5DMKB

Crystal structure of iag7 in complex with rlgl-we14
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
190
Chain Sequence
SRLGLWSRMDQLERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-D alpha chain
publication title N-terminal additions to the WE14 peptide of chromogranin A create strong autoantigen agonists in type 1 diabetes.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 190
sequence length 212
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmkB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5dmkB01
2B1HH 3DVGB 1YEKL 5GJTL 1R5VA 5E2WH 3MBED 1DFBH 5FUZL 3SKMA 4JFXA 1OTUC 5FK9B 3RWGB 3BDYH 1X5JA 1MFEL 2Z92B 3VGDA 5IK3A 4PR5A 1DLFL 3EYFB 4HV8A 3QUMA 4OGXL 1WK0A 3PP4L 4Y16D 1FRGH 1RJLA 2MFNA 1CICA 1HSAA 5IKCA 3SDAD 3H3BC 2EDHA 3L5XL 4IHOB 1DEEB 1R3LB 4I3RH 4JHWH 4M1DH 4YZFF 2EDNA 4O4YH 1YDPB 2PTVA 3NTCH 2BZDA 3EYSH 3MRLA 5FYKH 1S7UB 3O6LL 4Y19A 4C55A 4LPYA 1ZMYA 4PRBB 4RNRB 4F2MA 4PG2C 5EU6E 3EDEA 5J56B 4HIHA 4P4RB 4CVXA 4XB8A 2X1QA 4FABH 1AFVH 2EICA 2H9GB 1LO3H 4XPBH 5HHXL 1TZHA 2FYYB 5KTEH 4HKBB 3RL2A 2OP4L 1I8KA 2NTSP 3MXVH 2F5AL 1NC4D 2XZCH 3FRUB 1S5HB 5E8PA 1Z0NA 4ESKA 5D7IB 5BVJA 3OTTA 1RZKC 4PTTB 3H42L 5F7NC 2EYRB 3P4MB 3OKLA 1EEYA 1QEWA 3T04D 5SWSB 3GIZH 2DBJA 3U4BH 2MTPA 3MRQB 4XNXH 1AH1A 1TTUA 1KIQB 4LSVL 4MA1B 4FQJL 5HVGB 1YECH 2YWZA 1H3PH 3W9EA 2CKBL 1GRWA 4S10A 1LK2B 1S7VB 1YJDC 1HE7A 4Q97A 3AS0A 1YEEH 4LPTA 5GGVL 1T0MA 1DQQB 5AWNL 3V5DA 1BFVH 4G7YH 4G6KH 5C0NC 4LLWB 4X5XB 3VFGL 5GXBB 1A4KB 4PJFB 4JHBA 5I8CB 5E24E 1YUHA 3MYJB 1J10A 3S7GA 4XRCB 3MTRA 5JUEL 3WNOA 1TETL 4EXPX 2W9DL 1JWUB 5F7YC 3GI8L 2QQKH 4U1KA 4U1IA 4ZFFA 3EJYD 4TULH 3FZUC 4YGVB 5CEZL 3C09B 1EXUA 3WBDA 4MAYC 2NTFB 1X5YA 2XICA 4YDKL 1N2RB 5HHVL 1URLA 5TDPB 3REVA 3MREB 3GIVB 5I1CH 1J11A 2X1WL 4CN1A 4EOWL 3HAEA 5JHDD 3LQMA 2CLZA 2Y07L 4HKZB 5ILTH 4IMLA 4OI9A 1ES0B 1T7WA 1T4KA 5IW6B 1MH5A 1X4YA 3U0TB 4DK3A 4HC1H 3U4EA 4NZDA 3SDYH 1YEJH 1CDCA 3ZT5A 3LKNB 4RQQA 4NGHH 4J3UA 4PRHE 2NLJA 1EFXB 2GTZA 3DTXA 1GAFH 2KBGA 5C8JA 5JORB 3HMXL 2R0ZH 4UINL 3PDGA 5DJ6A 5FF6A 5GGTH 3L7FA 2ICEA 1EEUA 4LPCA 4YEFA 4Z95H 1MCFA 4GKNB 1A3LH 1A7RL 2VH5H 5C6TL 1YNTA 3UTTE 4AQOA 5C9KA 4OM1H 2CIIA 2XV6B 4MGXA 4DGVL 4GW4B 3FQWB 1S7XB 2HH0H 1YYML 2V2WB 4K07A 5C2UB 5GRUH 3O2DA 5I1IL 4QLRA 5D4QA 1NGXA 2DDQL 3G5XB 1DDHA 1EHAA 1G7IB 4GLRH 4F57L 4L8DA 4AT6A 2B7DT 4OTXH 2R69H 1P5VA 3Q0HA 1UJTA 4MX7A 4F3FA 1DUZA 1I3VA 1CLOL 2F19L 3NA9H 2A6IA 3IGAA 1NEZA 1A0QH 4Y0GA 4J12A 5J13B 5J9PB 3WUWA 4IMKC 3ARGA 2A83B 1ZHBA 4UIKL 4X9FA 1EAJA 3TA3B 3V5HA 4QTIH 2D7NA 4Y5XC 4WUKL 4XGZB 1U6AH 1RJYB 4AEIH 2VL5B 4NO2A 3SO5A 3QH3A 1A3RH 1WEJH 1FSKB 2VDMH 2PCPB 1J9CT 4MYWB 5DUBA 4RMTA 4PJEF 5BV7H 1IEBA 4JQVA 4AEHH 4AIOA 5IUSA 3S5LB 5JHLL 1QFWM 4K7FA 1X44A 5JXED 2CKNA 1WZLA 4M1GH 3QFDA 4PGCB 4XNMA 5L0QB 1YEIH 3NVQA 1BZ7B 1KPUB 3ZE2E 1A6WL 4NFCA 2Z93B 3QWOB 1BWWA 1IZKA 5HHPA 3DSFL 4UDTA 4GS7C 1JN6B 5F3HB 2FD6H 5BXFA 4BQ9A 1L7TL 1LEGB 3O4OB 5GZND 5F9JB 1FLRL 2VIRA 5HHOA 3SJVA 3CMOL 3UP1A 2X89A 3EYUL 1INDL 4N68A 5I1AA 3MX0A 5F7DB 4JY5L 5F72S 3C6LD 2Q7YA 1T6VN 3ARFC 3S37L 3DNKA 3OKOA 4WUUE 2YPLA 1RUKH 3L3GB 3T3PE 4XVUC 3TYGH 1NGPH 3WFDH 3QWQB 4OCNC 2AK4B 4XHQA 5D2NA 5D7LB 4JCMA 4HIJA 4J4PD 3VWJB 3C08L 1MVUA 1U8NB 1GGCH 1OP5H 1RI8A 4PJAF 3TN0A 4N0FB 4N1EA 4C4KT 4MS8C 4P4KB 5KSAC 5BZDB 4JPVL 3RAJH 1NANI 4JY6A 3FRPA 1Q9OB 4K3JH 2FZ3A 3VXSE 3B3IB 4HS6B 5ANMB 1RIVH 3T77B 5TE4H 2GYSA 4DAGL 1OHQA 3U1SL 2BSSB 2GFBB 1EFQA 2YD4A 5L6YL 1MPAH 7FABL 1LD9B 1MFCH 3NCJH 1UG9A 4IRZH 2AQ1A 4L4TD 4U4BA 4HEPG 3QDAA 3AFLA 1QRNB 1GC1L 3QUKA 4P3DB 3S6CA 2V2TB 4G6FD 4PREB 4YBLC 1D5IH 8FABA 2C5DC 1KJVB 3N85L 2NMSA 1TZIA 5ESAB 4D3CL 4QXTA 4AH2A 1J86A 1GGUA 1MAKA 5KSUA 3I50H 4RIRB 2C1PA 3KPOA 4OLZL 2DKMA 5INDA 2XA3A 5TFSH 4G8GB 2XZQH 1T21B 3M1BA 2IGFL 5TE6L 1ZGLP 2R29L 3WL9A 1MRCL 3AC0A 1J0HA 4N0UE 1P2CB 5FDYA 2BVEA 4DQOL 3MLZL 4KROD 4XNYL 3FO1B 3EDFA 2OL3H 3HMWH 2F54A 2APXA 4D2NA 5HYSA 4UT9H 4UT6H 5I66B 3U9UB 4B5EA 4P9HC 5B3JE 1UWXK 3QO1B 4U6HA 2VWEC 1F4WL 1CR9H 2NY1C 4ZUVB 1KJMB 4G7VL 5KOMC 5CHNA 3VH8A 1MAJA 4L9LA 4TVPH 1FG2A 3O3EB 3FMGL 3LN4B 4XH2A 2LU3A 2E3VA 4YFDB 3IETA 4G8FA 2B39A 4RWYH 4JY4A 4XBGA 5GPRA 2WBJC 4LVHB 1KB9K 4NKOA 5A43C 8CGTA 3WE6A 4WI2A 3IFPB 4APQA 3B9VA 3GSWB 2P5WD 4LRNL 4OZGE 3HPLA 4RMQA 3PABB 4QXUL 1E28A 5BJTB 2EE9A 2AKRA 1W0WA 2DJSA 4LU5L 4XAKE 4WFGE 2GJJA 3T09A 1PEWA 3IDJB 2WP3T 5J1AA 5L9DL 5HDQL 4YDIL 3T3ME 4IRSD 2Z91B 3EYOA 3MRDA 5D1XC 3MLSH 3DUHA 3UJJL 5IHUL 3D18A 1RURL 5HI4C 2CDGB 4S1SL 1B0GA 5CJ5A 4GAGH 3O41B 5MHSD 1AKJD 1F90L 2BNUA 2DQJH 2EH7H 3S9DB 3HG1E 4YPGB 3KXFA 4P2RD 3WS3A 5C0BB 3IFNL 3KPPA 1ZEAL 3IDGA 4KDVA 3KPSD 3OJ2C 4Z0XB 5I1KL 5HYQB 3QUYB 3AMKA 4U1MA 2B5IB 5IQ9B 4IJ3B 3SDDC 5F7LB 3BISA 2XTJD 3BJ91 3QIWB 3WFEH 3H9YA 2XN9A 3QWRD 3GSNL 2MPAH 1NDMA 3VXTB 3BDXA 3TO4D 3WFHB 1U95A 1U8MB 3FFDB 1P84K 5KN5A 1G7JB 3WHE1 3C5SA 2H32A 1EHLH 2R9HD 4PV9A 2FIKB 1EO8L 4PGEB 4PGDA 5F1NA 3LH2H 1MEXH 1KCUH 3WKMH 5D1ZB 4NO0B 5IQ7H 3ZDYE 2HJKA 1XCTB 4F58H 3E2HC 3VXUE 4QGTA 3TJEL 3MRNB 3QCVL 2E7CA 4N0CD 5HI3C 4K3DH 5FO9B 1T2XA 3CH1B 3IAPA 4WFHE 4L8SC 2A6DB 1B2WL 3OX8B 4WTZA 3KDMB 5ID0A 2MSPA 4OLUH 5SX5K 5IF0A 4XNUL 5BV7B 4M93B 1BVKA 1BP3B 3IFOA 4KTYA 3NCYP 4Z0BL 2FO4B 3D39A 1WIPA 3ZDZE 5FM8A 1HHKA 1QBML 4OKVA 5EU6D 2XG4A 3GMNB 4PGBA 3UBXA 5CWSB 4X4ME 4H25A 4I0CC 2PXYD 3IJSA 5DI8B 4H1LA 4Y4KD 5F1SA 3VI4F 2AEQH 4R8WL 3O6FB 3STLB 5ALCL 4POYA 4OZHA 5DVNA 1J8HB 5KSBA 1N26A 1V8HA 1T1ZA 3OR6B 1EDQA 2R0WL 5D7IF 4ONHA 3HZMB 5ISZA 3UTQB 3TF7C 1NCNA 4PJDF 3AS1A 1P7QA 1EUTA 3DPBA 4X6CB 4PBXA 4DW2L 1NAKL 3B4NA 5CBEB 4LOUD 3VFSB 1GZQB 4WO4A 2WBKA 3KHOA 2IFFL 1P53A 3IDNA 4ZAKC 4FTVA 4KJYB 2XYCA 4L3EB 4TPRL 1F4XL 2ZSWB 3TYFA 5DT1L 5GGUB 1A7NH 5IEHB 3QDJA 2NY5C 1JP5A 1AI1L 3NFNA 4EQ2A 2WWKO 3KG5A 2HYMA 4G3YH 3V7AG 4RBPK 5J06A 4HIEA 2D7PA 1HHIA 1UM6H 4H5SA 1ZVSA 4Z7UB 1CI5A 3NAAL 5T1MB 2ZOLB 1XF3B 2Q6WA 2O5ZH 1A64A 3MV9A 3QDGB 5EU5B 3R0MA 4R0LB 3L9RB 3NBNA 1W72H 3HZYB 4QCIB 4MQ7B 1UWGL 5F88A 4YHOH 4TQEH 3ARUA 3VFRA 2KUTA 2JCCB 1TDQA 4ALAL 4UDUA 4P2OA 4MJ6B 4LVOB 3RPIA 5F9AC 4WW2A 3LD8B 5JOFA 5DSCB 5B38A 4ZTOH 4GBXC 3VDCA 2ARJB 4EIZC 3QXAB 3ET9F 4HLJA 3QZWG 3Q1SH 3U7AA 2IMMA 2X4SB 4PRIB 1T1WB 4I5BA 3GDBA 3RWFB 2D7OA 3BKYH 3DGCR 1G6RH 3MODH 3S88H 4EQ3A 5DTFB 3B83A 15C8H 1U36A 5IESL 2UYLB 4JHZA 2AI0L 4GRLC 2VLRB 1P4BH 4P46D 2HN7B 4LPWA 2DD8L 1WZMA 5M7QA 3FQXA 1TCMA 3HUJB 3MV01 1W0YT 5B4MC 4L8BA 4ZO9A 3FN3A 2GI7A 5IWLA 3E8UH 3BD5A 4UV4L 2UWEB 3VD7A 2DWEB 3GGWB 1ZE3C 1CFVL 2X09A 2EE3A 5L2JB 3VA6A 1HHHB 5CGYC 1KB5A 5FYJL 1X5KA 3GMQA 1ADQA 5E00A 4X99B 2FJGB 3PQYB 5E94A 3GBNH 3RUGB 3DURB 1KJ3H 3QHTC 5IFJA 1IAOB 4QRSA 3S96B 1QSFA 5I71C 5EIIA 3GMMA 3AROA 3QIUA 2ARJQ 3PL6D 4OIAA 5D5ME 4XXDB 1DBBL 3UTSA 5F6IB 1ED3B 4TYUA 5T1LD 4D9LH 5F44A 1WAAF 3RU8L 5AG8A 1AGCA 5KZCD 3IDYB 3MRJA 2I07B 2WIMA 4PLJD 1NUNB 5CINH 3PNWB 5C0EB 1X5IA 3ALPA 3TIDB 4A6YA 4D9RE 4NRYA 3U0WL 3Q6GH 1AXSA 3PGDB 4UNTA 3T1WA 2ZZUT 2YZ1A 1SJVA 1AGDA 2G5RA 4R26L 1I3RA 1OAXL 1MELA 4NQCE 5HGBA 3JBG7 1A1NB 5I8EB 7CGTA 2QSQA 3FTGA 3HE7D 4UTBL 1BIIB 1R3HA 2Z8WC 2R2BB 3HC0A 4HJ0C 5EDXA 3G6AA 4U1NB 2MJWA 3IDIA 2DJ4A 3BWAA 1DBAH 3C5JB 1QBAA 2B0SL 3I9GL 1MI5A 3SGEI 3MNWA 3F7VA 1CFSB 4NCDA 1PYWA 1OVZA 2BVTA 3BGFC 3L3HA 4I0PD 3KLAA 5D2LE 3KR3H 1MREH 1T5WA 2H8PB 5E1HB 5I73C 2R23B 2W91A 4CMMB 3DX8A 3TT3L 3LEYH 3N1QC 5E6ID 4WUUD 5IB2B 1DVFB 1LWRA 4U6TA 2XXCB 3QUMH 2GIYA 4O2EA 1UQSA 4HXBH 5MP6L 2WAHA 4XCCL 3L3IB 1MCOL 4K2UH 3B2VL 3W5MA 5IMOB 1JPSH 4RAUB 4HWBH 5JLZB 4TNVF 4OAWA 3NMEA 3O4LE 4JGJA 4ZSOE 3VXSD 4MNGB 1IAII 5CJXA 1HI6A 4RGMC 4ZQKA 3BQUD 5CJOL 2FBJL 3QHFH 5GJSH 3DRTB 5EN2A 5CD3A 1QBLL 1A6UL 1F6FB 4UTAH 3OR7A 5MENB 2DQTH 5BOZG 3GKWH 3EYQD 1WIUA 3WO3B 1BD2B 1KXVC 4JRYB 1FVEB 2EKJA 1WBXA 4MD4B 2FRGP 2HT2D 1RUPL 3R8BB 5JZ7D 4P48A 5EZOL 2EE2A 4N8PA 5EC2B 2IALB 3X12B 2EIZA 2A0LC 1CVSC 1AE6L 5SWZA 2NW2A 4DTGL 2QEJA 3F12A 3UROR 2C7UB 2XXMB 3SCMD 1J5OL 4Y1AA 2Z31D 4JJHA 3RVUD 4NNXA 1DBMH 1RULL 4LSSL 1H3VA 1RZJL 4JVWA 2QBWA 3FFCE 1CGVA 4OD3H 2X10A 4KUZH 4ONFL 5DJDA 1SYSB 3DO7A 3RGVA 3HR6A 1OARH 1LHZA 4W6WB 4XMLH 2UUDH 4NWUH 1W72B 4OCYH 3TWCH 5IM7A 4K3HA 1A6VH 3ROLA 1F6LL 3JV6A 1ZS8B 1BVLB 1HINH 4LSRH 5FV2A 3G6JE 3V52H 2K9UA 1I8LA 4HLZG 5EO9B 2PYED 3ULUE 2BJMH 1ZT4A 1G1CA 4MNQE 4BUGA 2IBBA 3BE1H 1IEAA 4X5LA 3LHPH 1U8PB 3IU3B 3LS5H 4G80B 3TFKC 5BQ7B 4MAUH 4JG0H 3TZVC 5ACZB 2YXMA 1C08A 1Y0LA 2R56L 2HT4D 5DJXA 1F02I 3QI9A 4G6AD 2NX5E 1QFUH 4UNVA 3T0DA 1CGUA 3WYRA 4N1CA 1JZ4A 4XAKD 4M00A 4WFGD 4S1DD 3WEXB 5FA4A 1G6RB 4LLYA 4C56A 4P9HH 5GISH 4DFIA 5I76A 2IANE 3L5HA 1XF4A 3F7PC 2ZUUA 3PWPA 4XTRD 4OLYL 3L95B 3TJHC 1MJJB 5EU7E 3SEPA 4TSCH 4JFDE 4PB9H 4GG6F 5A1AA 5TGBB 4JFFB 1AP2B 1IM9D 2NY3D 3HG1D 1D5ZB 2VR4A 4K71B 3OKMB 4RFEA 4X80L 2LAAA 3GM8A 2BRRL 5E2TH 5LGHH 4GW5A 1YMME 4YZFE 3WHE0 2ZUQC 1BJ1H 3V6OC 3MMEB 1VENA 3LCYA 3KJ6L 3SKOB 1CXEA 1TJGH 2FX9L 3OKNB 1WT5C 3NPZB 4ZUWB 2JJTA 4Z7OF 1K85A 1FZKB 1UM4L 5EWIL 3HZKA 1C1EH 4G8EB 1KIUA 1JWMA 3G6DH 4BZ1L 2BHYA 3MC0A 4XC3L 4OCLC 3TT1L 3QHZL 1A6ZA 4C83B 1X5GA 1JRHL 3ARBD 5GZOD 2ZOKB 3VWKB 2QHRH 5H35B 2VE6A 2GKIA 1J18A 1Q0YH 4WHYH 4WFHD 4YE4H 2I60H 1LEKA 4JM2B 2EDBA 3MR9A 2X4PB 1H5BC 1LO2L 1NBYA 4YDJA 5FGRA 2XZZA 2F9BT 1JBJA 1KC5H 1QSEA 4KJPD 3T8XA 1B9ZA 1ZAGA 3VD5A 5IMMB 1IILE 1T0NB 3S37X 3EBAA 2Y5TA 2AV1B 3ZHDA 3BP4A 5GGQH 1Q0XL 4G6JH 3QA3B 3RNQB 5EORL 4IEFB 2AABH 2GHWB 4RZCA 3CLEL 4QEGA 1JPGB 3MJ6A 5L2KB 4UILL 1D5BB 4PJ8A 1VGEL 4PG9A 1ZHLA 3MRKB 2JJWA 4MQXC 2A73A 4P5MA 5J3HC 5E4IA 4LQFH 3RY4A 1KCKA 1R5VB 3QEHA 1ACYL 5ICZB 3SKMB 3GMLA 1JF6A 4JFXB 2WIIB 1J05B 2DLFL 2QKIA 3MOAL 4YHYC 3AAZA 4QOKE 1NH6A 3DI3B 4PR5B 3Q2CA 4XMPL 3QUMB 1WFOA 1I9RL 1RJLB 3ZDXF 1CICB 2FECI 3BZFA 4GS7B 5IGXL 4G5ZL 1K4DA 2EKSB 4KGJA 3TGXA 5C08A 2Y36H 3KS0J 2EEBA 6FABL 4Z7UF 3RQ3A 5LCVL 3KYOA 4G8IB 2W59A 4Y4HA 1RUAL 2NY2B 1FVDB 3MRLB 2HRPH 4JPKH 5H94A 4FNLL 4Y19B 12E8L 2FGWL 2FIRT 4XNZC 1FO0A 2R0KH 1VGKB 2NY4C 1D9KA 4LHJB 1G0YR 3HN3A 5EOCL 2G75B 5EULV 1NDGA 1I8KB 4X4XA 3S5LG 4QWWC 4JM4L 5KSAB 4O5LL 1F11A 5IB3B 4OD2B 3M17A 3QNYA 2EO1A 3PHQB 1KN4H 4J8RB 4JFZH 4KI5F 5E8PB 3ZYZA 4DN4L 3HC3L 4BFBD 1CF8L 5JA8B 3EJZD 5MEOA 2ZCKL 4OZIB 2VZUA 4HGKC 4Z8FL 1AHWA 4KJWC 5ALBL 5F93C 3ZYIA 4ZNEE 1QHOA 4JKPL 1WZ1L 4I18C 1X5AA 4N0YH 4H0HB 3KPRD 4HXAH 3GHEH 2V2XB 4OFYA 4PJ7F 1GC1C 3L1OL 5ADPL 4KAQL 5INCB 3QJFA 4N0RA 3DO3A 3W9EB 4LEOA 2Q76A 4QF1B 1Q1JL 4QRQA 3BD4A 1SBSL 3V5DB 4XVSH 2UWEF 1VPOH 3MUGA 1U8OA 5E5MA 3LMJL 3S97C 1M7IA 2FB4H 5KVDH 1YUHB 4CJ0A 4I2XA 4PJEE 1XR9A 1JMXA 4PJIF 3QNZA 2VJXA 5DD0H 4WI8A 5CUSH 4P2QE 1N6QH 1UKTA 3DLQR 1AGEA 5IROC 4U1KB 2EDYA 3HFMH 4JZOA 4LLUA 4HS3A 3CC5B 1PDKA 5I30H 3BP5A 1EERB 4U0RC 3HI5H 1ROWA 2GEEA 4WWKD 4XC1L 4ZYKA 1LEIA 3HNVH 3REVB 3MGAA 2X05A 4RMRA 1OF2A 2NY1B 5BRZA 3L3OA 3ARZA 3QDHA 3WN5C 2VKWA 4NRZA 5IFHL 3ETBF 2CLZB 2E7LC 4IMLB 4U33A 1BMGA 3T4AA 1QLRA 2G2RA 3QCUL 4YFLI 1DL7L 1HHJA 1MH5B 2IQAA 4TSBL 4Y2OA 43C9A 3MZTA 1CFNA 2FR4A 4HSQA 1HYSC 3RBGA 4OQTH 4NOFA 4HK0B 4RQQB 1KENL 1SJXA 4I77H 2NLJB 2GTZB 4D9RD 3FOMA 3O3AA 4RFOH 4M7ZB 4LF3A 1EV2E 4W6YB 1HILB 4ELMA 1C7TA 1J7VR 3VRIB 5JXAH 2NW3A 3BN9C 5D1XB 5C07A 3L7FB 5E99L 1LQSR 1I7UB 4PJAE 4N1HB 2H2PC 5DK0A 3QFJA 2BDNH 1ZANL 1RMFL 3EYVA 5CJQL 1T83A 5GRJH 4MWFA 2CIIB 4ZD3L 5IBLD 4JFQA 1FPTL 4MA8H 2RGSA 3BRGC 1DDHB 4L8DB 2F53A 4CVWA 3HE6A 4PGZA 1D7FA 1DUZB 4IIQA 5JW3L 2IAMC 5C0RL 2A6IB 2AGJH 3IGAB 5E8NB 1NEZB 1PG7W 3EFFB 3WUWB 1C5CH 1XF1A 2ESVE 3QUZA 3V6FA 3V5HB 1FGNL 1AXIB 4K23H 4XPHL 2ZJSL 4JEGB 4NUGL 1YYLH 1CBVL 1TVDA 5EBGA 1SM3L 1X4XA 2V7NA 4K3EH 1WBYA 3PWLB 4EKXA 5EUOF 4LLVA 3MRMA 1G0XA 4NO2B 3ME0A 1RIUH 1YEDA 5DUBB 4WJ5B 1IEBB 5EOTA 3SDAA 5LG1A 4K7FB 4OBSA 3QFDB 4XNMB 1FYTE 3T0WA 3LKSA 5EZLB 1D5XA 4JN1H 4LKXA 4OZFA 4LKCA 1RVFL 2X7LA 1FNFA 3E6FA 3NABL 3BZDA 1HIMH 5HHPB 4X4ZA 4UDTB 3EOTH 3QNXA 1K6QL 4JPWH 2Y1VA 3EKCA 5BXFB 3UJTH 3PP4H 1NGWA 5HHOB 1CK0L 5IVNA 3WNLA 4H20H 2DMKA 1F3RB 5I1AB 3LB6D 1UJ3A 2YUXA 3WIHA 3FFCD 3G5VA 3NZ8A 4R90L 5HTSA 3RTQA 2P48B 2UY6A 4NQEA 4JREC 3OKOB 2YPLB 2AXJA 4PJHE 5CP3A 3K4ZA 3MOBH 1YNLH 3BHBA 3C8KA 4U7KA 4UOW1 2XQYK 2EDEA 4ZOCA 5FB8B 4HIJB 2NQCA 4LVNB 1Z5LB 5LXGL 2CGRH 3UYPA 2MKLC 4NWTH 2R2HA 3TN0B 5D9SA 4JRWA 3BPNC 4LK4A 3BW9A 4Y89A 4JY6B 5CILH 4HBQA 4X9GA 1DQML 1L0XA 1WWWX 2GITA 3ULUD 5CBAA 4MNQD 2OP4H 4EI5A 1XMWA 3ARPA 3D0VA 3VFTA 3ZKMC 5E5RB 1OCWH 1A7OL 5DJAA 3U46A 5FECA 1NL0L 4MJID 1T20A 4ZXBC 4YXHH 4MZ3A 2NX5D 3QUKB 5E03A 3ULVL 3DVFA 2N4IA 8FABB 4OFKA 3KPMA 5J6GA 2DQUL 4PD4J 3ARDC 3I84A 4QXTB 4AH2B 1G9NH 1KNOB 3CSBA 3JV4A 2YRPA 5I0DA 5KSUB 5TQ2H 3ZKNC 4H8WH 3K1DA 2C1PB 1KBGL 2ERJC 3KPOB 4BSVA 5GS1A 4BQBA 4Q74A 1V7MH 5D93C 5CCKH 2DM3A 3M1BB 2HRLA 2AJYL 2R4RL 2SEBB 3B2UC 1MRFL 2GJ6E 2X41A 1ZA6A 3VFGH 4CNIA 4M5YH 3MZGB 3LN9A 3DV4A 3SE8L 2AEWA 2NZ9D 3V6ZA 4Y5YC 1MHCB 1BOGA 4PJ9C 1TETH 3QQ9D 4M7KL 4LCCB 3WNNA 5A3ID 1BREA 3PDOA 4U6HB 3U6RA 5I74C 3D3VE 2HTKD 5CHNB 3VH8B 1OTTC 1AO7A 1CFQB 4L9LB 3U9PH 3OZ9H 3MJGX 4FQHB 4XH2B 5HHVH 3VI4E 4G8FB 3CX5J 2QADC 2VLLA 4JY4B 4XBGB 1EIBA 3WE6B 4EOWH 2AXGA 4OV6F 4ORZC 4P9ML 4APQB 3DETC 3HPLB 2IADB 3MACL 1P6AB 4WEMB 1E28B 2EZ0C 4RGNC 4PRNA 3KJ4C 2A6JB 2AKRB 4E5XA 3MJ9H 1W0WB 4PJDE 1CLZL 1YQ2A 4MNHA 5DFWH 3MRDB 3C60A 3ELAT 3JSSA 4YXKL 3G9AB 2P8LB 1IC4H 1MHEA 1OTUD 3ZTJH 4H88L 4P49A 1B0GB 4LCIH 5K9KB 5C0AD 4X6BA 1PLGL 2AK1L 3ORJA 4NQVA 4KKBC 4X9BA 3QDME 2OXGA 3O9WC 1I7TA 4QHMB 1BOYA 1R3IH 2ZUXA 4U49A 1H3UA 1BFOA 2A1WH 4HZLA 4LLMA 4A6YH 2HKFL 1I1AA 2XN9B 3W0WD 4DKFH 4O9HL 4NP4L 4X7SH 2YMXL 1WTGT 3I3EA 3QPQD 5KN5B 1IFHH 4QNPF 4AYFA 1FH5L 5EC1A 2J8UA 4X4YA 3ARRA 3MUHL 4OLXH 2Y9RT 3TNMB 4PV9B 3VCLA 2V5RA 5DRNA 3MBEC 1FG9C 1FORH 2E27H 3PWJA 4PGDB 2IC2A 1CLOH 4QOKD 3IJYA 6CGTA 2ITDA 4KK5D 2HJKB 4Y16C 1FDLL 2ZWLT 4UIKH 5HYFA 3FB6A 4I4WA 2Q8BL 1FN4A 1MCLA 4KXZI 1OGTA 4V2CB 3KYKL 5ID0B 1OLZA 3O6MH 4QRRA 4KRNA 1BVKB 1FBIH 2VITA 2ZP0T 1HHKB 4OKVB 3GNMH 1C12B 5GRZA 3UYRL 4L8CB 5DS8B 2OTWA 3IJSB 4H1LB 1G7QA 4BA8A 1XZ0B 2Y23A 1JNNL 4JZJA 1XF5A 1NSNH 3UDWC 4J4PA 3QRGL 1BEYL 5C0ND 3NH7L 4QHNA 5KSBB 4G9FA 4P23A 1IKNA 2X9YA 2LABA 1T1ZB 1BQHA 2UZXB 2WV3A 4ONHB 5ISZB 1HHGB 3EYUH 3AU1B 5F7KC 3RJDA 1KYOJ 1P7QB 4F9LC 1PQZB 4NN7C 2P5EE 2AJXL 5T5FH 3JVGA 4ZOBA 4Q9BA 1DSFH 5D1QA 3QXVA 4MA7L 2YA2A 4EUPA 4MAYD 1H3TA 3C8DA 3IDNB 4FTVB 2I9LB 2HJLA 3WS6A 3MGTB 1CGTA 2J4WL 4G6ML 1KCRH 3P4NA 1UGNA 1GSMA 3S3SA 4RA3A 2DBLL 4TRPL 1QTYT 2DLGA 3MV8A 3QDJB 1KLUA 1P69B 4EVNB 3NFNB 1E0OB 4CJ1A 1PKQA 4LDOB 4HUXB 4HIEB 5DJ2A 1HHIB 1SJHA 1CE1L 1INEH 2J6EL 1NLBH 1RZJC 5FOJA 4DAGH 1SY6A 4URTB 4G43A 2E7MA 3HB3D 4R4FL 3CXDL 3DYOA 4OIIH 1TITA 3CFIC 5EZJB 3Q5OA 5F88B 1QA9A 5DD5L 4DCQA 3EJYC 3BKJL 1GC1H 5J57B 3NIDE 3ARSA 5F6HJ 4XPTH 4UV7H 1BGXH 1ZA3B 5FGBA 1C16A 4UDUB 1FFPA 1PJ9A 2KQNA 5E8OA 1Y6MR 4ZFZB 3RPIB 1U3ZA 4I3SL 5DMKB 5JOFB 4PJXB 4Z7QF 3LQZA 1TVHA 3PJSB 4OLZH 2NNAA 2WNGA 3CD4A 3QEQA 2W65A 3MV7E 4Y5VA 3RIAF 4I5BB 3AREA 1W8OA 5CLTA 4DQOH 5KG9A 1BQSA 3DMMA 3OKDA 1MFAL 4YO0A 3FQNB 4JQXC 1MJ8L 3D0LA 1UACH 4OFIA 4P3CH 4R3SB 1JZ5A 4OKDA 4EN3D 5IVXB 4L8BB 1L9MA 3RKDC 3OGOE 1GL4B 3E0GA 5ADOL 3EO0B 3I6LE 2DQEL 2DJUA 2X4QA 2VLKA 3BYTA 1T1YB 1HH6A 1NLDH 3V4VL 4HD9A 1KUMA 4JB9L 1FJ1A 4LRNH 3ARXA 5I17A 1DE4B 4FFZH 4IRJA 4QHLA 5F21B 3VXRB 1KB5B 3HTLX 2BVPA 3RDTA 4WDIA 1QRNE 4Y4FA 1I9IL 4LARH 4CMHB 5IFJB 3O45A 4YUEH 5FM5M 4ZO6A 1NGYB 5KVFH 2F15A 2F5BH 4JAMB 1FL5B 3W5NA 5EIIB 5IHUH 3GMMB 3QIUB 5IBTL 3TBWA 3OXSB 1A9BB 4JO4H 2HLAA 3PWNA 3RWIA 5IJVA 1F90H 3UTSB 5DC9B 3GBMH 2RR3A 4DGYL 3F5WB 5IB1A 3MRJB 2HP4A 1G84A 3AB0C 4AZ8A 1CQKA 3BGMA 3SE4C 2CDFA 4A6YB 2OK0L 2ED8A 2FATH 2GSIB 4ONOA 4F7CA 1AXSB 1OGAE 1EEZA 3ARFD 1AGDB 3MBXL 3RY5A 1I3RB 3GSNH 2WQ8A 3DXAE 1CU4H 5DA4A 3HNSH 4KFZC 5JXEC 3E1F1 3H7LA 1H3XA 3L6FB 4JO1L 5HGBB 4HQQL 4XVUD 3MLYL 1H5BB 1AGFB 4GO6B 4HT1H 5BS0B 1NAMA 4Q6IA 3FO2B 2QL1A 4AL8L 1R3HB 1P7HL 5L7XH 3T0ED 2I24N 3G6AB 5GS2H 2XKNA 2Z35A 3WKNA 3DHMA 4NO3A 1MI5B 4QHUA 5GZNC 4M7JL 3RWHA 4HWEL 3MNWB 2Q87A 1EAPB 3CSPA 1PYWB 4F9PA 3L3HB 3KLAB 5FO7B 4UOW0 5T5NF 4B0MM 2X42A 3ES6A 1KULA 3PGCA 4HPYL 3C6LC 4LLDA 3HCVB 4E41E 5DHXB 1E6JH 2V9TA 5DD1L 1ZLVH 3P73A 1IBGH 4LNRA 4O2EB 1UQSB 1PG7H 2V7HB 4R7NA 4HUMB 1BF2A 2VC2L 5GS0D 1N0XH 4WU7A 1I7RA 1MF2H 2BSRB 3K81A 3MPCA 4XP4L 4U2YA 4GG6E 3PGFL 4GFTB 2BCKA 1UVQA 4QRPE 3QISA 3C5ZC 5ALCH 4IDJL 3BPLC 1N5AA 2XFXB 4M6ML 1HI6B 4ZQKB 1YN7A 4Q6YA 2OR7A 4OCRH 5EN2B 4DFHA 5CD3B 1UT9A 3F7RA 5FHBH 3OR7B 3MXWL 5HY9A 5A2KH 3F6IA 4NQDD 3VXNB 3T0VA 3BD3A 1KFAL 5DHVH 3U7YL 4OCSH 2YD2A 5A2LH 5TE7H 4PRDA 1RFDL 4O02L 4Z7OE 1MUJB 4YDLC 2EIZB 4PJGB 2R8SH 3HS0A 3P0YL 5A40E 5I15H 1DCLA 1F4XH 5HDLA 1E27A 3IU4L 4NNXB 3LKRA 2IPTL 4LRIC 4S11A 3AM8C 5C86A 1AI1H 2OZ4H 1YQVH 2OQJB 3HZVA 4FN0A 4WI6A 5I1GH 1MLCA 5DJDB 2GJ6D 5DQ9A 3LOWA 4UBDD 1IC7L 1ORQB 1RY7B 3FAWA 2AJUL 4X6DB 4HH9B 4KROC 5CEZE 4RGOL 5IM7B 1KV3A 3D87B 2VYRE 3KYAA 1OM3H 4RX4D 5I16A 4BZYA 3SGDH 2B1AL 3D3VD 4PRHA 1BZQK 2Z4QA 1ZT4B 5H2BA 3FN0H 1IEAB 3DJ9A 5FUCE 1JNHA 3PWUA 5AYUH 4P46A 1LP9B 1NMAL 1NC2A 2C4FT 1GOHA 3F7YA 3DX7A 4YBHA 1C08B 1Y0LB 4V1DE 3SDDD 4L4VA 4J6RH 3RX5A 2YA0A 4TNWK 4K94C 3QI9B 3JWOC 5F97E 2E8ZA 2CRZA 3NCCB 4JO3L 4CAGA 4HS8L 5DURB 3I02A 3ZE0E 1NFDF 3UTTA 2IH1B 4KK6D 5M95B 4LLYB 4C56B 4IOIB 4NC1C 4IRSC 1NMBL 2WQRA 3P2TA 3DVGA 4HIXL 5L8KB 5E08L 2HFTA 3PWPB 5AZ2L 5B39B 4OCWL 2AI0H 1TJIL 5FK9A 1U8KA 3ZDXE 2GSGA 4RFEB 1TVBA 4KMTL 3X3GH 1LO4H 4Q2ZB 5ELIA 1OP3K 1JPTL 4GW5B 3UPCA 2BNQE 2CJUL 3SO3C 5ITBL 4IHOA 2BSTA 3NPSC 5LKNA 5HHMB 5KS9E 2XTJC 1JNLH 4C4KO 2NY7L 2WZPD 1S7UA 5FYJH 4JJ5A 4FZEH 3TO4C 2HMID 1GGIH 4PRBA 4PJCB 1LK3L 3N9GL 1NBZB 3HZKB 1LO0L 1JWMB 3S36H 3WV0A 1OAQL 5DRWA 2H9GA 3MCLL 1HKLH 5FYKU 4UQ3A 3HE7A 1TZGL 3JUYA 3Q6FA 4X6FA 2P43B 1UM5L 2DLIA 4Y2DC 2VE6B 4U2ZA 4NJ9H 4KI5E 4N0CC 3WD5L 1LEKB 2VQUA 2MCPH 1BZ9A 2DM7A 1QFPA 3MR9B 3MRBB 3WO4C 1NBYB 5HGAA 3X3FH 4YDJB 1QSEB 5GQBA 3VJ6B 3HAEG 4M48L 3C87A 4PJ7E 5SWSA 1UC6A 3CDGB 3MRQA 2Y5TB 3CFBB 1KELL 1MSPA 2H41A 1IGML 5DFVD 4HCRL 3BP4B 3GHBH 1BPVA 2Z8RA 4YHKH 1A1MB 2PXYC 5K9QG 5CD5C 4Y4KC 3VXME 4OZHF 1LK2A 1S7VA 2CQVA 3H9SE 4DOHB 4RZCB 3V4PL 1DQQA 1YMHA 1KCVL 2HWZL 5EOQL 1MHPH 4PJ8B 1QP1A 4LLWA 2JB5L 4X5XA 3WSQL 4PG9B 4PJIE 3TV3H 1KEMH 2A73B 4P5MB 5I9QB 2EYSA 5I8CA 4OZFH 3CMGA 3MYJA 4M8VA 4O58L 5I75C 2P5ED 4XRCA 3QEHB 3RHWF 5C0CB 3FQTB 3GMLB 1C7SA 1JWUA 2AP2A 4FQXC 2QKIB 3AAZB 1E4XI 4LOUC 1M71B 2BK8A 2G60L 2PO6A 3BZFB 4ODTL 2NTFA 4OD1H 1JIBA 1MJ7H 2A77L 1IKFL 3O8XD 3MREA 3W39B 5C08B 1A47A 2WP3O 3WIHH 4NJAH 2C4FU 3DWTA 2C3HA 3L5JA 4MLIA 2XIDA 4U1LA 2Z31A 1ZT1B 1NEZG 1RU9H 2OLDA 1FO0B 3OMZA 3WUWG 3MYZA 4N5UA 3LKOA 1D9KB 3QR2A 1MNUL 3HC4L 5J4MA 5DD3L 1R5WB 5JORA 4YJZL 4N0UA 4GRMB 3N50A 3VXOB 1KLGA 3K80A 2QHLA 5C09B 5EZOH 1MAML 2VXQL 4WW2F 3VG9C 4J7RA 1LDPL 4NUJB 5HYJE 1LILA 4X6EB 1KSRA 4GKNA 3M17B 3GJFA 4FFYL 1JTTA 1FNGA 2Y7QB 3QNYB 5D7JC 4EBQL 1JHTA 1SBBA 4OUUA 1FNLA 2BSED 4GW1A 4OM0L 1BHGA 4XP1L 5MEOB 1FNHA 2CK0H 5CSZB 3MV7D 5B8CA 2CLVA 3O3UN 4ONFH 3FQWA 3V7MA 2BVOB 4OZGA 3ULVC 4XI5D 4ZXBB 3QJFB 1MCQA 1JYXA 4KUCF 2VL4A 2AK4D 2Q76B 3NZHL 4QRQB 1KOAA 3MA9L 1PBYA 2C9AA 5J9PA 5T5NG 3CVHL 1K2DA 3TA3A 5EUOE 1M7IB 1IAIH 4UT7L 3MROB 3A67H 4I2XB 4XGZA 1XR9B 3EDDA 3QNZB 4FP8H 1CDYA 2VL5A 1JJUA 4F80A 1BF8A 2DYPB 1RUQL 5MI0C 1AGEB 4WVRA 4DUXA 4JZOB 4Y5YB 3QQ3A 4ZS7L 1QRND 2ADFL 3FRPG 4XP9L 4JRXE 1KPUA 3ZO0A 1LEIB 4ZYKB 4M61B 2NXZD 4GKSB 5IV2B 5I74B 5BRZB 3L3OB 2CDEB 3QWOA 1CLCA 2VR5A 4NRZB 5EU4A 3EOYG 3PL6C 3T4AB 1QLRB 3W81A 4PFEA 1LEGA 1KXQE 1CFNB 4NN5B 2RQ8A 1G7LB 2BRRH 4MQSB 3WXWL 1CGWA 1CXLA 2KZ1B 5DZOA 4JPIA 2VZTA 3ARBA 5F7DA 3O3AB 4UOJA 4PJBB 3VXUA 3ULVF 2BOCA 2R1YA 2PF6A 2NZIA 4ELMB 2JB6A 3TH3T 5HI5D 1BQLH 3L3GA 1AJ7L 3SKNA 1H0DB 1QFWL 4TUOB 1UA6L 4OF8A 2FX8L 5IVZB 4RISH 1AXTH 5DK0B 5I8OH 3QFJB 2NPLX 1D6VH 4GAJH 4HKXA 1BAFL 1CD9B 5E9DE 1U8NA 5EWIH 3HR5A 3TBYA 2P4AB 1XIWA 2XY1A 2AW2A 2EO9A 4P4KA 2OCFD 3T65B 4Q9RL 5HGDB 2IPKB 3RA7L 3T2NL 2D4DA 2WUCH 4QRTA 1Q9OA 3A0OA 4HFWA 4X4MA 2DM4A 1JGEB 1JFQL 2QR0A 3B3IA 4HS6A 1ZGLA 5ANMA 1SY6L 4HGMA 3VDAA 1Z0MA 2BSSA 1NCBH 3VH8G 2P1YA 1BFTA 2KL6A 5DQDL 1N7ML 3BKCH 3IRZA 2F53B 3HE6B 5I1JH 1JGLL 1EGJH 3I85A 1LO2H 1T89C 3BXNA 3RY6A 3AVEA 4M7LH 5E6IC 5IEKB 3A6BH 4ZFOA 5K59F 5JOPE 3QUZB 1EZVX 3EOAA 3LQAC 5F1KC 1UWEL 1UYWL 1WBYB 1Q0XH 4LLVB 4ZDHA 3SQOL 1S9WB 4Y16B 1OP5K 3SE3C 5EOTB 2M2DA 2FLBT 3SDAB 3CLEH 1RJZA 4HEME 3TVMA 2IPUK 3BQUC 3RP1A 1P2CA 1UZ6F 1D5XB 4LKXB 4OZFB 4BM7A 3JTTB 1Z9OA 2X7LB 5DZNA 3E6FB 3H7BA 3O3DB 4NHCH 3UO1L 5KVEH 3QEGH 3CDFA 1R6VA 2AERT 2EH8H 1J0JA 2HT2C 3D9AH 2XQBL 3QO1A 5JZ7C 2I5YL 1DBKH 1JYWA 3CK0H 1KTLB 4ZUVA 3VFOA 1KJMA 3CFJA 1L4IA 4L29A 5D1ZD 4NO0D 4UUJB 1B0WA 5L8JB 3SOBL 5IT2H 2HLFD 4G5ZH 3LN4A 5E8DL 3TFKD 3W11C 3SCMC 1UJ3B 2LFGA 3TZVD 2WW8A 2QQNH 4YHZH 1LMKA 1L0QA 6FABH 4NQEB 3QCTH 1RUAH 1NC4B 4CUCA 1MIML 1MWAL 5FHAL 4HC1A 2YD7A 5DDHA 4K9EH 4EUPH 4YHMH 3IDJA 5CEZD 3GRWH 4LLQB 2Z91A 2R2HB 4PY7A 3SY0B 5DGQA 5BCAA 1A5FL 4PRPE 3TJHD 2CDGA 1V5JA 4WTZG 2I27N 3VE0B 5GGTA 1P4IL 2GITB 4YK4C 3H9ZA 5CBAB 5EOCJ 4EI5B 1NCUA 2H1PH 3ESVF 4NT6A 3ABZA 2D2OA 4O5LH 3D0VB 1DBJL 1J8HD 3VFTB 1Z3GL 1CTOA 3IXTB 2A9NL 3QUYA 4LAQL 1MHHA 2D31B 4JFEE 2PN5A 4N8VA 2ZCKH 3DX9B 2HT4C 4H1LG 3QIWA 1X7QA 4NCC2 4QNPE 3J8F7 4JKPH 4XP6H 3KPMB 3ZYOA 3CVIL 3WFHA 2VDNH 1U8MA 4S1DC 5ADPH 2LU7A 4MHHI 5I8KH 1ORSA 2FIKA 4DVRL 4L3ED 4P3WA 5GS1B 4WENB 1K9TA 3STBA 4YBQC 2EDQA 5AAWA 3FHQA 4RGNE 4YHLH 3IRPX 5GGSB 4FZ8L 5CSBA 5D6DA 3IVKB 5JQ6H 3DVNB 5FO9A 5FYJE 4Y19E 4K94H 1BOGB 1X5ZA 3BH9A 3JWOH 2VISB 3KDMA 1N64H 3QG7H 2BY0A 5HJ3B 5JTWA 2WUBL 3P30L 1CDJA 3PDOB 2ADGA 3UMTA 5H37G 3VFPB 3ZSTA 2VSDA 3ZTNL 4WHCA 4X7TA 4X83A 1CZ8H 4Q9QH 2HJFB 4LSUL 2VLLB 3WCYA 5TH2B 4TOYH 3BAEH 3MNZB 4NQCA 2AXGB 1KG0B 2VDKL 1NQBA 4P59H 2F58H 1HH9A 2NR6D 4P99A 3O6FA 3STLA 1MRDL 4JDTH 3CZFA 5GZOC 4PRNB 3DECA 4Y4HC 4DN3L 4KI5D 3OR6A 1MJUH 4WEUD 3HZMA 4MNHB 3UTQA 4PRID 3ZL4L 3C60B 4P5TA 2Q20A 4X6CA 4KVNH 2E6PA 1JZ2A 5JO5B 2VZSA 2YSSB 4D0DB 5B38G 3DUUA 3QUXD 5D2LA 5CBEA 1JGUL 2YN5A 5EA0L 3WFCH 3VFSA 1GZQA 3OV6A 5IW3A 1U3HA 3REWB 3V5KA 2ZSWA 3HHRB 1NGQH 4LASH 1ZTXL 3VXMD 4HZLB 1RMFH 2NXYD 5CLWA 3ZKQD 1BECA 3QIBD 1P7KA 3FO0L 5IEHA 3H9SD 1F8TH 1ZHNA 4IBLT 1CT8A 5CMAA 3FAXA 3RX7A 1G7HA 3RWEB 4ZODA 1QG3A 5EC1B 3O4LA 4X4YB 3QDGA 1NAMH 5DRNB 3LZFL 1XT5A 1T2QH 3PWJB 3HZYA 1U2CA 1BFSA 1AD9A 3IJYB 1RZFH 4YR6B 1L9NA 4P2YA 2CSPA 4YAQB 4MVBC 3RZCA 2VOTA 5TPWL 1YEHH 4I4WB 3BYYA 4Z7QE 1CBVH 4MJ6A 3UC0H 4KRPD 4WEBH 1OGTB 3TPUB 2NCMA 5DSCA 1KB9J 2O5YH 4UI2A 4QRRB 5C3TA 2ARJA 3QXAA 2BP3A 3CH8A 3VGFA 2VITB 1JPST 5E95B 1A7BA 1T1WA 4NZUL 3C2AL 2EDKA 3GK8H 3FFCA 3RWFA 2GTWB 2XACC 5FGCB 2JLLA 2OL3A 5TQ0L 1G7QB 1OAUL 4U1JA 5DTFA 3WMSA 2UYLA 2VLRA 4JGMA 4JQIH 2HN7A 4MXWL 5CZVL 3ZKSD 1AR1D 3HUJA 1IQWL 1IGIH 3CXHK 3JTSA 3MLUL 4P23B 2V17L 1BQHB 5T3ZD 5HYJD 1OAKH 2DQIL 4YHIB 3BKML 2ADIA 4GQ9L 4L5FL 3GGWA 3BPLB 4WCYL 2NY0B 4KHXH 1NJ9B 5L2JA 1HHHA 3I6GA 3JUZA 5FKPA 2UZYB 4KV5F 4QO1A 1NCDL 5T3XL 4OJFH 4EUPB 4DUVA 4X99A 2FJGA 5I1EH 4L4TB 1A14H 2WANA 4LMQE 2F8VA 1GOFA 3KPLB 3P4NB 2NX5A 4BH7A 4Z7NF 4HJJH 2CMRH 5E2VL 4YDLB 3MV8B 4XWGH 4OSUL 5JHDE 1UZ8A 3FONA 4N8CL 3OJDA 4M5ZL 1B3JA 1PKQB 2IANA 2EDDA 1A3QA 1CS6A 1ED3A 4OLWH 4OB5H 1V3JA 5IMKB 4G43B 4JFDA 2I07A 2AAVA 4Z7WF 3TIDA 1PFCA 3MLVH 1JK8B 1U8QB 3ARVA 1ONQB 4B7LA 2H2SC 1BD2D 4KPHH 1ZVHA 1YMMA 3PDDA 4KROB 1B4JH 2OM5A 4XXCA 4Y88A 1CXIA 1I75A 2JJSA 3AGVA 1C16B 4JRXD 5I8EA 1FFPB 3SHSA 4JN2B 4NZRH 4WWKC 2BNRA 2COQA 1UCBH 1UXWB 4S1RH 2ENSA 4XVTH 1FGVH 4FQIH 2YD3A 3GSUA 4NZTL 3SJVE 2Y06L 5M94B 1BIIA 3LQZB 2R2BA 1KBGH 2FHBA 1QD0A 4FXKB 1A02N 3D85A 1IGCH 4WV1A 3QEQB 2W65B 4Y5VB 1U8LA 1MRFH 5EPMA 4ZFGH 4NKIL 2P5WB 2VDRL 2EYTA 3DMMB 3OKDB 5J12C 1ZVYA 4YO0B 4CADA 4ELMF 2VLJE 3GSXA 1WF5A 5D2NE 3D0LB 1PEZA 3UAJD 4CMMA 2IAMD 4M02A 4PTUA 4HWZA 2R1XA 35C8L 1KEGH 1V7NL 4KDWA 1IT9L 1NCTA 2CUIA 2VAAA 3RZWA 1JHKH 2YPVL 4XBEH 3NFSH 5B22A 2X4QB 4LSPH 5IMOA 4RFNB 4RAUA 1HH6B 1KTRL 4P2RB 4XMKH 4P9MH 1QYGL 1FJ1B 5D6CA 1JI2A 2XZAH 5I17B 4ETQA 4QHLB 2BVPB 5I19H 3DROA 1CL7I 1N0LA 4FQLL 1A7PL 1J1PH 1RZ7L 4WDIB 3SE9L 5IBLC 4LIQL 3VG0L 2VN7A 1CLZH 2XTJB 4GT7A 3O45B 2EXWD 1QO3B 4DEPC 5MENA 2DQGL 4CVUA 2Q86A 3U79A 3RI5K 1YPZB 4D9QE 3TO4B 4JRYA 1CD8A 4EI6A 2D4FA 1S7TA 3BIKA 3BSZL 2G5BB 4PG2A 2HT3D 5JA9A 1S9YB 2A9MH 2HLAB 3PWNB 3RWIB 5JOPD 1I7ZA 3S35H 1IAMA 4K8RL 4K7PH 1FFRA 4RMSA 1YZZA 4BZ2H 1XH3B 3BVNA 4JFFD 1E6OH 1FNSL 1TXKA 4QOKA 4LSQH 5JMRA 1ZKAA 2CDFB 1NMCC 1YNKH 1L6XA 2CRMA 4F7CB 1EEZB 1AY1L 4M6NH 3JWNC 5DUPL 5HD8D 2F54E 5K9JL 5JPMA 1H8NA 4O9HH 5J6HA 1SYSA 4FQ2L 1IC1A 5DHYB 5ACMA 4MLSA 1NAMB 4ISVA 4Q6IB 1FL6B 1H3GA 1W72A 1YY9D 4JR9L 1OAYL 5EU6B 1BVLA 2XKNB 2Z35B 3LQAH 3EIFA 4QHUB 4LFHG 3IFLL 1IGTA 2KQMA 1Q8MA 1SEQH 1G9ML 3KPQA 1HEZB 3P11L 4OLVL 2Q8BH 4ODVH 1A9EA 3VWKD 3TC9A 2ICWI 2RJMA 3LB6C 4G80A 3ES6B 4KZEL 3P40A 3PGCB 1Z9SA 4L3CA 3B9KD 4LLDB 3RWDA 3NCYS 4CVZA 3P73B 1GPOL 1NFDE 3ZE1F 4LNRB 4AEFA 4R7NB 4KU1A 2B1HL 3WEXA 3H9HB 1G6RA 3BGAA 4O51B 2H26A 1DFBL 1I7RB 2MQCA 3MRCA 2UUDK 3KXFE 3PWVA 4ZNEA 3ZKND 3BDYL 4P2CG 4MA3A 3GSVA 4U31A 1JNNH 4MAYA 4WHTB 1FRGL 2GUOB 1AP2A 1N5AB 3NH7H 4PGJA 5D7SH 1YN7B 1PSKH 2XN9E 5L2KD 4I8DA 2X9XA 5E7BA 4FS0A 1INQA 4I3RL 4H26B 4MJ4A 4JHWL 4M1DL 4K3GA 4JFED 1UB5A 4O4YL 5FYKL 4X8JA 3EYSL 3OJMB 3IDMA 1TTGA 3MJ7A 1B4RA 2PTTB 3OKNA 4UAOC 3RVWC 4P2QA 1MCRA 4ZUWA 5T1DH 3TBTA 3ZLQC 5D8JH 4I9WE 4FABL 1AFVL 4G6MH 2QADD 1FZKA 1QUNA 1CICD 2DB8A 3P77B 4Z7VF 3SDXE 4C57C 1CDBA 2APBA 2DBLH 4G8EA 3LKRB 4FHBD 4NM4L 1LO3L 4XPBL 5EU7C 5KTEL 3HZVB 2JELH 1ODAA 4GXUN 4C83A 1MLCB 2EZ0D 2FLRT 4RGND 3MXVL 5DQ9B 2J6EH 3QPXH 2NY2D 2XZCL 2VNCA 5H35A 3RPKA 2BC4B 1OL0A 2Z0BA 3D39E 4Y19D 4EJ1C 1F58L 2NZ9C 1UEMA 1T7XA 3QQ9C 2YXFA 5I16B 5A3IC 1CXHA 4OCXH 4X98A 1QOKA 4ZOEA 4PRHB 2RFXB 3U4BL 3VMPA 5MHSE 4ZS6D 4XNXL 2HTKC 2Z4QB 4KKBD 4PIRF 5F7EH 4JCLA 5GSRA 4X0KA 5H2BB 5IMMA 1T0NA 1YECL 5BW7C 1WTLA 1H3PL 3H3PH 3KPSE 4OZHE 4P46B 2AV1A 5DR5L 1F3DJ 3F7YB 3QA3A 4IMKA 1YEEL 4U6YB 3RNQA 2W9EH 4H0GA 3BPOC 5ERWA 1BFVL 4G7YL 4G6KL 5JW4Q 1NCWH 1JPGA 4Y5XA 5LGJA 4YLQT 1ZHKB 1RZ8B 1MY5A 1A7QH 2OXHA 3VD3A 1MCPH 3UTTB 3MRKA 2PNDA 2H6PA 4LHUA 5L88H 3NA4A 2IJ0C 3HNTH 2QQKL 5TDNA 4TULL 5ICZA 4YHNB 2WIIA 1J05A 1U8KB 5GGSY 1J1XL 2GSGB 1FV1A 3VW3H 2X4OA 1TVBB 1LGVA 1JHLL 1X5LA 2I26N 3GO1H 3U4AA 5I1CL 5CGMA 3PL6B 2EKSA 2DQEH 5C92A 2YR3A 3SGJC 2BSTB 2ESVA 4OI7A 4HWBA 4BELD 3MV9E 4ETYA 1DQTA 3QXTA 4G8IA 2DQCH 2DLEA 3IDXL 1FVDA 1RD6A 2XPGA 2J8UF 3SDYL 4JJ5B 1FAIH 1FCCA 3QPQC 3SDCC 1O5DT 1XGUA 4CU7A 1VGKA 4FQQA 1DQLH 1J1OH 2R0ZL 1FYTA 5DRWB 4AIXA 3THMH 1KGCD 3ZKXB 2G75A 1IAIM 5JW5B 4AK1A 3DSNA 4UQ3B 3O2WL 3HE7B 3OAUL 4KK5C 4X6FB 3Q6FB 5FYLD 5IJKC 3D1MC 3S4SA 4S0TD 4Z95L 4DGYH 1A3LL 5KSAA 2VQ1B 5E8EA 5IB3A 1AR2A 2X6MA 4OD2A 3HI6H 2VH5L 5HXMA 2CRIA 2HTLD 5EBMB 3PHQA 1U8HA 1BZ9B 4J8RA 4YH6A 4DJMA 5HGAB 4LPXA 4LBEB 5KW9H 4I0PB 4R2GB 2VR9A 4OZIA 2HH0L 4KK9C 1JL8A 2ZCLL 1VADA 4R97C 5GRUL 1F3JB 4CW1A 2V2XA 2E6JA 5INCA 1MCIA 1GZPA 4OTXL 5E6IB 1S7QB 4WUUB 5E0QA 2R69L 3MLTB 4PJHA 2V5SA 4Q9CA 1U8JB 4QF1A 3NA9L 1A0QL 4MD0A 4YFEA 4R4BA 4W4OC 4HPOH 1YMHB 4NC0B 1AD0B 4QTIL 4ERSL 4K55A 4MDJA 1U6AL 2EYSB 4AEIL 5IW1B 1XGTB 1A3RL 1WEJL 2VDML 3VXSB 3LS4H 5BV7L 4AEHL 2L0DA 2FJFA 4M1GL 1QSFE 1CGXA 3BX7C 2MMXA 1WLHA 3CC5A 1MOEA 1QKZH 2DI9A 2PO6B 3VGHA 3P9LA 3ARGD 5F8RC 4M03A 2X4UB 1N3NA 4M8QB 2FD6L 1S9KC 4DVBA 3P4OB 5DVMA 5KAQF 5FCSH 2DTML 5CEYA 2DRUA 3TO2A 3SCMB 4TUKH 4U1LB 2Z31B 2WBJA 5LQBH 4HK0A 3LKOB 5ICXA 4EIGB 2OJZH 1RUMH 3CNKA 3HB3C 3OGCB 3ULVE 4BSWA 5GRVK 3OQ3B 5IR1A 3HA0A 5DVLA 3T2PA 2VXUL 4N0UB 3ULSA 1JGDA 1MIEL 4PLOB 1RUKL 1HILA 1KLGB 1WZKA 3BT2H 3P0GB 3TYGL 2QQLH 1NGPL 3VRIA 3WFDL 4R4ND 5D1XA 4O02H 4YXLH 3RKDD 4O2CA 5FDWA 1FIGL 1I7UA 4RX4A 1GGCL 1GCFA 4XZUA 4GMSL 4P57A 4YC2C 3LKQA 4KJQD 5IB4A 1UKSA 5HHOD 3GJFB 4YPJA 1FNGB 3SJVD 1JHTB 4OUUB 4OZFG 2D3VA 3IF1A 3BEWB 4GW1B 1MCWM 3DGGB 3NIGF 1HOCA 5CIPH 3QEUA 4K3JL 5C0JA 3OXRA 1RIVL 5B8CB 2CLVB 3R1GH 1E4WH 1JUFB 3OB0H 1OQXA 1MPAL 4KKCD 3SDDA 4OZGB 3NCJL 4G42B 4IRZL 4XCFH 2VLJD 4W81A 4B50A 2KH2B 5K59E 4PJDA 3TN0D 5E8NA 1D5IL 2PR4H 4EN3C 2UVEA 3EFFA 1K2DB 3SPVB 4EDXA 2AJZA 3I50L 3I3BA 3PWLA 2JJUA 3V0WH 1IM9B 2NY3B 3HG1B 5TFSL 3QDMA 2ZG3A 4E9LA 3OF6A 1VCAA 2XZQL 4R96B 4WJ5A 4HJGA 1CGYA 1U0QA 1I1FA 3NGBC 4RAVA 1UZ6E 4L8SA 3QQ3B 3TIEB 1QLEL 3I2CH 4UIMA 5EZLA 3B6SA 4LGSB 3HMWL 5TF1H 2HVKB 1LE9B 1UB6B 3LY6A 4UT9L 1M05B 5DUMH 4D9QD 3GSQB 5SWZE 1YA5A 1R24A 5EU4B 1TJIH 1CR9L 4CU6A 1I3GL 4Y1AE 1T22A 2ADJA 1XR8A 4TVPL 5A2JH 4EEEA 1WITA 1Q9KB 4RWYL 3U36B 4PP1D 1DANT 1S3KH 2WMPA 4JPIB 3ARBB 1WC7A 5LBSL 1BM3H 5ITBH 2XRAH 3VXUB 2BOCB 2R1YB 2VUOA 4WY7H 5A2FA 2F54D 2EDJA 2JB6B 4M43H 4LEXH 2B8OT 3SKNB 1TLKA 5DEZA 1LK3H 1TQCC 5FB8A 3MLSL 1Z5LA 4HKXB 3OJVC 3HR5B 4F8QA 3LIZH 3TBYB 4J3TA 1XIWB 2IFGA 3T0EC 4YFLF 4OGYH 4GAGL 5KJRH 4ZAKA 1ULVA 4GAFB 2DQJL 4QRTB 3D48R 4HFWB 3C5ZD 4APQD 2QR0B 1ZGLB 1TZGH 2AJSL 2M8XA 4ZUTA 1QPXA 1GOGA 3QJHB 3KNBA 1S8DB 1EK3A 3SN6N 3BZEA 2LTQB 3CPLA 3E6HB 2OX5A 3BXNB 3K7UA 1PY4A 2NY6C 4ZFOB 4JKLA 2YBRA 4FG6D 1VB9A 2P5EA 3MRFA 3EOAB 3RHWK 3I6KA 3BIAX 1O0VA 1F6AB 2W0FA 1EUUA 3KXFD 4HCRH 5GS0C 1TJHH 1KNOA 4ZDHB 3X11A 5I6XB 3V95A 3LH2L 4JFYA 1KCUL 3WKML 1UCTA 25C8L 2EEDA 3JWDH 3RWJB 5BO1H 3PE9A 5IQ7L 5T3ZL 3BZ4A 3V4PH 1RJZB 3TVMB 4F58L 2P24B 2SEBA 1A6AA 4K3DL 2XN9D 3WSQH 4KHTH 3FL7A 4FQCH 4GBXA 3OHXA 2JE8A 4A2LA 3QO0A 2UV3A 2X2YA 3H7BB 4OLUL 4KDTC 1MHCA 3ESUF 4LCCA 3CAFA 1U2HA 4Z78A 3DYPA 4JKKA 1N8ZB 2FDBP 3VFOB 5J1TC 3MJ8A 3CFJB 1VKXA 2PYEE 4L29B 2G60H 4JHAL 1CFQA 4I9WD 4GRLA 5J11B 4FQHA 1VFOA 5C9JB 1XGYH 2AEQL 4GSDH 5GHWH 3L5WA 3ULUH 1UH3A 1WUNT 1V05A 3RIFK 3UPAA 1GGBH 2IADA 4GRWH 4P0DA 4F15C 5DDHB 5FM4A 4Q0XL 2A6JA 4OQTA 4UBDC 3VXPA 3DARA 5F71A 3D39D 4PY7B 3HC4H 2MQ3A 5EUKA 1P6FA 1OP9A 1RAMA 1GH7A 2P8LA 1NFKA 2XG5A 5FEBA 5LVEA 5K9KA 3KWWB 2VXQH 4XPFH 1LDSA 1SEBA 1PX4A 1HZHH 4NT6B 1T80A 2XQYG 4QHMA 1QHPA 4AMKL 1A7NL 3WNMA 4PJ5E 3NACL 2IBZY 5ECJE 2ICWA 1MHHB 5ISZD 3DIFA 3VFVA 1DANU 4N8VB 4G3YL 1OT2A 2BVQA 1P7QD 2R2CA 4NRXB 1X7QB 4Z5RA 1JZ3A 1E4XH 1VFUA 5ICYB 4NIKB 1GGYA 4KK6C 4WO4D 1W72L 1CYGA 3LDBB 1JPFA 1BQHG 5DXWA 3TNMA 1ORSB 4FTVD 1HXMA 4M3KB 5C0FB 3BMVA 4YHOL 3VD4A 4TQEL 1GJIA 1W0VA 3Q3GA 4WWKB 4OGAC 5HDOA 5FCUH 5AD0B 4ODSH 4U1HB 4Y2DD 1L7IH 1S5IL 1Z2KA 1RHHA 5D5MB 4EUPG 3QYCA 3OWEA 4YNYB 3BH9B 2FCBA 3TNNB 3MV9D 2G9HA 4OV5A 3QAZB 2WLYA 3EDJA 2ADGB 1A21A 2Y5EA 5J12B 3BP7A 4X7TB 3N06B 3BKYL 2ADFH 5LWYH 4XP9H 2HMIC 1G6RL 1OGAA 3MODL 1C12A 3S88L 3C09C 4L8CA 4POZD 2HKHH 15C8L 2CLRB 5DS8A 5KAQG 5KVMC 3DXAA 4P2OD 2LVEA 2K7QA 3ZE2F 1KXTB 3GSRA 1P4BL 4NQCB 5CD5D 1XZ0A 3G5ZB 2RCSH 3SGDI 4FXGA 5EFIB 1HH9B 3RRQA 3CU7A 2UZIH 4PLKD 3CZFB 3WJLC 5IHBA 3E8UL 4ODBD 4HX1B 2QTEA 2DI7A 1HHGA 4QXGH 3AU1A 3TPKA 4P5TB 4LPVA 1PQZA 1WICA 1U3YA 2XT1B 2KDGA 1JZ6A 4M62H 4FQXD 4KV5E 1O7SA 2L7UA 1OW0C 3DUUB 4NNPH 5D2LB 3GBNL 1Q72L 4DEPB 5IIEA 1KJ3L 4KUCD 4Z7NE 1FE8H 2I9TA 4E41A 1EMTH 2I9LA 1U3HB 5DFVC 3MGTA 4FQPA 3V5KB 1BAFH 3S3JA 4K8RC 1SJEB 2W0PA 4KI1A 1P7KB 4CDHA 1OB1A 4EVNA 3RA7H 5ETUA 4PS4H 1ZHNB 1CT8B 4PJFF 4C59B 1MCCA 5CMAB 4HUXA 4NDMA 4D9LL 4YX2H 2A38A 2F8XC 1JFQH 3FQUA 5EO0A 1NMCB 2IF7A 4OZ4A 4Z7WE 1G7HB 2VKXA 2ORBH 2E6QA 3O4LB 4RRPA 1RZKH 4QRPA 4HAFA 3TBSA 5DQDH 4ZSOB 3Q6GL 3WJJC 4K7PY 5EZJA 3ZMRA 1AD9B 1JF1B 1KJ2H 1QSFD 4U1GC 3ZZ1A 3WDHA 1KIPB 3RZCB 3QIUD 3B8YA 4B53A 2DKUA 4E0RB 1ZA3A 1I1CA 3EO9L 5J13C 2YEZA 5DRZA 4ZFZA 1YJDH 5D7JD 2YK1L 3O8XC 2MCG1 5DMKA 4PJXA 3KLHD 1DBAL 3C2SA 4YDVA 3PJSA 3X13A 1RHFA 1NCAH 1RK0B 1FSKC 1OPGH 1SVZA 2ZNXA 1QNZL 2HFFA 2R1WA 3TZVA 3KR3L 3EFDH 3KPRE 3FFCB 1MREL 1VHPA 3ULVD 5C07E 2OL3B 2R15A 4U1JB 4JKMA 3FQNA 3LEYL 5E6YA 2VXSH 3DBXA 4NKDA 3QUML 2RB8A 4R3SA 5B3JF 3I3DA 3F58H 3KAAA 1J0ZA 4HXBL 3JTSB 5IVXA 1IGFL 3O4OC 4TNWF 3SOBH 1F5WA 3G6JB 3U0PA 2ADIB 3EO0A 1JPSL 4HWBL 1S9VB 2DQHL 1SMAA 1T1YA 2B4CC 3TBVB 4MNQB 5FXCH 1ZWIA 4Y7MA 1CDGA 1DQDH 1EO7A 1DE4A 1UKQA 3W2DH 3I6GB 5FKPB 3VXRA 3MJ9A 3MLWH 1MFDH 3QHFL 2D03H 4LSDA 5GJSL 4RMWA 1RZGB 3D2UA 4V1DA 3FT3B 4JG1H 3V6OA 4UTAL 3GKWL 1P9MC 4XI5C 2NX5B 4BH7B 5HDBF 2ATKA 3C6SA 1NGYA 2VAJA 1A5FH 3RGHA 4JAMA 1FL5A 2AXFA 2VSCA 3VWJC 1UZ8B 1WT5A 3FONB 5E2UH 3OJDB 5DO2D 2J1KA 3OXSA 1A9BA 2IANB 4HBCL 4D0CB 3P0VH 1F45A 2VXVH 3F5WA 1WFNA 2LVCA 4JFDB 3A6CH 4N5ED 1DBML 5IVOA 2OI9C 4OD3L 4F7EA 2GSIA 4KUZL 3G08B 3GB7B 4BFGA 1YMMB 2BNQA 5FA3B 1OARL 3LV3B 2W0LA 4XMLL 2PUQT 3L6FA 4KKAD 1QQDB 1YEGH 5KS9A 4NWUL 1H5BA 4OCYL 1AGFA 5TJWK 5HHQA 2BNRB 2B2XL 2NXZC 1A6VL 3STZA 5BS0A 3GSUB 3IKCA 5JNYA 2XWTA 3FO2A 5SWZD 1HINL 3V52L 4DVRH 5MEPB 3D85B 4Y1AD 4WV1B 1K5NA 2J5LB 4ZMAT 2BJML 3BE1L 5T1KD 3RWCA 1WWBX 4BH8B 1U8LB 2P8PA 1EAPA 5EPMB 3LHPL 3LS5L 1MFNA 5DD6A 2EYTB 4JG0L 5FO7A 5BOPA 3MLXH 5DEFB 3RGVD 4CADB 2ZUVA 3GSXB 5DJ8B 3HCVA 2WUBH 1JGVH 1QFUL 4PTUB 4XP5H 5AZEH 4HWZB 3LEVH 4J3SA 2R1XB 4AIZB 4HGWB 5HI5C 2AEPH 2V7HA 4P9HL 2C26A 5GISL 2VAAB 4OBRA 5FAAA 3H3KA 4WIQA 4PJ7A 2BSRA 3PV6B 4TSCL 5FYLL 3BDBA 1H15A 4PB9L 4XB7A 5D6CB 1D5MA 4LVHC 4ETQB 1DJSA 4JVPA 2VXTH 3DROB 2GAZB 2XFXA 2AJVL 2OBGA 4LCWE 5LGHL 4HWUA 43CAA 4QT5B 4HUVA 1CLYH 4WFED 4XCEB 5MERB 5HPMA 1T03H 2A6KA 2Q86B 2JIXA 3VXNA 5DWUH 4C56D 3FHAA 3L5IA 3PP3H 4EI6B 1S7TB 3BIKB 4PJIA 1OSPH 5F9OH 1TJGL 1B90A 1G9EA 1JGUH 2X70A 3KPTA 1ZLVK 1I7ZB 1MUJA 4Z7VE 4PJGA 3BVNB 3PIQA 1NBVH 4QOKB 1C1EL 3G6DL 3SKJH 3W11D 3MRHB 1XF2B 2R0LH 3CDYA 1EBAA 3B5TA 3QUYC 2OQJA 2QHRL 5JPMB 4GMTL 4LFHD 5HHMD 4JANB 4TTGA 5J6HB 4D8PB 3KYNB 1Q0YL 3O2DL 4YE4L 1ORQA 2I60L 3BFOA 4ISVB 3VMOA 4X6DA 4HH9A 5ESVA 1N5YL 1AO7E 3GMPB 4I18A 1KC5L 4LLAA 1KJ2B 4JE4B 3U30C 1JF5A 1IGTB 5GS0H 1TNNA 3KPQB 4PB0H 5D1ZC 5I1LB 3UXFA 4KVCH 4G6JL 1A9EB 2HLFC 4GRWE 3MO1B 4XAWH 1LP9A 4XHJC 3FT4B 4L3CB 2AABL 3LSOB 3RWDB 4UZGA 5HYJA 4MJIE 1JRHI 5GGRA 5D72L 4CVZB 1TCRB 5I18H 4M93C 4KY1H 3PXHA 1GXEA 1QSED 3K4DA 2X1PA 2J88H 1Q94B 4LQFL 3C2AH 2DTSA 4NZUH 4KC3B 2IH1A 5IROA 4Y8AA 2H26B 4IOIA 3MRCB 3PWVB 5F96H 5DJZA 2Y4SA 4MA3B 5B39A 3GSVB 1ZGLM 3UJIH 2XNAB 4MAYB 4F7PB 3BOVA 3IXAB 2YD9A 4GH7B 4YBQD 4LSTL 1R0AH 4CRPA 3U7WH 5CZVH 5KSVA 3MLUH 2ZG1A 1I85C 3WN5A 4QTHB 2FEEL 2AS5M 4XVJH 2E7LA 5FUCC 1MQKH 3FB5B 4Q2ZA 1N4XH 2Y36L 4PJ5D 1INQB 2R4SH 4FOMA 4PUBH 4WCYH 1ZT7A 2K7PA 4FMFA 1UB5B 2J8UE 4X8JB 4JPKL 3IDMB 3G5YB 3BUYA 3MJ7B 5C2BH 2ZCHH 4NN6C 5A16B 4P2QB 3TBTB 2DL2A 4PJCA 4KQ4H 1CVRA 5BZWB 1IJ9A 4ZUSA 1NBZA 2P7TB 1CCZA 1S7SA 32C2B 3L3JB 2VDLH 5F70A 5DZLA 4U6VH 4JRXA 5BMFH 5C08D 3LRSB 3BEVB 3D25B 4ODHH 4IOFD 3OAZH 4QRRE 4QXWA 4Y4HD 3V4UH 3E3QC 1KN4L 4JFZL 3IT8D 2D7MA 2XWBB 3MRBA 4X98B 4R0LC 3VFWA 2JF1A 3GSNA 3VJ6A 4N0YL 4HXAL 3BMWA 5C0AE 3GHEL 4GQPH 1ERNA 5GSRB 4NFBA 4X0KB 3CDGA 4JDVA 3CFBA 2IAMA 1CWVA 4G9FE 5MEQA 3VXQB 1EA9C 1A1MA 4LVOC 4NQSB 4PJAB 3QULB 3LD8C 5ERWB 3GUTA 2NR6C 1VPOL 2GK0A 5E9DA 4Y5XB 5LGJB 3W0WE 4TTDD 5GRVL 2FB4L 5KVDL 4KI5C 4X6CF 1E4KC 1WQVT 2H6PB 4LHUB 5DD0L 3NGBB 3HPJB 5CUSL 4ZTPH 1N6QL 3GMRB 3N1MC 4OFYD 3UTOA 5TDNB 5C0CA 3HFML 3FQTA 3L3KA 2FHFA 3BPCA 1EVTC 4A2MA 3QUXC 5I30L 2P49B 1FV1B 4MVBD 1M71A 35C8H 3HI5L 1AGBA 1V7NH 2X4OB 3KS0H 3HNVL 4F7TA 1EHXA 1OD7A 5F1IA 2YPVH 1GHFH 2PW1A 3W39A 2ESVB 4OT1L 2MOVA 1KIRA 4DZ8B 2BFVH 2NXYC 3QIBC 1ZXQA 3OPZH 2XPGB 5GIRB 4MDIA 1LO5A 5I1HH 4HUKB 1ZT1A 5C0IB 1ZLSH 3PF2A 1XGUB 2BX5A 4I77L 4S1QH 1IARB 1ETZB 2E5EA 3ARFB 4HMDA 4FQQB 2C3WA 1FYTB 2JCCF 5DHVA 4C54A 1R5WA 3S34H 3MRPA 5AUMA 5BRZD 5FKAA 3TP4A 5JXAL 4GRMA 4LVEA 1TQCB 3ILQD 3VXOA 4NFDA 2LU4A 4FMKA 3GSOB 4QYOB 5C09A 3RBSA 4ZNCD 2YUVA 1CIDA 3S4SB 2FGZA 4J23A 3P9MA 3UBXI 4NUJA 1RIHH 5E8EB 2BDNL 4X6EA 5F6IC 3GMOB 2NY5H 1N59B 4GKZB 4KRPC 3CFCH 3NIGE 4M7LT 2Y7QA 1U8HB 3KLDA 2XA8L 4GG8B 3S3PA 3IDYC 5GRJL 4YHPA 4LQ1A 2OZ4A 2DMCA 4LP4A 4ZPVA 3MUZ1 5CSZA 2QSVA 5K9JH 2EC9T 3O11B 3V7AE 2XTLA 1VADB 4MA8L 2KKQA 1JWSA 4CW1B 2VDOH 4MD5A 5C07D 2BVOA 1GZPB 4ZXBA 3EHBD 4PJHB 2ZUTA 4GXVH 4YBLB 5HHNB 3QFJD 2AGJL 3HUJF 5DK2B 2DQFA 4KTDH 4MD0B 3ARDA 4R4BB 1C5CL 2VLKE 2VRAA 4KMQA 4IOSD 4Z76B 2DQDH 1OT1A 1YYLL 1AR1C 1FZOA 4PRPA 4KZDH 1CL7H 2EDLA 4MDJB 3P11H 3MROA 1QVOA 4PY8J 2X4RA 4KZEH 4XPAL 1MLBA 3P9WB 4UB0L 4QHKI 1T7YA 3BRDA 2DYPA 3SGKC 1Q9LA 1B88A 2FJFB 3RUGF 5EBWA 2F53D 3ZT6A 3QB7C 2H2SD 3HE6D 4Y5YA 1SQ2N 4HIIB 1L6ZA 3CLFH 4KGLA 2EIBA 4PJ9A 1OWRM 1DVFC 3P9LB 3BESR 3QUZD 1HIML 4M61A 2F74B 1P1ZB 4GKSA 3EOTL 5IV2A 4JPWL 4ONGH 2CDEA 1N3NB 4LCYA 3B9EA 3OKKB 3UJTL 4DVBB 4AY0A 5CEYB 3TO2B 4H20L 5CP7A 2WBJB 2VDQH 3FCTB 2X44D 4PPTA 1G7LA 1HQRB 1ACZA 4I48A 2B4CH 5DF0A 5ICXB 1VFBB 1WSST 1UXSB 4BSWB 1F97A 1C8PA 5IR1B 1WISA 4F15B 2GJ6B 4PJBA 5L8LB 3ULSB 1JGDB 1NCCH 3MOBL 4KK8D 3AMLA 1YNLL 2FEDD 3K2UH 3JZ7A 2GCYA 4JLRB 1S7RA 1S7WA 4O2CB 5FDWB 1H0DA 4TUOA 2CGRL 5IVZA 4NWTL 4XZUB 4P57B 3LKQB 5IB4B 1WVZA 2BOBB 5EB9A 2AJ3A 3D3VB 4WU5A 2Q1EA 3IF1B 3SBWC 5CILL 4NM4H 4IS6B 5SWQB 1HOCB 3O9WA 3T65A 3QEUB 5HGDA 2IPKA 5IBUB 5C0JB 3OXRB 4GXUM 4HUNB 1IE5A 4E42A 5C71A 4S2SB 1GIGH 2IQ9H 1YC8A 3RTQD 1JGEA 1AQKH 4NQED 1CFBA 1W2KT 3JV0A 1UENA 3SDDB 2D0FA 3GI9H 5FUOH 1OCWL 5F1OB 5ABDE 1F58H 5EZIH 4PJDB 4YXHL 3UAJC 3MRGA 1HQ4A 4U3CA 5IEKA 2QLVB 3ISWA 3WLBB 5IFAH 3VFMB 3MBEA 1FVCA 1G9NL 2Y72A 3AY4C 4EDXB 4F33A 2HFEA 2AJZB 5TQ2L 4H8WL 4S0SD 4EI5D 1PVHA 3KVQA 1KT2A 5DR5H 3F7QA 2ZPKH 5FIEA 1S9WA 3WDJA 3QDMB 2W0KA 1V7ML 4Y16A 5CCKL 3WIIH 3E2HB 1A2YA 4O2FA 4HJGB 2IG2H 3OBAA 1I1FB 4RAVB 3FQRB 4L8SB 4M5YL 1IGJA 4LCWD 2YZ8A 4UIMB 5D70H 3ARYA 2P44B 2EC9U 3B6SB 4WRLA 2EXWC 3JTTA 4QGYA 2V6HA 3O3DA 2E9WA 1H8OA 1YEKH 4X7CC 4LCUB 5GJTH 1R24B 1O7VA 5FUZH 3T0EE 4WGVB 3LEXB 2HT3C 1MFEH 1T22B 3K3QA 1U92B 1J1XH 4YGAB 2H3NA 1DLFH 2ADJB 4OGXH 4N8VG 4WI4A 1XR8B 1KTLA 3U9PL 4NNYA 3OZ9L 2Q3AA 1JHLH 1MCHA 4WI5A 4UUJA 4NYLB 5GRYA 4K71C 3UDWA 3L5XH 1WC7B 1VDGA 4KRMB 4ORGA 4U6XB 1HKFA 1REIA 1KB5L 2DOCA 4TUJB 5HD8C 4DKEH 3IDXH 1ADQL 1NC4A 3MJ9L 2YS4A 3O6LH 4F9LA 5K9OB 1ZLUH 2YD5A 4LLQA 1AO7D 1IC4L 3SY0A 5DRXA 1YY9C 5JIKA 3CFDA 2CIKA 4LCIL 1I4FB 4ZAKB 5FM5O 2CR6A 3O2WH 3OAUH 3VE0A 5HHXH 4HUUA 1LVEA 2XWJA 4L4VE 5DEGB 3HRZA 1R3IL 5EBLA 3EAKA 4ZUTB 2F5AH 3VWKC 2A1WL 3KNBB 2CUHA 3IXTA 4A6YL 1K8DA 4ZO7A 3BZEB 2D31A 3CPLB 4NQDE 1QFOA 3B9KC 4DKFL 3C60D 1I1YA 3DX9A 4JM2C 3H42H 4X7SL 5CZXC 1WBZB 3P4LA 1L0YA 2YBRB 2ZCLH 3Q5YA 4BUHA 3RVWD 1IFHL 2P5EB 3MRFB 1DR9A 3I6KB 4OLXL 4H0IA 2W0FB 2PYFA 1ND0A 4U1GB 4LSVH 4FQJH 1FORL 2E27L 3X11B 2BERA 4JFYB 2ENYA 2CKBH 4PRAA 3BZ4B 2YN3A 5GGVH 5AWNH 3O8XB 1I1AD 1A6AB 1I9JL 4RDQF 5GGSA 4ERSH 5JHDA 4GBXB 3OHXB 1NGZA 3IVKA 1T2JA 3DVNA 3QO0B 2WINB 5T3XE 3EO1B 5JUEH 3O6ML 1JZ8A 2W9DH 1TMCB 2VISA 1G7MB 5HJ3A 4Z78B 3GI8H 1FBIL 1QBBA 4F37F 3EW3B 3VFPA 3GNML 2AVGA 5CEZH 2IPUG 3MJ8B 1VKXB 4QY8A 5JDJA 4JQXA 4GRLB 1ZV5A 4YDKH 1DN2A 2HJFA 1IAKA 1UH4A 1CICC 5TH2A 1OLLA 1RV6X 3MNZA 1FZMA 3L5WB 1NSNL 2X1OA 1IMHC 1KG0A 2Y07H 5SX4I 2DTMH 2I25N 5D7IE 1ZLWK 4QRRD 1UFUA 4JM2F 2NY2C 3CDCA 3V9FA 2IH3B 3VXPB 1A1OB 3U48A 4NHUA 5SWSE 3MV7B 5EUKB 5J8OA 1A6TA 5T5FL 3HI1B 3HMXH 2VXUH 1DSFL 4UINH 5JO5A 1MIEH 1VFMA 3PUCA 1YC7A 4DZBB 2YSSA 4D0DA 4AM0B 3UPRA 3W9DA 4ZS6C 4CDGC 3O81A 2Q8AL 1SEBB 2VLJA 1FCGA 5I71B 4MZ2A 1OD9A 4WTWA 1FIGH 1KCRL 4IDLA 2DS4A 4G9FD 4GMSH 4P23D 3REWA 5E1AA 4J3XA 2ICWB 4PJFE 3DIFB 5DMJB 1A7RH 5C6TH 3VFVB 2BVQB 5DJCA 2WLZA 1Y18A 1INEL 2NY0D 1NLBL 1T5XA 3RI5F 4DGVH 3SE4A 4Z5RB 2OI9B 4LDLB 3NCEB 2EDTA 3PHOB 4TSAL 1YYMH 3SDCD 3RWEA 5D1QD 2QSTA 3GFUA 4OIIL 3V0VB 2R2EA 5I1IH 1JPFB 2DDQH 2V5MA 5IMLA 2KZWA 1HXMB 4F57H 5JXEA 1EGJA 5F89B 4ODUA 3BRFA 1W0VB 4YIQA 4R6UA 4BFIB 3Q3GB 2F19H 4WNQB 4XPTL 3MV8D 4UV7L 2ZUSA 2NXZB 1BGXL 3QBTB 4YR6A 5FO8A 3B9AA 4YAQA 4XPGL 2A74B 1AC0A 2DWDB 3X14A 5E56A 1RHHB 4WUKH 4W70A 3TPUA 4MXQD 5F7MC 2G9HB 4LIQE 1A4JB 1MCBA 4OV5B 3BGFB 3ZHKA 5JHLH 2BVYA 4KK9D 3BP7B 2DIAA 1J87A 1JI1A 1QLEH 2ZUYA 3C6LA 1EJOL 5I73B 2C3XA 1OGAB 3K8KA 1DQJB 2GTWA 4PYHA 1A6WH 4NPYA 3DXAB 1UACL 3GSRB 2FWOB 2J8OA 4P3CL 1SYVB 3DSFH 4KTEL 1YY8B 4FXGB 2XKUA 4AG4L 1I3GH 4OFDA 1L7TH 4M9OA 1FLRH 3QEQD 4F7MA 3CMOH 4YHIA 1INDH 3OSKA 4OZIF 1NLDL 5E70A 3ARED 4NQTA 4EDWL 2HTLC 3TCXA 3C5ZA 1VESA 5LBSH 4JY5H 1IRAY 3DMMD 4RGMB 4FFZL 3L3DB 1NJ9A 1R3KA 3S37H 1VSCA 2BY3A 4M7ZC 5ITFB 4WFFD 4PJHF 5IIEB 4LARL 5HDBE 2I9TB 4YUEL 4E41B 4L4TA 5KVFL 3GRWA 3WFBL 2F5BL 3KPLA 3C08H 1NFDA 2JTDA 1T04A 4X9HA 4JO4L 1GGTA 1IL1B 1OB1B 3BIBX 3K0WA 4JPVH 4XNQB 5ETUB 2VLKD 1BBJA 3H6JA 1WAAE 4NDMB 3GBML 3FQUB 5EO0B 2AJSH 4OZ4B 4IRJD 4GG6B 2M26A 4LRIA 4NCC1 5IMKA 3U1SH 1P4LA 3AM8A 4ZG1A 5I0ZA 3RDTD 4QRPB 3TBSB 5L6YH 7FABH 2FATL 4Y4FD 4YQXL 4R7DA 1JTOA 2X4TB 1F4YL 1JK8A 1U8QA 1ONQA 1CU4L 4RWHA 3HNSL 5AG9A 3U83A 1WWAX 4TVSa 3D5OF 3QT2A 3N85H 4HT1L 1AIFA 5EO1A 5JIPA 2YEZB 4JN2A 5DRZB 3ARGC 3RL1B 4D3CH 1XGPA 1NFIA 2EE6A 4NZJA 5L7XL 1UXWA 3U30B