXYB 5F96H 1MCIA 3RVVD 3VA6A 2BZDA 2WNGA 4MAUL 2RIKA 4L4VB 1KGCD 4PJAB 1J9CT 3O2VH 5J12C 3DVGA 4WTZA 2YZ1A 4ETQA 4FS0A 3SE8L 3TGXA 1ZHNA 4M3JA 3KYAA 4NQCD 3I6LD 2IC2A 4K3GA 1AR2A 4R4BB 2Z35A 3WFCH 3RFZC 1MHHA 4S1RL 1KELL 2B2XL 4UTAH 3THMH 4XC3H 2I27N 4V1DB 4DUXA 5D7IF 1WBXA 2BNQB 2GK0B 4PJHE 4PGCA 4DGYH 3GO1L 5I8KL 2CMRL 2IADA 3QIUB 3LVEA 3LMJL 3LS4L 4NKQB 1X5XA 4AT6A 4R9HA 5IMOB 2IAND 4X8JB 2JCCF 1AGFA 1TQBB 4GRLB 5FA4B 2WINB 4LRNH 4MXQC 3QUMA 4GW1A 3KYOB 3HMXH 3L7EA 1R3JB 2R2EA 5K9KA 5CEYA 4N90E 5IW1A 3T2NH 4H0HB 4P3CH 1U3JA 1NDMB 4F57H 4LEXH 4N0CD 5HJ3B 5IFHL 1QFOA 2QHLA 1OGTA 5J12B 1SBSH 4Z5RA 4JDTH 3BEWB 3QRGH 1L9MA 5FXCH 5IKCA 1AKJB 4YO0A 5GHWH 4EIZC 5F6HI 1IAOA 4HHAB 3CXHJ 2HT4C 4GG6A 3VXME 2FNBA 2DJSA 3DO3A 4MJ6A 1RUQH 2M2DA 1X5YA 4UB0L 1UJ3C 1SJXA 1WC7B 3KLDA 1QLRA 1U8JB 3MLZL 5GGSB 1JZ6A 4ZUWA 2BFVH 2XTJD 2QSCL 3U4AA 3WS6C 1QFUL 3BKYH 3T3PE 4MZ2A 4PJ7E 3FL7A 3VFWA 3RP1A 1P4IL 2VJXA 3CCHB 3F7PC 4X80L 4PGDB 3KAAA 4LARL 3O2DA 1OB1B 3EDDA 4U1KB 4PJIF 1A3RH 5FOBA 2OR7A 4WNQB 3G6JA 2BHUA 1NFDB 4HBCH 4PG2C 1DEDA 1R0AH 3RHWF 5FUCE 4FZEH 4R7NA 1YY8A 4GRWE 3HZKA 4ZXBC 4HGWA 1GHFH 4JHWH 5HVFB 1BP3B 3RPIB 2P1YA 4AM0A 2R2BB 4FFYL 3GIZH 3GNMH 1IQDA 3GJFH 4ONGH 3RY6A 5IF0A 4Z7UE 2E9JA 2HLFC 4ZYKB 4JFPA 2V7NA 2A6JA 5EC2A 3NABH 5DMIH 3V52H 1NBZA 1I1FB 5EB9A 1P7KA 3L3JA 5C6TL 4WHYH 3JWOL 1CGUA 4XNXH 4XBGA 4MD5A 1H9VA 3ARBC 2Q8BH 2HJFB 2WMPA 4NRZA 5L2KD 2YBRB 1T3FA 5DJZA 1U8NA 2D4DA 5E7FA 3U36A 1VHPA 5IG7B 1OP5K 3T0VA 5CILL 5F7DB 3SDDC 1QSED 1ROWA 4JDZA 4X5XA 5JR1L 1KJ2A 5DS8B 3SE4C 3B3IB 2R1XA 5HHQB 4CW1A 3IF1A 4MNGE 2QKIA 4ZXBB 4QRSB 5BRZD 5C0FA 3QPXL 4HGMA 4J8RB 1HH6A 2N7AA 3MRJA 3BE1H 2F8XC 2GT9B 4Z0BH 1XGYL 1C12A 2QQLH 1KCRH 4NDMB 4HV8B 4OM0L 3WIFA 4L8DA 2R1YA 5GRUH 4UMGA 4UV7H 5H94B 4U6HA 3U0PA 2PO6D 5I1GH 1WCBB 3BSZH 5FDWB 1DE4A 4YXLL 1BM3L 4QYOA 4ODXA 4ODBD 2PTTA 1BBJB 1EO8H 3SY0B 5KW9H 1AY1H 3MRHA 4LLQB 1U91B 3IKCB 3BWUC 4E9LA 5DD5L 4LKXA 1SM3H 1RZFH 5CSZA 1IAMA 3P40A 2XV6B 2L0DA 3UYRH 2R69H 3V6OE 1E0OB 1S7TB 2BVUA 3VD4A 1KN4L 4X7CC 1IGML 2ZWLT 5D6CA 3ULSB 4IMKA 5I18H 2IBBA 1VGEH 5IBLC 4LSTH 2X4RA 2XA3A 3BN3B 5D93C 2OZ4H 4KRPC 1JF5A 4KZEH 4BH8B 4ONFH 4YFLI 5JQHC 2Q6WA 3QQ3A 1IGCL 4RMQA 5E70A 2YXFA 5HHPA 1ZA6B 5FGCB 3QQ9D 3EGSA 1E4XL 2F19H 1YDPB 2Z91B 4C55A 3IFPA 1MCFA 3HE7D 1D6VH 3MOQA 4HWEL 3CH1B 4HWBA 1OT2A 1OF2B 5HI5C 1JRHH 2J1KA 2H2SC 5D7SH 1KGCE 5IM7A 1FORH 5KANG 3MMEA 4ODTL 2YD9A 5E1AA 1AGCB 1YJDL 3KG5A 4PS4H 4PRIA 4YHLH 5HI3D 4AEHH 5C3TA 2AV7A 5A43C 4NQCE 5L88H 3I6LE 5DWUH 1B3JA 1QFHA 1FFOB 3SDXA 2UWEB 2ZUTA 4QXUH 3ULVH 5IB5B 5I9QC 4NQDB 1RUML 4Y4KB 2G60H 2YN3A 5D93B 32C2B 4CJ1A 3N50A 3E2HB 4KRPB 1DQMH 1WBYA 2Y5TA 1R3KA 5FHBL 3MLXH 3QISA 3BPLC 3FT4A 3IB4A 5E8DH 4LHJB 3ZDYF 2IANE 4JANA 4F15C 3MBED 4DGVL 1I8LA 3N9GH 4I0KA 4TPRL 1CE1H 5IB4A 1MFBH 2YK1H 5IVXB 5HSFA 2CRIA 1AGEA 3F7QA 1F90H 1ETZA 3TT3H 4K23H 5TPWH 2Q76B 1GH7A 4M7JH 3VGHA 2VXVL 4GRMB 3TO4C 1IEAA 1T80A 1XGQA 1KIQB 5C09B 1HILB 2NY3B 3UBXA 4L29A 4L9LA 4QRTB 4P3WA 1I8MB 2OK0H 2C7UB 2R23B 5GSVB 4X5WA 4Y5XC 2VR4A 4P4RB 2HJKA 5KOVC 1B4JL 4M8QB 1YQVH 1DLHB 3GSUB 3H0TA 1HXMA 3GMPB 5H37G 5DURB 4R4ND 3BQUA 3DXAB 3RVWD 2EXYD 3O3UN 3ULUC 2E7CA 1AD0B 2IG2H 5GRJH 1MCOL 2XTJE 3BPLB 1ODAA 4C4KO 3IDNA 2NY0B 3PHOA 3ZKXC 4F15B 1FFNB 3GSNL 3HCVA 4YFDB 4JKKA 4AENB 4UTAL 4P5TC 4GKSB 4J6RL 5ID0A 3SHSA 4HIIB 4DGYL 2QQKH 3QUXA 5JA8B 1WF5A 1AQKL 1ZVYA 4L8BB 5IHUH 1QSFD 4Q9QH 4E41A 4J3TA 4LSQL 4XNYH 5CWSA 1KC5L 2IJ0C 3VXRA 4NNYB 5ANMA 3B9KD 2SEBB 1GOFA 5C0CA 2FX8H 1M7IB 2G5BB 5IHBA 4Y5XB 4PRPB 1F2XK 3BKJH 3UPRA 5HGDA 3VFMB 1RJYA 3FQRB 4JLRA 4P3CL 4YHIB 4KKLD 2E9BA 4DKFH 5FKPA 2WUBL 2QTEA 2X4QB 2X89A 1G0DA 1SBSL 4NBZB 5I71B 3BJLA 3UDWA 1IFHL 4O58H 3HLAA 4S0TD 3IETA 4FMKA 3VRJB 5L2KE 2NPLX 4ZS6C 5GIRA 1JN6B 3ZKXB 1KJVA 5IMKA 2XRAH 3LIZH 4OZFA 1T1WB 4ZNCD 2WLZA 1XF2A 2VZTA 4WW1B 3VD7A 3RVTD 3NBNA 4U1JA 3JTTB 4BQCA 1G7QA 1QLEH 2LQRA 2HMID 4ODUA 1QSEE 3ZYJA 5EUOE 1U8QA 3GIVB 3VFPA 5SWZA 5GGRY 2DDQH 3T3MF 2GTWB 3GM8A 4C83A 3DIFA 1V7NL 4F80A 4JFFE 2MNUA 3Q1SL 4GLRH 5BRZE 2BFVL 4HEME 5TFSH 5KG9A 2YS4A 3BKYL 1IARB 1B0WA 1IEBA 2FECL 4P2QD 4RMTA 4W4OC 3WD5H 5EO1B 4Q2ZB 1I9IH 1Z0NA 3ZYZA 1I7TB 1QHPA 4PGBA 5GRXG 2D9QB 1VEPA 3G5XB 4WUUA 5F1NB 4M3KB 1A3RL 2VDQL 2XWTA 3EHBD 4OBSA 3ZTJG 5KN5A 1MJUL 3V5DB 5FF6A 1R0AL 1JGVH 4EI5D 1FO0A 1CGVA 4JHWL 4ODWB 4QF1A 4Q97A 4UOW0 3PHQB 4XZUB 2WBWB 1P7QB 4BFEA 2HRLA 3GIZL 4MJ5A 3OB0K 1VPOH 4M7LH 4X9HA 4N1CA 3LH2H 2ZG3A 4PJ9D 1XGPA 3BD4A 3CFBA 3HE6D 4GBXC 5JIHA 5T1LB 1UVQA 3R8QA 4EUPA 2VMFA 3SCMD 1JPFA 4MA7H 1I3RA 2Y06H 3V52L 2NY2D 2PW1B 5EC1A 2F53A 4IM8A 4XNXL 4YAQB 1TIUA 5CJOH 5I1JH 4HFWA 3IS1X 5HYFA 2EDWA 1N59B 2WAHA 5HI4C 4O9HH 3QEGL 1FPTL 4NQUA 1QRNB 5EPMB 4ELKA 4WDIA 4EN3A 43CAB 4APQD 2A6DA 3ARDA 3GGWB 5E1HB 1I1AD 1VEOA 1A9BB 2D0FA 5F7LB 1RHHB 3MRQB 1WIPA 5SX5H 1YPZF 3ISWA 2ESVA 4G7YH 5BV7C 3MNVA 1LQSR 4JVWA 2OCFD 4U6XB 1A3LH 3REWB 5GS1C 1CVSC 3QXTA 3P4MA 4I18A 1DUZA 1A47A 1KCRL 1IGTB 4JFHD 2R4RH 1NGYA 5I66B 2XPGA 5GRUL 4NNPH 5JHDA 1VADA 5MP6H 1RZKL 5I1GL 2OXHA 2YWYA 4KHTL 5HYSG 2VXQL 1UA6H 3QZWB 4Z7QF 1PYWA 1Q72H 4JKMA 3Q5OA 4OLZH 3HTLX 3VI3E 5KW9L 3EJYD 4IRJD 3HR6A 1CFSB 5DZNA 4PR5A 3FT3B 1CLZH 3VW3L 3HUJE 4TQEH 4X9FA 5K59F 3S4SB 1PJ9A 3MZGB 1RSFA 4WFFD 1UACH 3QDAA 5F7FA 5AG8A 2XIDA 1NAKL 4JPVH 1G7IB 2AXJA 3OR6B 4LSTL 5GS0H 3MJ7B 2VLJD 1XGUB 2JJVA 2R29H 5GS1B 1PG7L 3OKKA 4NM4H 2AQ3A 2MPAH 1OAZH 3HAEB 5HGAA 1CT8B 1T7WA 3TP4A 4XCEB 3KHOA 4V2CB 4MCZA 3MV8A 1MHPL 3GB7A 2QV2A 4L3EE 3MO1A 4X7EC 4WU7A 3T4AA 1G7MA 4GKOA 5H2BA 4W6WB 4JRYD 4PJDA 5EA0H 2FGWH 4P9ML 1OAXL 3BZ4A 3D5OF 2YSSB 3GJFK 1JPSL 2Y7QA 4Y8DC 4BQ8A 2QBWA 1JWMB 3JUZA 2I9LB 1NLDL 2HLAA 1S5HA 1MVFA 4DTGH 3RVUC 2WM0A 5TE4L 5KAQF 4JFEB 4AEHL 1XH3B 2H45A 4DUVA 1D6EB 2F58H 1X7QB 4QXUL 4Y16C 3ARED 2FEDC 4WY7H 5CINH 5ERWA 1KTRL 5KTEH 3X14B 1DQML 5EWIH 2NZ9C 4CRPA 3IJYB 4PTUB 2APXA 1AGDA 5DQDH 2YPLA 3P0YL 4OFVA 5E8DL 4HW6A 5GGVY 1U9KA 2CRMA 3Q0HA 3UTQA 4NFDA 3N9GL 3BZDA 3RWIA 1K4DB 1DUYA 5FUCC 2CDEB 4PJGE 5KVMC 1XF4A 5DFVD 1A1MA 3MNZA 4S1QH 2FEEI 1G7LB 2VITA 1G9NC 4MQXC 1IAIM 4PRAA 1F90L 4GJTB 4HWBL 4ZMAT 4K23L 1T1ZB 3O41B 3W2DL 4LSVH 4M7JL 2W65B 4WO4D 2W9EH 4WCYH 1RZIA 3VRLF 1AXTH 2A9ML 3QXAA 1HHJB 5I1EH 4GG6F 4RIRA 1ZANH 1W0VA 5DYOB 1MAKA 3NZHH 4D3CL 2OTPA 1BFSA 1FE8H 4R6UA 4MB3A 4OUUA 1IGJB 5ETUA 3D39B 4OJFL 4G7VL 5DA0B 2ICWI 4HT1H 5A3ID 3PIQA 4WWKA 4NRYA 3OAZH 4KZDH 4M6MH 4HCRA 4NZUH 4Y16B 3ZHKA 4LVEA 1ITBB 4RDQG 5LAXA 5CLTA 3EYSH 4Z7VE 5HHOE 4I0PD 1P7HL 3RKPA 5IB2B 2EYSA 4K8RD 2J8HA 2IG2L 4MX7A 4XPBL 2VZOA 3C2AH 4JFDA 5C07A 4JY4B 2ITCB 3MGTA 2FBOJ 3UAJD 2E7MA 4HMDA 4P2QE 3EDJA 4H0IA 3VWKC 1RVFH 4POZD 4NO5B 4KJWC 1CU4L 4YHOH 2O26U 1UJTA 4X6BA 3FZUD 4M5ZH 1NEZB 1S7RB 2QQKL 3NA4A 3SJVE 2OSLA 1HDMB 5JNYA 4HH9B 1O0VA 4TSCH 2LU7A 5F7EH 5IHUL 3TH4T 1IC7H 4Q9QL 1IL1A 5F70A 4MD4B 4ONHA 1MLBB 2CDFA 1H3GA 3JBG7 4M6NL 1SHMA 3VXSA 4LU5H 5IB1B 3CDFA 4LHUA 1J88A 1K9TA 3C6SB 2ITDB 1R6VA 4CADB 3FRPG 3FQUA 5E8NB 5F9AC 2DN7A 3QJHB 4QHMB 1RHFA 4XCFH 2ZUWA 3TBTB 1DQJA 5ISZD 3EYVB 1OSZB 2XI9A 1CBVL 1RUAH 5J1TC 4HUUA 2V5MA 3C2SA 3C5SA 3VXQA 2EZ0D 2XQYG 1BF8A 2EXWD 2F5AL 2IALB 5M94B 3PL6B 1SEBA 4HF5H 2G9HA 5C0AD 1J0JA 1S9XB 1T4KB 2LU3A 3CFDA 5C0BA 5IV2B 3VWKB 3UO1L 1Y6NR 1ZHLA 3UYPA 3UTOA 4MNGB 1ZVSB 1WZLA 1MUJB 1QLEL 2WWMD 4MNHB 4X7TA 3NPSC 1TMCB 4BYHA 1G7JB 1KCUH 1XMWA 2DDQL 2FJFA 4Q6IB 2A73B 3O6KL 1FLRL 1DBAL 3I85A 1Q9LB 2FATH 1JGDA 4JFYA 4B7IA 4NFCA 1NGWB 1I9IL 1U3ZA 4X7DC 4JFHE 1A6AB 4KMTL 1RZGB 3OJDA 2UVFA 4OZGE 4P57A 1MCNA 2GAZB 3RVVC 3SPVB 1NC4D 3UJIH 2DIBA 1BVZA 1JGVL 4PJBA 5IK3A 2I5YH 1BX2A 2IPKB 4RCAA 5D4QA 1WWBX 1I3GH 2GEEA 3B43A 4ZUVB 2R8SL 3HI1B 3UCRA 4QRPD 2XXCB 1S9VB 2VLKD 4FQ1L 3HNTH 1N7ML 3NCMA 5HDQH 3P11L 3DWTA 3OL2A 5GJTH 4G6AD 1CIUA 2JJSA 2YXMA 5D2LE 4X6FA 3T1FA 4WFFE 5DMKB 3C6LD 4RZCA 3NPSB 3ALPA 5MEPA 4NN6C 4NYLB 4WTWA 5I17A 2NY1D 3JV0A 4Y2DA 3ZDZF 1TZHA 3HRZB 5HVHC 5TE6H 3MA9L 2VLJE 3OKLA 2RFXA 4UTBL 4O9HL 5I1CH 1U36A 1UYWL 4DVRH 4NZDA 2EDRA 3L95A 3BW9B 1UH2A 4M43H 4X99A 5TDOA 4YDIH 4JJHA 4DZBA 2FHCA 3EDFA 3SDCD 1L7TL 1ONQA 2GK2A 1FO0L 2VLRD 4JRYE 4XC1H 4R0LC 2FX7L 1MNUH 3MJ8A 4ERSH 1D5XA 3EOYG 5TH2B 1JGLL 1CDHA 3MRCB 1R5VA 1OY3B 3QXDA 4NQCB 3SDXF 1T03H 3BYYA 2CKNA 3QEHB 5FAAA 2YHGA 1CF8H 3P9WB 1ACYL 5MP6L 3DBXA 3WKML 3NCJH 1INDL 5DZOA 3C09C 3S5LB 4R96B 2OR9H 1Q8MA 2VQUA 4NN6B 4QRRD 3W0WB 1EEZB 2ED9A 5CKGA 5HVHB 2XTJC 2CRZA 3A67L 3RU8H 3RVXD 4XX1E 1PBYA 2XZCH 1P6AB 5B39B 3GSQB 5EOCJ 2UVEA 1FZMA 4TOYH 2G2RB 4KHXH 4EOWH 1J8HB 3MRMB 1JHTA 1UACL 3H8NA 1RMFH 1QNZH 3JV4A 1T5XA 4FA8A 5LBSH 1C5BL 4ZO8A 3ARRA 4R0LB 4MLIA 4WEUD 3H3KA 4N9GA 3FQXB 3N06B 1LP9A 3PJSB 4FQIL 5HYEA 4NM4L 1T89A 1HE7A 1OAZL 3U2SB 5I6XC 1RIVL 2UYLB 1INQB 2G75B 2DYPA 4XNZC 5C0JA 3H7BB 5TDNB 2D0HA 4NQEA 1GGCL 5FO7B 4Q58C 2I07B 1T2QH 5EU4A 5FOJA 2X70A 1DVFD 1S3KL 1SBBA 1WAAE 2XTJB 3DSFL 2CUHA 3CGTA 3NFSH 1J11A 1KIPB 4FNLL 2AEQH 4DN4L 3MBXL 4KTEL 3ULUH 4DTGL 1I3VA 4OZHB 4X4YA 5D5MA 5FK9A 3SGEI 3DGGA 2Q8AH 4FQXD 1FVDA 2Q7YB 1GL4B 1NMCC 2E9WA 4WFED 2WP3T 3U7WH 1GPOL 2FECI 4IOFD 2OYPA 5DRXA 4LRIA 5ADPH 1NFIA 3BP5B 4NM8H 2JJUA 1I9EA 4G80B 5E2WL 1YEJH 4OLUH 5DQDL 2EC9U 2XQBH 4JFZH 1HSBA 4ELMB 4XNZB 1EO5A 4N1EA 2PO6C 4FXKB 1X3DA 5B8CA 2H3NB 5KSAD 1KXVC 5E0QA 4YIQB 5SX5K 3A6OA 4XP4L 4GAFB 3U4BH 5I8EA 3BXNB 1HXYA 5IT2H 3G5VA 4LF3A 3ZYOA 5HYQA 5I0ZA 1G9MH 2ZG2A 4F9LC 4MJIA 2P5ED 3RBGA 5JUEL 4LSVL 3NCYS 3GSRB 4K7PH 2W9EL 4WCYL 5ISZE 2V2WB 6CGTA 4HUKB 1J1XH 4I77H 1IGFH 3KPRD 1HHHB 3QUZA 1JYWA 3QJFB 4L4TA 4YGVB 3FHAA 1TJGH 2CXGA 3V0WL 4PGEA 3RZCA 3P3YA 1QBLL 1NMCB 4U3XA 5DEZA 3PWJB 5L8KB 1Z9MA 2DKSA 2DQIH 4MDJA 2LV4A 3DROA 4OF3A 5BRZB 8CGTA 3G9VA 2FIKB 3H2WA 4FRWA 1RJCA 1Y6KR 5EN2A 1UXWA 5B4MD 1PKQE 4X0KA 2B1HL 3F5WA 1LK2A 4RWHA 1GXEA 5JMOC 4NQSA 2JIXD 5LG1A 2C4FT 3QQ9C 2UY7A 2FR4A 4U1LA 1NBYB 2PO6B 3D2UD 1YN6A 1RVFL 2PYFB 1I4FB 3TT1H 2XKUA 1B6DA 4FP8H 4YHOL 3HE7C 3SBWC 1QQDB 5FCSH 3SE9H 4XAWL 1HOCB 3RIAF 3F7VA 4P23B 4XTRD 5HTSA 1CVRA 3IXTA 4GXVL 1U8OA 2YC1B 3RWEA 4WI5A 5CIPA 5EO9B 3OJ2C 5SWSD 3BO8A 1N4XH 5F7EL 1BVKB 1XR8A 1IC7L 3K7UA 2C1PB 5HI3C 2F54B 4LU5L 4NJ9H 2VLKE 3NFNB 1HZHH 1FVEB 5ICYA 1EIBA 3INUH 4PRNB 4GG8A 4HCRL 4HKBB 2DQJH 4G6FD 4XCFL 3MRLB 4ZTPL 1BQHG 4LCCA 1U6AL 4HX1B 2G5RA 4HIHA 3BGMB 3OXSA 1IBGH 3U4EB 4M6AA 2F8OA 2B4CL 4HF5L 3MBEC 4Z7WE 4CVXB 3SGKC 3VXPA 4UQ2A 2VYRE 1KFAL 1WSST 3HE7B 3B2VH 3V6ZA 2IQAA 2R0LH 1KCUL 5INCA 1S7UA 4DEPC 1A6TA 3PP3H 3NPZB 5GPRA 1K6QH 2BY0A 3PV6B 1I3UA 5DTFB 3NGBC 3O3BA 3ZTNL 3AFLA 1LE9B 3BIKB 3ARFA 3JV6B 2YUWA 3VMPA 3HAEH 4MHHI 4MLSA 3H9SA 3O4LE 3IFOA 3TN0D 3I2CH 1ORSA 1X5JA 4G9FD 4HUWB 3UJIL 5D7JA 5DJDB 2ZNWA 2I5YL 3BUYB 4G8GB 4C56A 3U9UB 3MV9D 3W9EB 4R4NC 4QRRE 3RVWC 2EXYC 2ADFL 1H3VA 2FD6H 2XT1B 3B5HA 1M7DA 4LSDA 3V6FB 3TBWB 4G42B 3E6FB 3HNTL 1MREH 1MRDH 3MBEB 5JHLH 5D96C 1MRCH 4KRNA 5HDQL 3EO1A 3QUYB 5GJTL 1BJMA 1A6VH 5T3XH 4PY7B 5F9JB 1JGUH 2JK5B 3GSWA 3P9LA 1LE5B 3FQNB 2X4OB 3K8KA 2CKBA 5ILTH 1M71B 1SJEA 1BJ1J 5J6HB 4M1CD 3UXFA 2H41A 4XPAH 4OF6A 5DRZA 1DZBA 3IGAB 3MUGB 3SKJL 4JO3L 4PP2A 4JRXA 4DEPB 3MLVH 4HLZG 1F6AA 4D0DA 2BSTB 5F7KC 2D0GA 4NJAL 1B2WL 1URLA 4JY5L 3NGBB 1W72A 5I1CL 1K3IA 4MCYA 4PJDF 5L6YH 3FB6A 2YUXA 3X11B 4M43L 2WUCL 4LSRH 1LO5B 4LLMB 4DQOH 3OKEB 5FYLH 1S9WB 2VQ1B 3TZVA 3S37H 1M6OA 1P5VA 5EOTA 2HFEA 2EICA 2OQJA 1JTTA 5CEZH 4LFHG 5JZ7D 1N6UA 4KKLC 1NMBH 4LASH 4O2EB 3WDJA 2MCG1 4ERSL 4EJ1C 35C8L 3WXVH 1SY6H 3V5HA 2EDHA 5ITFB 1JI2A 1LEGB 3QDGD 2FSEB 4BQBA 3H9HA 1T03L 1P1ZB 4JPIB 3V4UH 5D96B 5EDXA 1H3XA 3O11B 4OGAC 4QY8B 3RVTC 5T5FL 1Z0MA 1RULH 3BX7C 2HMIC 4L1DA 4QHKJ 4Y1AD 4XPTL 3D3VE 1TVHB 2KDGA 1CFBA 1A7PH 4MB5A 4WFEE 3PGDA 4M6OH 1NSNH 5SV4A 4HIEB 4TRPH 1P4LA 5IB3B 3ARSA 1N6QL 3FB8A 3QEQE 1F11A 3ES6B 1QSFB 1WITA 4KDTC 3OQ3B 3AY4C 4M00A 4P5MA 8FABA 1YY9D 2WBKA 4ZO7A 1MFCH 2MFNA 4TOYL 3B9KB 3QRFM 2NZIA 5EU6A 4Z7NE 3LN4A 3PQYD 4H20H 3EHBC 3MREB 2BC4A 4NKDB 4UINH 3SO3C 2GFBA 4G43A 1K8DA 3KPLB 4KVNL 4YDJA 4EI5C 3UBXI 1G9NH 4XP1L 1MQ8A 4XWGL 2CIIB 4QOKD 1FFPA 1NGQH 3C9NA 2P5EE 2D7OA 1AXSB 1LNUB 1ZV5A 3DURB 4F33A 1YEGH 5EUKB 3FO1A 4FQPA 5EIQA 4PJ9C 3HE6C 3QDMD 1T6VN 3SCMC 3DETC 5DJCB 1U3YA 5DUPH 5E99H 4JQXC 5KSBA 4NC2B 2NY2C 1T2QL 1EEYB 1AIFA 5EU3B 2GCYA 3QWRA 4PJEB 1KIRA 2QLVB 4AIZA 1X5AA 4YHNA 1VGKA 1BECA 4BSVA 1MLCA 1FFQA 2CD0A 4Z0XA 3NFSL 5LWYL 3V8OA 1FV1A 4P2QB 1LO0L 3D9AH 4MXVF 5MENB 5BVPL 3PGCB 4NKIH 1BVLA 3UJTH 4APQC 1I1AC 2DQEL 4RFEA 2L4OA 3GI9L 4RQQA 3HKFA 5I1DB 3MACH 5L0QC 3SO3B 1F58L 3QCUH 4EI5B 2XN9D 1I85C 2DWEA 3QDJA 5IUSA 3G5ZB 1EV2E 3B9AA 4OF8A 5HYSB 1YECL 1V7MH 4WW2B 3GM0A 4PJ5D 4AMKL 1UXSB 4GW4B 4PJ9B 3KPQA 5C0RH 1ZEAH 5D70H 5DD0H 3ZE1F 2H1PH 5IVZA 5SWQB 5AUMA 1NMAH 1IC4H 1RURL 1H3UA 1PX3A 3LOWA 2NY2B 1AE6L 2FBJH 4J7RA 2VDLH 1JWUA 3C8DA 5ITBL 1G9ML 4OD2A 1M05A 4WV1A 2YPVL 3OGCB 1RZJL 2ZOLB 4IRJC 5KJRH 1N64H 3MLUH 1JUFB 2A6IB 1TCRA 1U93A 1D5IL 4U4BA 1EMTH 5DMGD 3VXOA 4APQB 3MSPA 1BD2A 5DJ8B 3ARPA 1I1AB 1VFBB 3B9EA 5C8JA 5TDPA 4LNVA 4JB9L 1KCSL 5T1DH 1I7UA 5E03A 1NGZB 4UV4L 5HVWA 3GMOA 3LDBC 1Z5LB 4NBYB 4NC1C 1U41A 1WEJH 2D9CA 2J8UB 3DECA 3NACL 1H5BC 1JZ5A 4OCSH 3RIFF 4OZGB 3QB7C 3MLPA 2VUOA 3LKSB 4Y19A 4QTIH 1P9MC 4ODSH 5JO5B 2NY7L 3CFCL 4H26A 4JG1H 4MDIB 3PABA 4LNRB 4X7SH 4OZIB 2ZCKH 4JPWH 2VAJA 5TE7L 4G9FE 4ZFZB 4IRJB 1FNGA 4IEFB 1TITA 1YMHB 2GTZB 3HPJA 3MV9E 5EBLB 3EFDH 2DD8L 2HKFL 4IMLB 4CNIA 3CSPA 1N0LA 4TSBH 3OKYA 2I9TA 1MEXH 3LHPH 3OKOB 1XIWD 4FN0A 1ZT4A 4RGOL 3INUL 5GGUB 3AREC 1BPVA 2VN7A 4ORGB 5FB8B 5I1LB 4PJ8B 3GMQA 2VLJB 5E6IA 4G6JH 1DBMH 3H3BC 3WL9B 5EFIA 4ZTOH 2C3VB 3HR5A 5FECA 1IBGL 5C9KA 3TV3L 1NCWH 5DHVA 2C1OB 1H5BB 15C8H 3AU1B 1TVBA 5DHYA 1MCPL 3BISA 4OF5A 5DFVC 4YX2H 5J1AB 3W5NA 2EEAA 4JRYB 3SKOB 3IS0X 2P8MB 2LFGA 5DO2D 4WTZG 4PRBA 3DYOA 3O45B 2XWBB 5K9OB 3ARVA 1F3DJ 5EORH 1BJ8A 4WO4C 4UNTA 4L1HA 2UZYB 1WWCA 4F7PA 3K46A 4NZRL 1V3KA 1OCWH 4X4XA 5JLZB 4XXCC 3GSOA 2VZSA 4O4YH 1KB9K 1YEDA 5KAQG 1HHIA 4P46A 5A3IC 4QTHA 4KVCL 1P69B 2C3GA 2VAAA 3L3GA 4Y1AE 4ZQKA 3UPAA 1C08B 1TZIA 4PLNC 2AKRB 1A1NB 4PJXB 4I0PC 4K8RC 4HZLB 1S8DB 2DM3A 2VISA 5DEFB 2VKWA 3UAJC 4EBQL 1OVZA 3S7GA 5DJAA 5D9SA 4POZC 2X4UB 2HH0H 4NN7B 2DQGH 5KOMC 4OLXH 3FZUC 1LP9F 1GC1L 1FJ1A 3PQYE 1FDLL 3S34L 4PG9B 1ZLVH 2F8VA 2YKLH 1AI1H 4TUOB 2R4SH 4WO4B 2HT2D 3UZEA 4QOKE 5DK0A 4ZUTA 2VNCA 5FYKH 4MQTB 4MA1C 3QG7H 3FCTA 2ADJB 4UDTA 3JUYA 1K5NA 3VE0A 2VLLA 5L6YL 1PVHA 2CLZB 4XVSL 3ARYA 1IQWH 4LSRL 3NTCH 1SYSB 3KPOA 3QDME 5D1QA 5FYLL 3TBVB 3LQAC 1A9EB 3VI4F 1Q0XL 3S37L 3V7AG 3Q3GA 2ZCLL 4LCYA 3DVFA 4JZOA 5JQ6H 1DQDL 3MCLL 4I48A 1NMBL 4I0PB 4XWOD 4NP4L 1SEQH 1IKNC 3O9WB 2EZ0C 4H5SA 1Q9KA 1FRGH 3AS2A 1MHCA 1IGYA 1NAMA 4LCIL 3RWHA 3OHXA 3GUTA 1RAMA 5DVOA 2WWMC 2EE9A 1J1OL 2CKBL 3QXVA 3HMWH 1IGIH 5DT1H 1EHAA 2Y25A 4OSUH 4F3FB 3PNWB 4PFEA 4M6OL 5I74C 1T1YB 5MHSD 3BDBA 3DPBA 5ADOH 1MH5B 1SJVA 3CX5J 1ZT7A 1J1PL 3IKKA 4K94H 3HFML 4JFOB 1W72L 4RNRB 1Q1JL 1EERB 4PJ5E 3MNWA 1Q9OA 1UB5B 4NWTL 3AS1A 4H20L 3FO2A 3UTPD 4Z8FH 5IGXH 3EUUA 3PP3K 4A6YA 5DJ2B 3RNQB 3QQNA 4ZUSB 5I73B 5DJ0B 3V5KA 4LKCB 3I6GB 1KEMH 3KPTA 2E6JA 3U82B 5BVJB 5C0AB 1I9JH 3BDXA 1CE6A 3P77A 3WE6B 5J8OA 4G6AC 4J3XA 4NQVB 5I30L 1F4XH 3TBSB 5I8OL 3LSOB 2IH1B 5E99L 4RAUB 2Z8WC 1FFRA 1T22A 5HJ3A 3RUGE 4QLRA 5EZJB 1PKQB 2NY1C 4F37K 4G3YL 5K9QI 4F7CB 5I74B 3CVIH 4QNPE 2HJLB 2EKSA 2V2XA 3C5JA 5FHAH 3IXAB 5DSCA 3ARZA 5CBEA 2PNDA 1AJ7H 2BCKB 2XKSA 3MR9B 2CDGB 1B0GB 1HEZB 1FYTD 2FX9H 2V5TA 3BD3A 3QXUA 1LO4H 3IJHA 1I7RA 4PRID 2XZAH 1S7SB 3SDCC 3L3HB 4BUHA 2OJEB 3D6GA 1NC4B 5GS2D 2BNRE 3R0NA 4X4MA 3QCUL 3BPOB 4JM2F 3QI9D 1TETL 5DEGA 3BP4A 3QCTH 1WBZA 3N1PC 4QRPB 5H8DA 3T09A 4NSKA 4DW2L 3MOBL 1UM4H 4EDWH 1IAIL 2VLKB 5D7IB 3ESUF 5ICZA 1UM5H 2BJMH 1ZEAL 2X1PA 4P0DA 4I8DA 2DJUA 4RGNE 5C2BH 4L4JA 5H37H 4XH2A 2AXGB 5F44A 4NHUB 3WXWL 4L3CB 3C6LB 5ECJE 3BKMH 1BIIA 2JCCB 5E00A 3RDTC 1N5AB 1DL7H 4A2LA 4RWYH 2NY1B 2E8ZA 2R2BA 1IT9L 2WQRA 2HA1A 3S3JA 4Z77B 1VFOA 3QNYB 3RVXC 5ENWA 4L8CA 1N64L 4P3DA 4Z7WB 4HUXB 4HIJB 3VCLA 5IBUB 5I1HH 5BS0A 4P9HC 4CN6A 3CSYA 2H8PB 1U8HA 1MWAB 5JPMA 4NN5B 1CDCA 1KCVH 3QT2A 3MRNB 1KLGA 3SDCB 5BZWA 4H88H 1UJ3A 4M1GH 5HD8D 1MVUB 3HC0B 5ACZA 4PY8I 1UWEL 2VLRB 4W70A 5C0DB 5I1IL 2DTMH 3WS6A 4PV9B 3QCVH 2MHAA 3UTSA 1OPGH 5E9DA 1ZT1A 3BQUD 1JF1A 3HPLB 1YMMA 1HI6B 4HS3B 4JKLA 5DQ9B 3V8CA 2Z8SA 3GMRB 4YZFF 2X4NB 2ATKB 3ESVF 4X7SL 2K3TA 1RFDL 4J8RA 2NXZD 3PXHA 3V0VA 5GGRB 3KPSD 1DVFC 1BZ7B 2WBJD 4LLDB 2AJYH 5JOFB 3G6JE 3ZE0E 1V3JA 3MA7B 2X41A 2IF7A 3F12A 3QUXD 1FG9C 3O6FA 1NGXB 2EDNA 3GSVB 5T3ZH 1C1EH 1TDQA 2A77H 2KPNA 3K0WA 3X12A 1FIEA 5BJTB 4E41D 4FQXC 3GHEL 4K2UH 3UEZA 4R3SB 2D03H 1BBJA 3EOBA 4ODVH 4IOFC 3QHZL 2CO6B 1ZA3A 4GH7B 5C0CD 4N0YL 1FN4A 4I2XA 3ARBA 3CFEB 5E8OA 3NZ8A 4LCWB 3OX8A 4G6JL 1EEQA 1DBML 2VN4A 5GJSH 1XGRB 4FZ8L 4IOIB 5D7LE 3UBXG 1ZGLA 3ZTJH 2HN7A 3SDDA 2X89D 4RAVA 5FUZH 4N8VG 3IU3B 3C5ZA 3SE4A 1WGOA 5KSAC 4GAGH 1T7ZA 4FQQB 4GMTH 2NY4D 4K3DH 5J4MA 5HY9B 3HI6H 3WFZA 2WIMA 5TQ0H 3G04B 3DV6A 3M8OH 5EORL 2IPTL 3AM8C 2DQTH 5EULV 1QUNA 2IPUG 5IBTL 1OCWL 2J5LB 2BY2A 4FQXB 3IJSA 2CIKA 3ZHDA 2XFXB 1GZQA 1CS6A 4FQCL 1NUFA 4WI7A 2RCSH 3WNNA 3JTSB 3RX8A 4MQ7B 3PDOB 3QFJA 3ECBB 4WUUD 4JO2H 4BZ2H 1PFCA 2AJUH 2V5RA 2VDKH 4PRDA 5B4MC 4O2CA 2R0ZL 4EXPX 1F97A 4C54A 5MHSE 1OSPH 4QCIB 3VXNA 2QR0A 4L5FH 2UWEA 4N0RA 5BXFB 2DQGL 2N7BA 4JG0H 4Z76A 3FT2A 3MODH 1GGBH 4NQDA 5D1XB 1BBDH 1V3LA 5E5RB 3UTPE 1KIUA 2P5EB 3MRIB 4QHUB 4PJFA 2R4SL 3LN9A 3U7AA 12E8H 2F53D 1X5FA 2VC2L 4YHYC 4YLQT 4S2SB 3ULVE 5FYKL 3DSNA 3ELAT 4RMWA 4OZFG 3KPRB 1E6JL 2AJZB 1T5WB 4HIXH 5KSBF 5IVXA 2NLJB 4U6YA 4P4KA 1BQHB 4MAYA 1ZTXH 1YZZA 3BKCH 2X7LA 2Q76A 2VE6B 3ARDD 1ZS8B 3TJEH 1UWGL 1RJZA 5JQ6L 2HVJB 3JXAA 5ALCH 3T0EB 1AD9A 3ULVF 5D2NE 2ESVD 1AO7E 4F7EB 1Q94A 3K4DA 5TGBA 4OCYH 1NKOA 3HG1A 2ADGB 1T04A 4JFXA 3ARQA 1MI5A 1FRGL 4HKZB 3TYFB 4GUPB 1QFWH 2AW2A 5GSVA 3MJGX 5AEAA 1WWAX 1HINH 3D2UB 4P4RA 1OW0C 2OTWA 4HK0B 4Y7MA 1MF2H 1FYTE 4YJZL 5JHDD 3GSUA 3KLAB 4U6VH 1G6RA 4PRIE 4GRLD 5DT1L 1T20B 2HFGL 1A2YB 4X6DA 4K9EH 4YHPB 3GJEA 3SOBL 4QRQB 5F3HA 4FFZH 5B38A 3JWOC 2VR9A 4MA3B 5SWSB 1ZHBA 5ADOL 5I75B 4YHYB 4U31A 5I16B 3TPUB 1AQDB 4K94L 2VLMD 4TNVK 4EUPG 3TIDA 5B21A 2FO1A 5EIIA 4QGYA 2VDNH 2YN5A 3I75B 3TN0C 2PW2B 1I75A 2PYEB 2M8XA 5DVKA 4OIAA 4ETYA 4Z8FL 1E4WH 5CD5D 4K71C 4PTTA 4DKEH 4X6CA 2DLTA 3ZDXE 4D9LL 1EFXA 4C4KT 3S96A 3CFKA 4G6FB 3TO4A 5E8PB 4OD1H 4M7KH 1N6VA 4IDJL 4PREA 3W5MA 2RB8A 1OP3H 5EBMB 1NAML 1KEML 2DL2A 1YNLL 3NCCB 2GSGA 4PRHB 3BH9B 1MCBA 4X83A 1M7IA 5DA4A 4QT5B 3D87B 1YC8A 5CJBA 1F4XL 4IRZL 2AXHA 2X1OA 1NC2B 3VFVB 3MV8D 3QHTC 4M1CC 1OLLA 3QEUB 2P24B 3O8XA 3VFTB 3BN9D 3NH7H 5DI8A 2YD6A 4D8PB 4TNVF 4XVJL 4NKMA 2ORBH 3IVKB 4MJ2A 5F1KC 3TIEB 4GAJL 1FZKA 4NT6B 1CG9B 3VFUB 3FRUA 5CUSL 3BYTA 4HFUH 4P5TA 3NN8A 1I1RA 2XZAL 1ZLVK 2GTWA 4G9FB 5JZ7C 3TVMB 4AL8H 2JTDA 4F7MA 3MFFA 3S35X 2AJSL 1I1YA 3MV9B 3WFBH 3KPSE 4OGXH 4PJCA 3QYCA 5EO1A 1Z2KA 1WJ3A 4HPYL 3H6JA 2NNAB 3MLWH 3RWFB 3G5XA 3U48A 5ALBH 2BJML 2YPLD 4JZNA 5C2BL 3T08A 5T1MA 4E41E 1N3NB 3C8KA 3OKDA 5IQ9B 3JVGA 1DL7L 5C0CE 3O2WH 3WHXA 5F1IA 1A8JH 3FFCB 4G8IA 1ND0A 3P0GB 4F7TB 4AJ0A 1JPTH 3L3KA 1FZOA 1NPUA 3CU1A 5EZOL 4KY1L 1YY9C 3ILPB 3VA2C 4KK6D 1YJDC 1B4RA 2CH8A 2N4IA 2N56A 2W59A 4YAQA 4JR9H 4LPXA 4H88L 1VCAA 3HZVB 3N1MC 3W9DB 3I02B 4TUKH 1N59A 1UH4A 4G8FA 4FQHA 2VL5B 4W4OA 4G8EA 3LKOB 3NVQA 4OFIA 1OPGL 3EOAA 1HYSD 4LEOB 3QDGB 4YK4C 2VXSH 1MPAH 1UB6B 1XF1A 3DYMA 5DK2A 3SKNB 3TO2B 1RHHA 5HPOA 5C07D 1F6LL 3FONB 4Y1AB 5JW5B 2LVEA 1NBVL 3GMMB 4CVZB 4XGZA 2BVPB 3AXLA 3C60A 4N0UA 1CR9L 1WT5A 4N8CH 1A7QH 1AR1D 2AJYL 1GIGH 3DX7A 4ZNEA 4RX4D 5DGQA 4AEEA 2EDQA 1WZ1H 1CLYL 1HQ4A 3TNMA 4GBXA 1RU9L 1HQRA 2NTFB 4NO3B 2GJ6D 4HWZA 1CD8A 4LVOC 5T3ZL 1C1EL 5D1ZA 3KS0J 2DTSA 1M7XA 4K2UL 4TUJA 3VXSD 2X05A 2X09A 3AMKA 3KXFA 2D03L 4LHUD 4UNUA 4ODVL 2GJZA 3LEXB 3MLTB 1XGTB 3IDYC 4P59H 2BY3A 4YHKL 4JY6A 1H8OA 4KJYB 1FSKB 4XI5D 5BQ7A 2VDOH 5CHNB 1PLGL 3DLQR 5LQBH 1E4KC 1JGEA 4E42B 4U49A 1RJLB 5ESQB 4MSWA 5C0IA 1YEIL 3QDMB 3GBMH 3ABZA 4YNYA 4GAGL 4L4VE 4X98A 4PJAE 1G7IA 4DZ8A 3DX9B 1AP2B 1XF3B 3DUUA 5C0BD 3DX6A 3IDJB 1F4YH 4UI2A 5GS1A 3DRTB 3M8OL 1XCQA 3F8UB 1DN0A 1CT8A 3LRSB 1BEYH 2ESVE 1CGYA 1RV6X 4D0BB 3WFHA 1YPZB 2YMXH 4V1DE 1BQLH 5MEOB 5DMGC 3U6RB 4Y4KD 4LVOB 5GSRB 4ZFOA 4R90L 4LLVB 1J5OH 3G9AB 3Q6GH 3AUVA 3VFOB 4NBXB 3M17A 5JIIA 3P9MB 1FL3A 4M03A 2RCSL 5EBWB 2ZSWB 2NTSP 2YSSA 4UIMB 2V9TA 2J8OA 5JHDE 2XN9B 4JM4L 4LOUD 4CMHB 1OHQA 3IDYB 5BO1H 1KN2H 1JL8A 1YA5A 4LCUB 4PPTA 4N8PA 4YXKH 1IC5L 3UPCA 2APWA 4JO1L 1JHKL 4QRUA 4LHUG 2A83A 1BQUA 3WIHH 5DD1H 3LKNA 4WI4A 2VLME 4PJHA 4L5FL 2ICWJ 1XF5B 3MC0A 1DFBH 5BOPA 2X1XR 1KG0B 3L1OH 1K8IA 2ED8A 5IFAL 3GSNB 1BBDL 3WNOA 4ZFFB 1AGBB 1R24B 2V7HB 3IJYA 4JQIL 5DLML 4PTUA 2DQHH 1IM9B 2FCBA 3IDXH 5TF1H 3MRBA 4Y2DD 1OT1A 3KR3L 3BHBA 1UENA 2X4TB 1CFVH 3QAZC 4GAYB 4LDOB 1K4DA 1P5UA 3K1DA 2P46B 5IFJA 4ZPVB 1XIWC 4KQ3H 1TQCC 4BH7B 1ZTXL 3BWAA 3DXAD 4TVPL 4OGZA 3RUGB 4GMSH 3EDKA 5C0GA 3QWQB 3HC3H 3LPGA 1EHNA 1WISA 1O7SA 3FO9B 3S35L 4FXGB 1D5BB 4U1MB 3TJEL 1HN1A 2NY0D 1ZWIB 4WENB 5DZLA 1BFOA 1H0DB 4N0FA 2ZSVB 3GFUA 5DYOA 3RKDD 4OCYL 4KPHH 3I3EA 3VXMA 5B3NA 1NFDE 1CN4A 1IGJA 1MJ8L 4ETQB 3KPNA 1OGAA 4FQJL 2HVKA 1DDHA 1HINL 3CLFH 2BRRH 2J7LA 3CDGA 4Y16A 1ZMYA 1QSVA 1MWAH 1MF2L 2EDDA 5DO2C 1ZLSL 43C9A 5HYJD 2Z35B 4PJ7A 1MHHB 1EGJH 3N1QC 1CXHA 4Q0XH 4EZMA 5IB2A 1WBXB 3QH3B 3L7FA 3QXWA 1J0YA 3DJ9A 4PGCB 4CVUA 4PRPD 1IM3A 3CK0L 2IADB 4RFOH 1A6UL 1U92A 1YYLL 4XBEH 1AGFB 1XIWB 1TQCB 1FNEB 4OFYA 1A5FH 3QUMB 1HH9A 4FQLL 4BQ6A 4N5ED 3VG0L 2ARJQ 3L7EB 3U9PH 5K9KB 2R2EB 3UYOD 5CEYB 1FNLA 4Z7UA 1KSRA 3OGOE 1E6OL 2GSIA 4YXHL 3CPLA 1K2DA 3SDAA 1OGTB 5BW7C 3C6SA 5E94A 4Y0GA 4Z5RB 2VQTA 4M02A 3GJFB 2NW2A 1NANH 5IKCB 5IJVA 4YO0B 2V2TA 1G6RL 5L7XH 6FABL 3WFEH 1IAOB 4R7DA 3RGHA 5J3HD 3R8BB 4GG6B 4TYUA 4KK8D 3LKPA 4OLYH 4MJ6B 4LSUL 4FG6D 5FCUH 2HT2C 5FYKU 5E4EC 2IALA 1SJHA 1QLRB 3PWLA 2XACC 4JGJA 4YBHA 1S9XA 4U3CA 3ZE2F 4LSSH 2YD5A 4Y8AA 4FABH 1OARH 4JHZA 4MNGA 3FO0H 3VFWB 2BMKA 5CMAA 1BZ9A 2MMXA 3WHE0 7FABH 1TTGA 4KKAD 5IHZA 1WZKA 3L3IA 1GSMA 1GGUA 3STBA 5LGHH 5FOBB 3G6JB 4R4FH 4LIQL 1S9KC 3FTGA 4XWOC 4R7NB 1YY8B 1EUUA 1JHLL 3HZKB 2ARWA 4HGWB 4OGXL 1W8OA 1NGWA 4MGXA 2X2YA 3PP4H 1RZGA 1I8KB 5LVEA 2ZPKH 1IQDB 4XMKL 4LVHC 4FOMA 2D7MA 2GAZA 2GJ6E 5IF0B 1T21A 4QXGL 2HKHL 3QHFH 4Z7OE 4JFPB 2V7NB 4AEIH 5EC2B 2ADIA 1NBZB 4IHOA 2AV1A 3L3JB 3V6OA 4JN1H 4XBGB 5FGCE 5E4EB 1S9VA 4I0CC 4MD5B 4MAUH 1EVUA 4JZJC 4XCCL 1JPGA 4POYA 2AJ3A 1T0MA 5IJKC 4DKAA 4NRZB 1T3FB 2JJTC 5DJZB 2YRPA 1U8NB 3U36B 4UIKL 3SE8H 3CZFB 4X5XB 4JDZB 1KJ2B 3RZCD 2EIEA 3T2OA 2R1XB 4P5KA 3UC0L 4CW1B 4O2FA 2QKIB 1KELH 2B2XH 4I4WA 4S1RH 5C0FB 4OFPA 1UZ6E 3BW9A 2HG5A 1HH6B 3GZKA 2YA0A 3MRJB 3GO1H 4CU7A 4K7FA 2CMRH 4MB4A 1MPAL 1ORQA 1C12B 3ZL4H 3LMJH 4LVHB 3LS4H 1L9NA 3WIFB 1JNNH 4L8DB 2R1YB 3ILQD 1FIGL 4U6HB 5FUOH 3U0PB 1DE4B 4QYOB 1BAFL 4ODXB 3B9DA 2PTTB 5FM4A 1OP3K 1GIGL 1N2RA 5CZVH 1UM6L 2UWEF 3MRHB 4PJBE 1WZ1L 2NCMA 4UU9A 3LCYA 1PX4A 3NIFE 2X4PA 5IFHH 4LKXB 2BNUA 2PF6A 5CSZB 1Y18A 3I50L 4PJFF 3S5LA 4OIBA 5HDLA 1MRFL 4G6KL 3ZKND 2C3WA 4Q7DA 5D6CB 3ARUA 1CD0A 4KTDL 1IAKA 3QI9C 5C09E 5B39A 2IANA 3T0DA 5IVXF 2OMNA 2X4RB 4D9RE 4LAQL 5MERA 5SV3A 1UH3A 4UB0H 1QZ1A 5CP7A 2HT3D 5KANI 4U1GC 3WJLC 3MLZH 2Q6WB 2ZUYA 4J3SA 3M1BA 5IESH 3QPQD 1EA9C 2QSCH 4QO1A 5HHPB 1QFUH 3OB8A 4D2NA 3EGSB 1P4IH 4R0LA 4X80H 3DXAE 4LARH 3VFGH 4I3RL 5T3XD 3IFPB 3PWPD 1BIHA 1MCLA 4F2MA 3E1F1 4F58L 2EEDA 7CGTA 2Z93A 2W0LA 3MGAA 1INQA 5L8LB 1BEYL 4Z95L 3D25A 5IROC 2DQDL 1LEKA 1BQLL 2PR4H 3MMEB 1FYTB 5E1AB 4FFYH 4X6DF 2YRLA 4PRIB 4HKXB 3CUPA 4HLZH 4FMFA 1JWSA 1N8ZA 2AV7B 5HD8C 1CK0L 3H9SD 4KKNA 2RR3A 4HC1H 5I1KL 5HYJE 1KPRA 1BREA 1E27A 4ZO6A 5FYLD 1KN2L 3PGFL 5D7JD 5C6TH 5C86A 1KLFA 3JWOH 4C56D 4NFBA 1EEUA 1WBYB 4U0RC 2Y5TB 3BQUC 5DK3A 1R3KB 3UMTA 4PRPE 3NIDF 4OFDA 5I1AA 2P7TA 3FT4B 4RAHA 3UTTD 1DQLL 1F8TH 3W11C 4MNQA 4JANB 1DFBL 2Q3ZA 5IB4B 4I9WD 2A9NH 3ULUE 1U3HD 2WBJC 1AGEB 1V5JA 5ESVA 4Q9CA 4G80A 2BVOA 1ETZB 4M48L 1IJ9A 4YGAB 1MFEL 5DHXB 4ZFOL 1IEAB 1XGQB 3RWDA 2IFFL 3BXNA 1RUKH 3UBXB 5FO8A 3DMMA 4L29B 4L9LB 4OM0H 2Z31A 2Q86A 5DVNA 4X5WB 1MCDA 5HYIA 3TZVD 3BP7B 5L2KA 5AZ2L 2HJKB 4YXLH 1BM3H 3EFFA 4JO4H 3MGOA 3H0TB 3IDMA 1HXMB 4OLWL 4NCDA 4U0RB 4KPHL 3BQUB 1QSEA 4MQSB 5EUOA 3STZA 3RL2A 3TWCL 4B41A 1XR9B 4U3HA 1BJ1H 1CLCA 1RUPH 3IDNB 1X5LA 3CLFL 3PHOB 2DF3A 4JFFA 2NY4C 5BRZA 5DD5H 1MWAL 3HCVB 2DQFA 4PJCF 1QYGH 5FKAA 2NXZB 1EPFA 5JXAL 5D5ME 4YC2B 2WK2A 3H9ZA 5IR1A 2WBJB 3IFLH 4K3EL 4LDLB 5EZLA 5ID0B 2RQ8A 1UC6A 3QUXB 2X9YA 1AC6A 4RFOL 2PO6A 1CFQA 3X3GL 2BRQA 1EAPA 4U1IA 5CJXC 4E41B 1NLBL 4XBEL 4OAWA 1CXFA 3LY6A 3VXRB 3RX5A 5ANMB 1IGCH 3PL6D 3HB3D 5C0CB 4BK5A 5EU6D 4G9DA 3U9PL 5EO9A 2B8OT 1U8LA 1E4XH 2YR3A 3P4NA 1REIA 3E6HA 4LVNB 1J12A 5FV2A 3UPRB 5HGDB 1OLZA 1RJYB 4Y5YA 4JLRB 1HSAB 2OM5A 2PN5A 5FKPB 4XRCA 5GRZA 4HWEH 3KWWA 2BDNL 1VFAA 1CL7L 2O93L 4XBPB 4H25B 3HLAB 4U33A 1HHKA 3IETB 2GQHA 5DMJB 5GRVL 5GIRB 1JNHA 4KKCD 2NY4B 1KJVB 5IMKB 1YJDH 4HKBA 4OZFB 1XF2B 5L7XL 4M61A 5FO9A 4ZPTA 5EOCL 4U6TA 1G7QB 4ODUB 3I3BA 4IRSA 4J12A 1U8QB 3QWRD 1K85A 3VFPB 4K3HA 5H35A 4C83B 3DIFB 3K8MA 3WN5A 1C5CH 2HTKD 1RUMH 5KG9B 3F62A 4OI9A 4NPYA 1IEBB 1MHEA 1QG3A 4PGBB 1J87A 4PV8A 5FHBH 7FABL 2EH7H 4PLJD 3DI3B 3ARDC 4WUUB 3MLSH 1TJHL 2XWTB 5KN5B 4DGVH 4MVBC 4R4FL 5DC0A 5AD0B 4TPRH 4XCNA 5FF6B 3LV3A 3L5XL 1FO0B 2Z8RA 3H3PH 2V5SA 3QDJD 4QF1B 4Y4FD 3EAKA 2F9BT 2GITA 4MJ5B 3HNSL 5EO0A 2VXVH 4EQ3A 3DYPA 4RFNC 3QA3A 3D85D 3O81A 1EDQA 4WU5A 1MFDH 1XGPB 3CFBB 4XPFL 1UVQB 4MYWB 4EUPB 4GRLC 4P2OA 1JPFB 1I3RB 3HUJA 2OR8A 3CSBA 5C08A 5EC1B 3TPKA 2F53B 3CDYA 5IMLA 1S78D 1VESA 3PXJA 1B4JH 4HFWB 4S1DD 1GJIA 3SGKA 3SO5A 1NBQA 1FHGA 1X5KA 1RIUL 3FQNA 2VRAA 5CD5C 1M71A 5KS9E 1A6PA 1MCOH 4XP9L 4ELKB 4WDIB 2A6DB 3ARDB 1BD2D 4MXWL 2VZUA 2J6EA 4Z9KB 3GSNH 2O5ZL 4YUEL 2DI7A 2Y9RT 2ESVB 3RWJA 5T3XE 4JFEE 4ORZC 2HWZH 3MNVB 3PWPE 4DOHB 4J6RH 5DXWA 4L3EA 5J6GB 1LO5A 3P4MB 4I18B 1DUZB 3W0WD 1AQKH 3JV5A 3ZL4L 1CDYA 4RFNB 1JNNL 3OPZL 3MLYH 2XPGB 3ORJA 4HJGA 5JHDB 1VADB 5FUOL 4CMMA 4Y19D 4KK9D 4LSQH 1KC5H 1QFWI 2QJDA 1J8HD 3H9SE 4J3VA 1PYWB 2WIIA 2EDEA 3BN9C 5LJYH 3AC0A 2XKNA 4PJHF 5FYLE 5CZVL 3BDYH 4IS6A 4JPIA 3RHWK 2VUYA 5CEZE 5GRVK 5D71L 4PR5B 2WUBH 3FKUS 4JVUA 4U1HA 1S7WA 1IFHH 1FCCA 3UTTE 4KUCD 4HS6B 3GMLA 2IMNA 4DVBA 1MCHA 5I8CA 4I9WE 2B0SL 4IDLA 4WHCA 4ZAKA 3Q6FA 4PJGA 1RK0A 3D39E 4TNWF 3R06A 3VGAC 3OKKB 3SGEH 2D4FA 5E5MB 1V7NH 3WEXA 1EAJA 3Q1SH 5HGAB 4OKDA 1CXKA 5IESL 2VKXA 3GMNA 4MCZB 3VXUD 3MV8B 3GB7B 3MYZA 3QUMH 3VFGL 4AEFA 5IHLB 3MO1B 3T4AB 4PGJA 1G7MB 5H2BB 1LNUA 2GJJA 2VDQH 1YEHL 3BZ4B 1MJUH 4WRLA 2I26N 1A6ZA 4JDVA 2FJHA 3QQ4A 1SYVA 2M26A 2Y7QB 3EKCA 3WKNA 5DR5L 2YD7A 4EVNA 2YD2A 4X6EA 2PR4L 4KK6C 1S5HB 2HLAB 4PJ7F 4XHQA 3T3PF 4OCLC 5GGVL 5FYKD 5EU3A 3FOMA 4Z7VA 1CLOL 5HHOA 2BY1A 1BMGA 1YEFL 2OTUA 4L8SA 3MXVL 1LILA 4P46D 4CAGA 4HC1L 4IBLT 3RL1A 4KDTA 1MJJA 3IRPX 4P2QA 3AY4A 3UJJL 4RA0C 3FQTA 4GRWF 2BOBA 1R3HA 3V4PH 1HYSC 1J0ZA 1OOAA 3HI5H 4KFZC 3T4YA 1AXIB 3VGAB 4KGJA 1AGDB 3RNKA 2K7QA 2YPLB 4NHCL 1FZJA 1F8TL 4Z7UF 1UWXK 2R0WL 3SJVA 3UTQB 3QEGH 1FPTH 3RWIB 3O2DH 4OCRL 1XF4B 2A9NL 3WFDL 1A1MB 1B6UA 3MNZB 2VITB 3FN0L 1IKFL 1AR1C 4PRAB 2VH5L 3MRDA 4HQQL 1QR1A 1KEGL 4WFGD 3S36L 3QUKA 4GW4A 3HE6A 2W9DH 1CDJA 1RZIB 2YD8A 3VJ6A 3SCMA 4XNMA 3QXAB 5JDJA 4JQXA 5ICXA 2GIYA 4RIRB 2ZZUT 1RUKL 4JJ5A 5KVEL 4OUUB 3U1SL 5ETUB 3MOAL 1VFUA 1ES0A 5D6DC 3PIQB 1RZKH 4WWKB 1L7IH 4XI5C 4KHTH 2VXQH 1EXUA 5LAXB 4JO4L 5F8RC 3STLA 2EDYA 4APQA 2AP2A 2EYSB 4P23D 5JXED 4MX7B 4KRLB 5C07B 1RUPL 3MGTB 2AJXL 1PG7W 3VW3H 1I85A 1QYGL 2LAAA 3VGFA 2PUQT 2F54D 1NGZA 4X6BB 4QEGA 1KJ2H 1Z5LA 2CLRA 3IFLL 2EDLA 4M62L 1R5WA 2W0KA 1NAKH 3FQWA 4OZGA 4WI3A 4WVRA 4YDVA 2OSLB 5JNYB 2GJ6B 1CTNA 4Y4KC 1G0XA 2GHWB 3E2HC 3MJ6A 1S5IL 3DV4A 4ONHB 1PG7H 3LZFL 3VXSB 3MPCA 2WW8A 4LHUB 2VXUL 2R1WB 4OM1L 2C5DC 2BERA 4LOUC 4QHLA 1NJ9A 3LPWA 1D3CA 3FQUB 1F2QA 2C26A 3TA3A 1MHPH 1LD9A 4XXDA 2P5WA 3D48R 1UZ8A 4IMLA 1DQJB 2DKMA 2FZ3A 4P9MH 25C8H 1OAXH 3NAAL 3OAYH 3LS5H 5D2LA 1KBGL 4CU8A 4HUUB 1JPSH 3VXQB 5K93A 4MS8D 1SEBB 2G9HB 4GKNA 1BOGA 3RWGB 1NLDH 4ORGA 3FFDB 5FB8A 4XP5L 2H32A 3CFDB 1MCCA 5C0BB 2JJSC 2NY3C 1ZHLB 5TE4H 3MCKA 3NFPA 5GGQH 5EBGA 4NQXA 3WL9A 2C3VA 4X7TB 3G5YA 3CVHA 4Y2DC 2FJFB 1ZE3C 3LKQA 2GI7A 3S88L 1C5CL 1P9MA 1R3IL 2DWDA 2XOTA 4G8GD 1JGDB 2BXYA 4JFYB 4JRYA 1YEEH 1P4BL 3W0WE 1JMXA 4KI5D 1VKXA 3P0YH 3OJDB 2EH7L 3OMZA 4EI6A 4IIQA 2NY0C 3MLSL 4ZD3H 2BSRA 4UZGA 3MUZ1 4P57B 3LQZA 4XT1C 5CD3A 3QUYD 4PJBB 5IK3B 3RKDC 2H2PD 1G7PA 1C7TA 1J8HE 3V95A 1BX2B 3H3PL 2C4XA 3IDGA 4HWBH 3W2DH 5HHXH 2EKJA 4GQ9L 4X7FC 3KJ4C 5D7KD 3AREA 2A9MH 1MFDL 1PD6A 1O7VA 4D3CH 2AKRA 1A1NA 2DLFH 2IEPA 3GRWA 5GS2H 4X6FB 3KPPA 3T1FB 1OAKH 4OJFH 4RZCB 4G7VH 5MEPB 3QFDA 4N8VA 3WS3A 3PWUA 2X1WL 5I17B 4Y2DB 2P8PA 3VFRB 2EE6A 1PSKL 4JVPA 5HDBE 3OKLB 2RFXB 5I71C 1R3LA 5C9JB 4FTVA 4KH2A 4XPBH 3ARGA 4PG9A 2HT4D 4N5EC 5BS0D 3VG9B 5T3ZD 5LXGH 4X99B 3CX2A 5TDOB 2JELL 4HUVA 2N1KA 2QL1A 1JNLL 3VXUE 2BVQA 4BZ1H 4KJQD 4OKVA 4OZHE 1CU4H 4QXWA 1KLUA 3R1GL 1A1OA 2ADJA 2HWZL 4XXCA 5CZKA 3MJ8B 2D31A 5LGKA 1INEL 1T2JA 4UNVA 3MTRA 1D5XB 2AGJL 3MRRA 5ESAA 4UQ3A 5A16A 1T89C 3B2UD 3KJ4B 2IQ9L 5E9DD 1R5VB 3QXDB 5DVLA 3WLWD 2DBLL 2AK1L 1WAAA 3MLYL 1YMMD 5FYKE 5HYJB 5J3HC 3UROR 2Q1EA 5AWNL 4XVTL 4M6NH 4DGIL 3HZMA 4KK8C 3DBXB 1HNFA 4I0PA 1MFAL 3MJ9A 1I8IA 2NR6D 4FG6C 4ELME 3IAGC 2O61A 1G9MC 1CGWA 3BDYL 2NW3A 3MV11 1RZJC 4NGHH 1PZ5A 1GAFH 2E5EA 2OBGA 1CBVH 3O6FD 4P48A 1FZMB 4KKAC 2F5AH 3AS0A 3MV7A 2IH3A 2J6EL 2AAVA 1JHTB 3BPCB 3JV4B 3UO1H 4IJ3C 1A7NL 2CXKA 4LRIC 3HS0A 3OF6D 4CJ0A 4N9GB 3B4NA 1LP9B 1VFMA 4WFGE 4JHAL 3J8F7 2H9GA 4JAMA 1JFQH 3O6KH 4HXBL 2CUIA 1FLRH 1DBAH 4X8XA 4PGZA 4OCXH 5C0JB 4LLWA 2DYPB 2W0PA 1X4XA 4U1NB 3SE3A 5DJ2A 3O3EA 3C5ZD 2ZNXA 3AVEA 3PDDA 5ISZA 2EC8A 4NQEB 4HBQA 5MEND 1B90A 4XP6L 3QUML 3VGBA 4KMTH 4KAQL 3V4VH 3BRDA 3NCYP 5EUOF 1NANI 2X70B 1BZQK 2OP4H 4W68A 1LDPL 1A02N 3A6BL 4OCMC 4GSDH 5F7HA 2ICEA 2R8SH 1VB9A 4RAUA 4OQTA 4JCMA 4X4YB 5D5MB 2ZUSA 4FQ1H 4WHTA 3DGGB 4PLKD 4C57C 1FVDB 1YC7A 3RZCC 1ADQA 1N7MH 1JTOA 3P11H 2LAGB 2YZ8A 4HD9A 3K2UL 4OZFH 3WSQL 5J9PA 2GY7B 5JPNB 4QWWD 5DRNA 3QFJD 3MRPA 5DRXB