5JLZB

Crystal structure of hla-drb1*04:01 in complex with modified alpha-enolase peptide 26-40 with citrulline at the position 32
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRASSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted alpha-Enolase T Cell Epitope in Rheumatoid Arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jlzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5jlzB01
2EXWC 4RISL 5ANMB 1H3UA 1G9NH 1EERB 3KJ4C 3U79A 5I2IA 4X4MA 4KJYB 5BS0D 2HLFD 1FCCA 1UT9A 3VXTB 1NBYA 3OTTA 1NKRA 1T1XA 3KLDA 3NGBB 4PJEF 3LQAL 2VXQL 4N0FB 1FLTX 3WFBL 1ZVHA 2BCKA 5JA8B 3VE0B 3RDTC 4NNYA 4MD5B 1YNKH 4R9HA 1R3IH 1U8LA 1PG7W 1RZGA 5IMOA 3VGAB 1XF3A 2R2BB 5D2LF 1NMAH 1AP2A 1JGUH 3LN9A 3VH8A 1CFNB 4JQIH 1HXMB 2VKWA 4QOKA 4FQ2L 2YBRA 3LHPH 4FP8L 2LFGA 1BIHA 4PTTB 4FXGB 1E6OH 3FQXB 3MLTB 4OF8A 3T3PF 5DVMA 1DQJB 1L9NA 4U1KB 3R8QA 1D6VL 1IGML 2I25N 3QXTA 1SJVA 1FFNA 5IKCA 3BI9X 5D7KE 1N2RB 4G6JH 5C6PB 2PO6C 1MCPL 5GRUH 1BFSA 3L3DA 2NR6C 3TO4B 1QBLL 5KVDL 2DWEB 2WNGA 4XVSL 5C0FB 5KVEH 4H8WH 2AXHA 3W39A 5T3ZE 4JM2C 3WO4B 3SCMC 4JKPL 4LKXB 4P23D 4XBEL 2CD0A 3UJIL 3MRQA 2CO7B 5DR5L 4OBSA 4OKDA 5CFHA 2PUQT 3MXVL 1U95A 2XA8H 1I7ZB 2AQ3A 4GJTB 1KEML 1QSEA 3AUVA 3S7GA 3S96A 5T3ZL 4JFEA 4JN2A 5IBLC 4OZHA 4PJXA 3QZWG 2OS7A 3VWKC 4A2MA 3E6HA 2NY4B 1KENH 2K9UA 5JOFB 4U1IB 1T2QL 1JPGB 2AK4E 4HBCL 4JFDD 1AKJB 3MUY1 2DQJH 3ZE0E 4P5MB 3TBWB 3BP7B 5CINH 1I3RA 2PKDA 3KG5A 3LKOB 2IH1A 3FZUC 1I9JH 3RVUC 1QFHA 1ADQH 1D9KC 5I16A 4WO4B 4G7YH 5AEAA 1CU4L 2IBGA 1U2HA 1XF4B 4H8WC 4YDLC 2XRAL 1MHPL 4ISVB 4XRCA 5DWUH 5KSAC 1MLBA 1T1XB 4XPGL 4FRWA 3L5WA 5GGSY 2UYLB 1DFBL 5E94A 3MLXL 3T2NL 4J2XA 2VR4A 2VLLA 1A22B 3CVIH 5EA0L 2XPGB 2CR3A 4LDOB 5IESH 3U7AA 4NQXB 1WCBA 1I3GL 5IMOB 4J4PA 4X7CC 1JUFB 4UT6H 1HYSD 5FB8A 5F96L 2NY3B 5GZND 3ME0A 4NQDE 3RIFF 4JVUA 2UWEE 1KXQE 1X5IA 3LPWA 1KTRL 1D5MB 2IPKB 5CD3A 4HFUL 3QUZD 4K7PX 5DJDA 3TVMC 4JFXA 1R3LA 3SJVE 4ZD3L 4PGDA 4C58B 2HT4D 4IOSD 2QADB 3HG1D 2NZ9D 2R1XA 5IKCB 1IAKA 4RAUB 1WLHA 4PRBB 5FUCC 4Z7UB 2ZUQC 4Y5YB 3CDGB 2EYTA 3IU4H 4L3EA 4CVZB 1UWXH 4YBHA 5D7LD 4UILL 2NW2A 4RDQF 2VXSL 3VFVB 3WL9B 5CP7B 5DK3A 3B9KD 2YEZB 1BZ7A 3TO2B 3TP4A 3W82A 2GUOB 1G7JB 5DGRA 3QCUH 4Z95H 1DSFH 3X3GH 1BD2B 2NLJA 3S4SB 4QEGA 5MHSD 4YGVA 2IAMB 3MRLA 2LTQB 2GJ6B 3S35L 5I18H 1H5BB 2Y72A 1FGNL 1QZ1A 2C7UA 4YXHH 1J0YA 2AEPH 3S96B 4HWEH 5DSCB 3P4NA 1EVTC 3RUGA 3RWJB 1UWEH 4Y16A 5DC4B 1U8PB 2XN9A 3GSNL 3V2AR 2FHFA 4NKMB 1QSFB 1N5AA 2ESVA 4Z8FL 1S8DA 1FV1A 4JR9H 4M6NH 2PTVA 3BH8B 4N5UA 3DYPA 5TPWH 5JLZA 4XWOD 1FNHA 1T2JA 3U9UB 3KPRB 2IG2H 3PWPE 4W4NA 5AZEL 3BAEH 2O5XH 4KPHH 2G9HA 4OD2A 5GGQH 4RGOL 5JPNB 1KFAH 3G04B 3M07A 4UIKL 1QRND 2BVUA 1SJHA 1AO7E 3CCHA 4XNUL 4YXLL 3WO4C 5ICZA 2XQYK 4Y1AE 2J4WH 4P9MH 3NTCL 1CDJA 3X14B 4TVPH 1AJ7H 4GG6B 2A1WL 1JWUB 2ZZUT 3EO9L 3HE7B 2HKFH 1GHFL 3H3BC 2ZJSL 1LO4L 4L3CA 4WUUE 5DJXB 5L0QB 3UJTL 4NSKA 2AJYH 2ZG2A 5I73C 2LAAA 1MUJA 5GRYA 1WCBB 4PG2A 2PCPB 4YHOL 1SEQL 5D7IF 4NO5B 2ADGB 1N59A 3I75A 3AS1A 4PJBF 3X13A 2VTFA 3GSXB 1BVKB 5DQ9A 5KS9A 1QLFA 3EYSL 3MNZA 3MV8E 4M7KH 3RP1A 3QFJE 4AT6A 4OUUA 1OSZA 3B2UD 2WQ8A 1I1AC 4LRIC 3HZYA 1FC2D 5EULV 5I1HH 4TRPL 4WO4C 1FVCB 4EXPX 4PJCE 1OW0C 4HIHB 1CVSC 3EGSB 1F4XL 3MREB 3O3AA 3OSKA 4ACPA 3OGOE 1WBYB 4X99A 4G6FD 4JRXD 3BZ4B 1EK3A 3QQ9C 4O51B 5HDQL 5T1LB 1CT8B 3MCLH 3HS0A 2DQGH 3O3DB 2EDDA 4KJQD 4L4JA 1BFVH 1QP1A 4FQXD 2X89A 4PP2B 3HPJB 5F1OB 3AU1A 4Z78A 1NGZA 5I66A 3QT2A 3L3GA 3MRCB 5SX4H 3P4NB 4QRRE 4M62L 5D7JC 4TVSa 5IWLC 1YN6A 4BA8A 1KIPB 1S8DB 35C8H 1YMME 2PXYA 4MA1C 4AMKH 3RY6C 1AQKH 4WJ5A 3ARBD 5H35B 5SV4A 3OBAA 4OQTA 3RJDA 2OJZL 2ED8A 5IP4A 3N1FC 4BKLB 1M6OB 3OKDA 5TDNA 2IADB 3CXDL 4Y19D 2VXTL 1SJHB 5FO7A 4M5ZL 5I1CH 1MFBL 2LAGB 4PY7A 4I0PD 3QCTH 4RWYL 3MC0A 3F7VA 5IHUH 3V5HA 2QQKL 4JO2H 3CJJA 4KK8D 1Q9KA 4ZNCD 4HJ0C 1KIUA 5EZOL 1YQVH 3L3OA 4U1SB 2ARJA 4DN4L 4YLQT 1M7IB 2IH3A 4M6ML 2BFVH 3QHFH 1MCIA 5ITFB 3SKNB 3W2DL 2M8XA 3KPPB 2FZ3A 1A7NH 1AGBA 3ZTNH 3MODH 1M05B 3MFGB 1J8HE 4PJGE 2PW1B 1I8KB 1MHEA 4OSUH 2C1OA 3DVGB 5JORB 4OLEA 5J0BA 3VXME 2V6HA 1DBAH 2AJUH 1QLFB 3TV3L 2UVFA 3QBTB 3IKCA 3MXWH 4Y8AA 4RISH 4LNVA 4G8GA 4HWBL 4RGMC 4OZGF 3MRPA 4ONOA 4U7SA 3C08L 1WZLA 2CO6B 4OFIA 4GW4B 1H3TA 3QEQA 2CDFB 4X83A 1FNSL 3DMMB 3CC5B 1JI2A 3MOBH 5F8RC 3LQAH 2AK4B 3BVNA 4L29A 5L0QC 3WFBH 1UFUA 2FWOA 3MRHB 4ESKA 3FAWA 2Y4SA 4XXDB 5L2KE 1R5IB 1FNEB 5T3XH 5H94B 2WINA 2W9DL 3UZQA 4P2QA 4YC2C 2CKNA 3RWEA 4Z5RB 2Z91A 4XMKH 3I2CL 3FB8A 1X4YA 4J23A 5I66B 4PREA 4FQ2H 4FP8H 3L5XL 4QRPD 2AJXL 1LEGA 3LIZH 1P4IL 4U7KA 1HSAB 1D6VH 3P73A 1CLYL 1HQ4A 3RVTD 4CVUA 4D2NA 2X4TB 3UZVB 4NBXB 5DVKA 4MGXA 3M17B 3REVA 3FHAA 3LSOA 1C5CH 1MCPH 4TPRL 3VXNB 1QBLH 5KVDH 3T1WA 1ZHNB 1MCSA 4D94A 4NQDB 4Q6IB 2UWEB 5D1ZC 2FRGP 4JKPH 4S1SH 3V95A 1DQMH 3UP1A 3RWIA 3LQAC 4XBEH 1OWRM 4DKDC 2X6MA 3MBEB 5DR5H 2XG5A 3D2UD 3RVWC 3SJVB 5GGVY 3DUSB 4GT7A 1KEMH 2HRPL 3ARTA 4CBPA 4HPYL 4KUCF 4HWZB 5F6HJ 4ZUTA 5C0BE 3U0PA 2OTPA 1T66C 4YE4H 1JI1A 4CN1A 4KKLD 5FDYA 2ARWA 3KLAB 3UC0H 1FVDA 4HLZH 4UAOC 4DTGL 4TTDC 1DQTA 4OGAC 1T2QH 3PHQA 3IFNL 4KK5D 4HBCH 3QPXL 5EOCL 1GCFA 5KAQF 5I9QB 1KN4L 3QWOA 4LLVA 4MA8L 1OT2A 3S36L 4GAJL 4HSQA 3RPIA 2FECI 3NCMA 3RIAK 3FCTA 3VXUD 1KCVL 5DHYB 3MRJB 4OV6F 3K0WA 2XRAH 1MHPH 2H9GB 5E2UH 1FZJB 4XPGH 3OHXB 2AS5M 1DQQB 1WC7B 1D5BB 3T2NH 3PWPB 4PLJD 1FFOB 4HJGA 5BZWB 3LKNB 4X5XB 1I7UB 4L5FH 1AO7B 4J1UB 3QG6A 4IDJL 2X4UA 3GGWB 3QZWB 4JFFE 5F96H 4Y1AB 3QXDB 3BUYB 1A6AA 5F97E 4GFTB 4HCRA 1U8QB 2VQ1A 2ZNWA 4PREB 3CSYA 3MRRA 2Z0BA 1S7RB 4HFUH 2J8UF 5DUPL 1I7RA 4K3EL 4ZD3H 5C07D 5BXFA 5F7KC 3QWRD 5C0EA 1MF2L 2OX5A 2ENSA 4WUUB 4Y4HC 1X6LA 1IQDB 1T20A 4JY5L 1CGUA 3EDJA 1ZWIA 4LCWE 5D9SA 2H2SC 1INEL 2V9TA 2WWKO 4UILH 5C0JA 4EN3A 2YD2A 2VXSH 5INDA 3G6JA 4U1NA 3C9NB 2K1MA 3OG6B 1MHCB 1SQ2N 3O8XD 1CIUA 3KJ6L 1J5OL 5B4MD 4RIRB 3WN5C 3MV8B 3QFJB 4I3SH 2OTWB 2ICWJ 1S5HB 5GRXG 1FGNH 3FT4B 2WK2A 4HMEA 4WFFD 4WFGD 4PJCB 3KYAA 3MRBB 5GSRA 5HDLA 4R0LA 3WMSA 5ELIA 3WKNA 4ZUTB 4LLUB 1CFTB 3L3KB 4M7ZC 4JPWL 3PP4L 1FVDB 2P5WE 3P30L 5F21B 4Z8FH 2R2EA 1K8DA 4ODUB 1EO8H 4QWWD 3D3VA 3BKMH 2J8OA 3GIVB 5LAXB 5I8EA 3OB8A 4RGOH 1TIUA 4JQVA 1J88A 1IVLA 2XZQL 5A2IH 4PR5B 4YXLH 1S9YA 3BXNB 4ZFFA 1FJ1B 5CEXB 4QRRB 3NTCH 5HYQA 2OP4L 4Q9RL 4GBXD 2IMNA 2E8YA 1PQZB 4OLZL 4QRTA 1YMMB 3SN6N 1DTUA 1N7ML 3N1PC 1OAUL 4YO0B 1MY5A 1GHFH 1ONQB 2ZJSH 5GS0L 1LO4H 1CTOA 4M00A 4BQCA 3VGEA 3ARDC 1OF2B 3IF1A 3VRJB 1JN6A 3S37L 3WEXA 3WLBB 4W6XB 4RMQA 3G9AB 2IPUG 4OFPA 5I0ZA 3UTZB 3WXWH 3WHXA 3Q6FB 1DLFL 2FIKA 1WWBX 3QDJE 3OPZL 4NJ9L 2VDOH 3S5LG 3ETBF 4V2CB 5C0ND 1I7RB 3STLB 3RX7A 3O6KL 2VDKL 1GZQA 3GEWB 2XZZA 4Q7DA 1G7MB 5D1XB 2BXYA 2VKXA 3BEVB 3QUXC 1DDHB 5CHNB 1F4XH 4OZ4A 5FGSA 3TBTB 1XF2A 3ROLB 4AEIH 4P59L 2YUWA 5DK0A 3UDWA 4XCCL 3NN8A 1WWAX 3W0WA 5C08D 2YPVL 4PJGB 5EH1A 3F5WB 1LK2A 1DN0B 3OJVC 3VXMB 5HDQH 5TQ0L 3BPLC 1JF6A 2X4SA 1VGEH 5B8CB 4PJAF 3KHOA 3UAJD 1JRHI 2WBKA 1INQA 3QYCA 1EVUA 2ZKHH 3KR3L 1AGFA 1PLGL 3IJYA 1MPAH 5GPRA 2NY0C 5ITBL 3TEUA 3GMRA 4B7IA 3EO0A 2JJSA 3QNYB 2ITDB 1XCTA 5TFSL 4X6FB 4LDLB 4M62H 1JK8A 1I8LA 2IQ9L 4IIQB 3ZT5A 4JY4A 3KPSE 4XNXH 4QXWA 4R7NA 5FM5M 1AHWA 1I1CA 1NAML 1WF5A 1VADB 3MUHL 5L2KB 6CGTA 2HVJB 4NO0D 3D39E 5C0CD 5I8EB 4MSWA 3RNQB 4DGVL 1PG7H 4ZQKB 3CXDH 2VXTH 4HMCA 1FZMB 1MFBH 1DCLA 4RWYH 3K8KA 3MLZL 3QWQB 3GBNL 4AIOA 4J3SA 1RZKL 4DN4H 4UB0H 4HXAL 4QRTB 4Y4KD 3T0EE 4EI5C 4M6MH 4DVBB 1DE4A 2FHBA 2X41A 3EJZD 4XCYB 5IJVA 1IAOA 4KKNA 1XGPA 2ZCHH 3CH8A 4NWTL 3RVVC 2J88L 3CH1A 5EU3B 4LFHG 1IJ9A 1ZSDA 3OGCA 5E2VL 4JFQA 1CYGA 2UZYB 1CGSH 1AXTL 4QXTA 2H3NB 5HGDB 1G0XA 1C5DB 4Q9CA 2P42B 4PGCA 3TV3H 1KULA 1KIQA 4LK4A 2QQNL 4ZSOA 2D7QA 2GT9A 5HGAA 4C56A 3C08H 4XPFL 4Z7WF 5C0BB 1QUNA 4H1LH 3SDCD 3LKQA 3L3HA 3MJGX 4F9PA 1FNSH 1JNHB 3QDMA 4E9LA 1JWSB 3C2AL 1OVZA 4PJ9D 3QUYB 3VFOB 3KS0J 1UVQA 1QFWM 1KLUA 2NTFB 2X4OA 1FDLL 4WV1A 4M93B 5B38G 1JHKH 3SPVB 1KT2B 3HB3C 3QO1A 3DV4B 5JNYB 1A1MA 2W9DH 4K23L 4LCIL 4NBZB 2JB6A 5I8CB 1O7VA 5J1TC 3G5ZA 4HHAB 5MERB 3I2CH 4KK6D 4KDTA 4YHZH 5ESQA 5EZJA 4XNZC 2ZWLT 1P4IH 1NCBL 3PF2A 2CLZB 1J9CT 3MUGA 4QYOB 5F71A 5L8KB 1MRDL 1U3HA 1E4KC 1FIGL 1P4BL 4LCCB 3GHEL 1CLYH 4DKEL 5AWNL 4PJIA 3E6FA 2FO4B 2CDEA 2H8PA 2E7LC 4YAQA 4NC2B 5DEFB 1QA9A 2BNQE 1TCMA 1U36A 1YYLH 1A14L 4TPRH 2VL5A 1LD9A 1CQKA 2EIEA 4JFFB 5IB3B 5B8CC 3Q6GL 1UQSB 1BIIB 4LBEB 1T5XA 4KHXH 4K07A 4KUZL 5D5ME 5EU6A 4X7DC 3CX2A 1U8NB 4TNVK 4G8IB 4HPYH 1V7ML 1HH6A 1IAOB 1IM9D 4YPGA 1JYXA 4LHQB 3DXAD 5GISH 5SX4I 4LCWB 3BN9C 1LO0L 2L4OA 1NCTA 1F6LL 4PJ8D 4MLIA 3IFNH 3VDAA 3QPXH 3PWNA 4J7RA 1AGDA 4YFDB 2X9YA 3FAXA 3WJJA 3ELAT 1ZE3C 1MCWW 2JK5B 2VZVA 3K1DA 5SWZE 4YIQA 3S8WA 1CXHA 3LPFA 4MA8H 1YEKH 3S36H 1IGTB 2AXFB 5TE4L 1U92B 4BH7A 5E5MA 1AR1D 5FYJD 3O4LA 3VFRB 4L9DA 1KCVH 1VA9A 3KPSA 5IQ7L 4M43H 5EZLA 3D85A 1X5LA 3D25B 2Z9TA 2CIKA 4JFDE 4OZFH 2HYMA 5DRZA 3N1QC 4WDIB 1C7TA 3BDYH 1DN2A 2N1KA 2P5EE 5I71C 2HN7A 1Y0LA 2BOBA 4M02A 4IDJH 3KPMB 1QTYT 3QDGE 2J7LA 5EWIL 1YNLL 2JJUA 3KYNA 4YBQD 5CJ8A 5BVJB 4YFLI 5J12B 5DUPH 3RRQA 4K3EH 4FQQB 4M1GL 4NZJA 1T21A 4J3XA 2FNBA 1YEHH 4ZNEE 1EHXA 1J0ZA 3WHE0 5C0GA 2P8LA 1DEEA 4D0BA 3T4YB 2FX9L 3NVQA 3DLQR 3D0LA 4L8CB 2KKQA 3LEVL 3JWNC 1GGIH 1NC4B 5DD5H 1IEBA 1GH7A 1X7QA 3KJ6H 1G84A 3QUKA 1WBXB 1D7FA 3SKJL 4S10A 4Z7OE 1KYOK 1RUPL 3QDJB 2C9AA 4OFDA 1HINL 5LGJB 1F11B 4DAGL 1T7XA 2E9IA 3LH2L 5HHME 2Z93B 3PDOA 2HFFB 3AC0A 4IHOA 1NBVL 4MNQA 4XNYL 1EIBA 5F7YC 4J8RB 4PFEA 5M95B 2Z35B 3BE1L 1KJVB 4YPGB 4CU8A 3G5YA 1XFPA 2V5SA 3P30H 3IDMA 5CEYA 3ECBA 4DUVA 3SDYL 3WFDH 1I7TA 3PIQA 3EYUH 3UTQB 3CVHA 5MHSE 3AB0B 1RZ8A 3O6FB 3BPCB 3KNBA 3BIKA 4KRLB 3FFDA 4MXVE 4HH9B 5BS0A 3E2HB 5HHPA 3IXTB 4OLYL 4CW1A 1G7LA 2OP4H 5J13B 2CK0L 1PJ9A 4DW2H 3S34L 4R4BA 3KPSB 3K74B 2O5YL 1KTLA 3LEXB 5J4MA 2BRRL 3JV4A 4Z77A 1VEMA 1HWGB 4IOIB 3TPUA 4O9HH 5GS0H 4D0DB 1OTSD 1RFDH 4KJPD 4MCYA 2Z92B 3D39B 2YPLD 1QRNE 2DQFA 4HUXB 3VXQA 2VXUH 2BXZA 2OMBA 4E5XA 2BHUA 3GJFB 2LABA 2NY2B 1YEGL 3SDDA 2NXZB 4LLYB 4G9FD 3KYNB 5IFJB 1DLFH 4FQPA 4XH2B 3OPZH 3OAZK 3CFBA 4NJ9H 4EUPA 3T0EB 2VDKH 4WRLA 3JWOL 1SEBB 4UDUA 3BHBA 4QNPE 3FFCE 4DCQB 1ZVSB 5GGTA 4TYUA 2OR8A 4P59H 4RFEB 3L3IA 3T0AA 3C8DA 1CXFA 2VAJA 4AQOA 2WUBL 4P23A 4P46B 5FAAA 5IW1B 1QFUL 5DRXA 4N8VA 2EE6A 3KAAA 1JPTL 3WFCL 3U4EA 4N9GB 2BSRA 2Q7YA 4QRUA 5DJ0B 3G6DH 3GBLA 3KR3H 4R3SB 5D7SH 5GS0C 1PLGH 3S9DB 2V7HB 1HILB 4EIZC 5J3HD 4BSVB 5I30L 1WFTA 2WANA 3P4OA 4HZLA 4NC1C 2QSTA 3TN0D 4KGLA 2ZUXA 5D93B 1RUQL 4JRXE 2Q8AL 5H2BA 4FQIL 4P3DB 2KDGA 1NAMH 4O2EA 3S5LB 3T0XA 3GSUA 1XR8A 1HE7A 1WEJL 5ACZA 3PIQB 3MYZA 2EO9A 1RJZA 2ADIA 1GOFA 1LE5B 1CG9A 4Y2DC 2FEDC 2B1HH 3RHWF 5CZVH 1H0DA 1UA6L 1ES0B 3MA9L 4F7TB 1ZK9A 1ZHBA 5HI5D 1UH2A 1MH5A 3MPCA 4R96B 5JO5B 3MLZH 4DZBB 3O3EA 1HHIB 2VDLL 1N26A 1F6AB 2X5PA 1MFAL 2VC2L 3DOSA 5B38A 4GKNB 4IRJD 4R4BB 4P2OD 2HH0L 3HMWH 4HXAH 2DDQL 3WFEH 4BELD 3AY4A 5HHQA 4V1DE 4OZIE 1CD9B 2FJHA 4J3VA 5BW7C 1LWRA 5EUKA 1SY6A 3JSSA 3OAYK 4P5TC 2BNQB 4U6HB 4UINL 2J88H 4Y19E 4NUJB 1OQOA 1A9EA 1AGCA 5DRWB 2DIJA 5E2VH 1AXTH 4QHKJ 3AREB 3QUZA 2ICES 3O6FC 1YY8A 1JWMB 4U31A 2QQNH 5D5MB 3ULVL 3E2HC 4N1HB 3HG1A 4ETQA 1OWWA 3HLAB 4PRID 4K7FA 1BBJB 1OTTD 4LLQB 4U1LA 5ERWA 4A6YL 4XPFH 4UDUB 3WIIH 4XX1G 2MMXA 5T33H 5D7LA 3QQ3A 3B9KA 3BKCH 3NFNA 5E08L 1Y6MR 5E4IA 2P24B 3C2AH 4FQLL 4WWKB 4ZXBD 3GSRB 5I17A 1KF9B 1X5AA 5DHVH 2IPTH 3LN4B 5TJWK 1IMHC 1RZKC 4QHUB 5SWZB 3CFDB 3C6LC 3CZFA 3VFWB 4K23H 1DEDA 4LCIH 1MLCA 4HW6A 3JWDL 1V3KA 2QLVB 3HC3L 1AQDB 4TULL 3PHSA 5JIHA 3SGEH 3P4OB 1G9EA 2DLGA 2VH5L 1ZS8B 1FIGH 3QNXA 4DKEH 4JFDB 4O2EB 4GG6F 5AWNH 3DGCR 1M71A 2A83B 1G7PB 5CWSA 3ILQD 4OCWL 5AD0B 1AI1L 3RWHB 1LNUB 2P5EB 1WZKA 4DFHA 3PL6C 2W60B 2OMNA 4PRPD 1A14H 5A2KH 1PSKH 1HIML 1PZ5B 3O11B 4P46C 2QBWA 4EXKA 3QDGB 1YECH 3V6ZB 3Q6GH 4HF5L 4KUCD 2PF6A 3QRGL 3DTXA 4QRPE 4JAMB 1QRKA 5HGBA 1JF1A 4XP6L 4KUZH 4OCXL 5B38B 3ZKMC 5AYUL 3PWUA 1U8OA 1NFIA 1N8ZA 5DTFA 3WNPA 3KWWA 1PYWB 3VXRD 4L8BB 4JLRA 4D9RE 1IM3B 2XKSA 4PGEB 4LPTA 4YFLF 1F4YL 1A9EB 1CK0H 4PJ7E 3ARFC 4HKJA 5F3HA 4U1GC 2NY6D 2VISB 3V0VB 5CJQL 4TUJB 3TA3A 5EIIB 1MFEH 4W6WB 4X6BA 2JJWA 3VGDA 1MCDA 5IHZA 5HHMB 2Y07L 2VDPH 3RGVC 4GH7B 2HKHL 5LCVL 4NM4L 5TE4H 5C8JB 2W0FB 1D5XB 4YDJA 2A9NL 5D1QA 1BPVA 2D9CA 1W8OA 4HH8A 4NQVA 2KQMA 5DS8A 1IKNA 2IMMA 3U1SL 4R97B 5IQ7H 3UBXG 2XACC 4JREC 2MPAH 2HJKA 5AYQA 3ZMRA 3QQ4B 1NQBA 5DRNA 3DWTA 5GIRA 5GS2D 1I3UA 4B41A 1KPVA 4MJ5A 2F53D 1QHOA 2X40A 1R5WB 3HE6C 2O61A 2YD7A 4O02L 3UPRA 4HJJL 3WJLA 3NPSB 1I8IB 5EU4B 1WFNA 4P4KD 1A6VL 4XX1E 3AREC 1HZHH 2BVYA 1K8IA 4RMWA 3DBXA 1KB5A 2DBLL 3BGAA 5JW5B 1ORQB 5EG6C 3ARBA 3D6GA 2DTML 5DEZA 3LAFA 3MCKB 3MO1B 1D5IH 4WHTA 2GJZA 4Z7QF 5GGUA 4AJ0A 4ZS6D 1M71B 4F7CA 1QRNB 1DUZB 2WBJD 1WV7T 4ONGH 3LEVH 4MNGA 3GMPB 4I0PA 3AROA 5FGCE 4HWNA 4QRQB 2G5BA 2Y5EA 4X9IA 3SKJH 2NY5H 4CDHA 4OT1L 1RUPH 3QJFB 4OAWA 1HINH 5HGBB 2QL1A 3AMKA 5E8PB 5C07E 3LH2H 3BMVA 3JUYA 1BQHG 3FFCB 1QLRB 1NBVH 1MJ7H 2Z31A 4XNYH 1IILE 1KGCD 4PV9B 2PYFB 4N0UA 4JKKA 4KI5C 1RURL 3SDYH 3MV01 2EE2A 4PGBA 3QAZC 4X7TB 2QQQA 4TNWK 4A2LA 5J6HB 2CGRH 2YPKA 5F7DB 4XCFL 3VXSD 5SX5K 4WFGE 3FQWB 4NUGH 1G6VK 3FO1B 5JHDA 5C09E 4OLYH 3VD7A 3U0TB 2L7UA 4G6FB 4DVRH 4JRXB 3S34H 4R2GC 2O5YH 4JN1H 4WENB 1SBSL 3P9LB 3T4AB 2BRRH 1OQXA 4ODSL 1PVHA 1ED3A 1WT5C 1KPVB 2A6KB 1R0AL 3PP3K 3NH7L 4FQXB 1JGEA 3ARGB 4D0CA 2EZ0D 1NUDA 2AJZB 2P7TB 4LSTL 3N9GL 4WIQA 1YEGH 3TT1L 3BP6A 3MROA 1IT9L 5CILL 4P99A 1EO7A 4URTB 1S7VB 4G43A 4MAYB 3B3IA 3H7BA 4JY6B 4L9LB 4U6XA 1TVBB 3FQRB 2BSSB 2UWEF 4HUWA 4V1DB 4OZIB 2IFGA 5DZLA 4RRPG 3OKYA 4R97C 4X5WA 4RQQA 3V4UL 1KUMA 1B0GA 1A4KA 5DMIL 1VEOA 4N68A 5KTEL 4Y19B 5F88B 5HD8D 4APQB 3ZDZE 2VL4A 2HAZA 4X98A 3SO3C 3ZYIA 1JHTA 4QTIH 3RJQB 5BV7L 2I9TB 5B39A 5JIIA 1FAKT 4A6YB 1K5NA 2WUBH 4GAYB 3CK0L 1AGEA 1NDMB 2Q3AA 1OP3K 2MJWA 3WFCH 3I6KA 5GGRY 4OAWB 4OLXL 3QDAA 5K9KB 1KCLA 2OTUA 4F7PB 3X12B 1FZKB 2BVQB 1XIWD 2X7LA 3LN5B 2YD8A 5ID1B 2RCSH 3FOLA 1CDHA 1JHLL 1KCSH 3HUJA 3P0VL 4Z7VE 5F89A 1U8HA 3OZ9L 4UQ3A 3OKKB 5KSUA 2A73A 1KACB 5C08E 4ELKB 1CQYA 2Q8AH 2A0LD 2DKMA 3VG9B 5C2BH 3EOBB 4LVHB 4F3FA 3BGMB 5JZ7C 4WW2B 3QIBD 4JZJB 2YR3A 1G7QA 2VLKA 3O4OC 3PWJA 3NABH 2YPKB 3QXAB 4CJ0A 3QIUA 3QIWD 1Z9OA 3MA9H 3T3ME 5IOPA 1KJMB 3VXUA 3C5ZD 4LL9A 3IU3A 4FN0A 1MAKA 4GUPB 4MDIA 4UUJB 5EDXA 1NGPH 2VDLH 3B6SA 1MIML 1MFAH 2VC2H 3FQNB 3M45A 3MNVB 3U36A 4QCIB 2KZWA 3WNOA 3HZKA 4E0RA 2DDQH 4NFBA 3RWFA 5ESVA 2FGZA 1DBKL 3H9SE 5KG9A 3S35X 1YNTA 1ED3B 3LV3A 1CDGA 2OYPA 5SWSD 1RPQA 2QTEA 5GRVK 3WBDA 5IJKA 3WIFA 2F5BL 4GS7B 4J4PC 1ORSA 5F1SA 1IC7L 5TE7L 4QRPB 4BQ6A 1DR9A 5IMLA 1ITCA 2L0DA 4YPJA 1HHJA 3QWRA 3ULVH 3VDBA 1EJOL 2P47B 4G8FA 3ZL4L 1A1NB 1L4IA 1OLZA 3I3EA 1KNOA 1Q9WA 2AERT 1EEQA 4RQQB 4M1CD 5E1HB 3NZ8B 5E08H 4OLWL 4PJCF 3O8XA 2HT3C 4NQUA 4PJ7B 3IDIA 5EC2A 1E28B 5B39B 1FNLA 3SY0B 3OF6A 4GKZB 3MJ9A 3GMMB 3WHE1 3T2PA 2ZOLA 4F33A 3I84A 1ZGLA 2XTJD 3QHZH 2HTLC 3D2UB 2WLZA 1KV3A 1QBML 4PJEE 1F3JA 1S7SA 4AYFA 4X4YA 1GGUA 1HKFA 1DUYA 3JWDH 1L7IL 1YY9C 3GNML 2X7LB 3THMH 3OAZH 4TULH 3ULSA 4MAYC 2G75B 4XP9L 3BPNC 3MRDA 4KVNH 5I76B 2VH5H 4GW1B 5BZDA 1U42A 3T0VA 1N0XH 3DVNB 1YPZE 2FHCA 1FO0A 3RDTD 4LGPB 2W9LA 4ZPTB 2BDNL 5FIEA 4NBYB 4OCWH 4APQC 3ULVC 1AD0A 1AI1H 4M03A 2W91A 1HEZA 3MRKB 4WVRA 5DD6A 4OIIL 1HIMH 4DZ8A 1UH3A 2Q76A 3HHRB 1DVFB 3PWVB 4IS6A 3VXOA 4FQHA 2R29L 4GBXA 3EDDA 3QRGH 4QY8B 2FSEB 1B0RA 4QXUH 4YDVA 3H9HA 4XP6H 4FQ1L 4OCXH 3PGCA 4MQ7A 5KZCB 5BRZD 4KAQH 2BMKB 5ESVB 4XP1L 5IG7B 2QEJA 3TH4T 1T1ZB 4F7MA 3F8UB 3IXAA 3DX7B 4YHNB 2PO6D 2D7NA 1G7HB 4NN7C 3FOMB 2JIXB 3LB6C 3JWDC 4AEHH 1KTDA 1XT5A 3CFCL 4JZJC 2R39A 2GFBB 1EMTL 1F4YH 4L8DB 1F02I 3MUZ1 5AUMA 3SCMD 5EU7C 1ZT7B 4PJGF 1UKTA 5DJ8B 3VU2A 5C07B 1A3LH 1T5WA 2VDRL 4OQTH 2VAAA 4LVOC 4YBLB 2O93L 3GIZL 5IBLD 2Y7QB 2A9NH 5IF0B 4C54A 4OIBA 1TVHA 3IDJB 4NO2B 4RNRB 3DO7B 4XNQA 5FHBL 3TNNA 1HNGA 2NW3A 1LEIB 2G5RA 2X4NA 2AJVL 5E8EB 5EOCJ 3EYVA 5C0AE 3QA3A 3PXHA 3B5HA 2GSGA 1F3JB 4N0CD 4P9HH 4KKCC 1BQLL 3FZUD 5TDOB 3RVUD 1OAZH 1P53A 5C09B 5J11B 5L2JB 1HDMB 1XGUA 2HFGH 5EOTA 5KSAD 4DOHB 2MHAA 4X6EA 2DTMH 5IFAL 4MA7H 4S1DD 4LARL 2OR7A 2EDXA 2PXYC 5C0CA 4UDTB 1IL1B 3OKEA 3T65A 3BW9B 3MRGA 4J12A 2OQJA 5KVFH 4I5BA 2VJXA 2RB8A 2YRZA 4NN6C 4ZOEA 2FJFB 5C70A 1LO5B 4K8RD 2EDNA 4L1DA 3Q2CA 3G6AA 2B0SL 4J3WA 4OT1H 5KSBA 5EORL 5DUBA 1QD0A 1F2QA 4Y4KA 1DLHB 4UIMA 1YDPB 3WNLA 5A16B 2EYSB 4Q9QH 1UJ3B 1FNFA 1KG0A 4ONFL 4NRYB 3HC0B 4NKQB 1HHKA 3SBWA 3MV11 1OY3B 2D31A 4NKDB 3RQ3A 5FFLA 3DROA 4LNRB 2Y5TA 4G5ZH 2GTZB 5ENWA 5AUMB 4POUB 4HIJB 4PJEA 4PJDA 1T5WB 4Q97A 4PB9L 4LLMA 2KQNA 3SDCA 4KHTL 2H32A 2ZP0T 4LHJB 4QT5B 4Z7VB 4BFIA 1NMBL 5D2LA 4PJ9A 5C08B 5KSVB 1TVHB 4TN9A 1HQRA 2EDFA 5JPMA 4ODSH 4NIKB 3JBG7 3TO4D 1BQHB 3PQYE 1R0AH 3DRQA 1Q9LB 3NH7H 1C1EL 1U41A 3ES6A 1BVLA 3OR7A 2EICA 1G7IB 1YA5A 5MEPB 3WLWC 1FL3B 1OGAE 3S3JA 3N9GH 5IEKB 3ZO0A 5L7XL 5LQBH 3FTGB 2EEBA 2J1KA 4ZUWB 2FYYB 4YBLC 4RWHA 5D7IE 2BVOB 3H9SB 4U33A 4C83B 2FJGA 4PJBE 4LSVL 5C0IA 2F19L 4NO0B 3IJSB 4OUOA 3U9PL 3AMLA 3L5HA 3V4UH 4OLVL 2YPLE 2Z8VC 2NY4D 2OQJB 3MV9E 4CU7A 1ZHLA 5FF6B 5BV7H 1MJJA 2DYPD 1H3XA 2E8ZA 3V8CA 2H1PL 3CK0H 2EC9U 3RZCB 4JFYB 5ICYB 3IFOB 5CGTA 3FT3B 5D2NA 4BZ1H 1I1AD 5IT2L 4OLXH 2VLJE 2IAND 1WGOA 3VFTB 4YNYA 2EDHA 1JZ6A 2Y36H 1NC2D 4WO4D 1IM9A 1A5FL 3DXAA 4JJ5B 4EZMA 4M9OA 1FNGA 4PRDA 4LGRB 2D3VA 3L5JA 1JHLH 5TGBA 4PJ8A 1RULL 1SYVA 2ZPKL 3F7YB 3P77A 1UB5B 3GJEB 2YXMA 4HCRH 4TVPD 5TDPB 4QGTA 1FLRL 5C0DA 1QACA 4NPYB 1DL7H 3SHSA 2AV7A 5I1IL 5JW3L 1BJ1H 2CJUH 3MFFA 2I07A 2R23A 2OSLB 2NY3D 1F13A 4PJEB 3VRIB 1FVEA 4LGSB 3VWJB 1KJ2L 4MCZB 1CLOL 3Q3GA 5HBBA 5D7JD 4YQXL 3FQTB 5IVZA 1MIMH 5BV7C 1RSFA 2MWCA 4XB7A 4Y88A 3BDXA 1YPZB 2HMIC 3N1GC 4RMSA 4YHIA 4GSDH 1DBKH 2XYCA 1EAPA 1MWAL 1UCBH 5KN5A 4NGHL 4RFOL 5F9WB 3I3DA 4IM8A 5CBEA 1E6JL 1F42A 1CR9H 1BVLB 5KAQG 3BPOB 2F5BH 4H26B 2KUTA 1ACYH 4P5KB 1BD2D 3ESUF 2P45B 1W72B 5EBWA 5DVNA 1A1OB 1QNZH 2EDTA 1GZPB 3OXSB 3ARPA 2DQIL 5SX5H 4HJ0D 1P7QB 1WZ1L 4GKSB 4OFYD 4PY8I 2AAVA 3T0BA 4X4XB 1N5YH 5GJTL 4NRXB 4B50A 5GGVL 5E2WL 1EJOH 1RK1A 2YWZA 4LASL 5IROC 3CVHL 2FJGB 4DJMA 4C4KT 4HKBB 4KK9C 2VLRD 5IBUG 1QSFD 3C09B 3SDAB 2MTPA 4AH2A 2ARJQ 4S1QL 3DRTB 5DJCB 3TBVB 2VABB 2DLIA 5CSZB 3EYQC 5J56B 1DBJL 1C08B 2F8VA 1MJJB 4EN3C 5L88L 1EBPA 2CH8A 1EJ6A 2EC8A 3PP3H 3SKOA 5GZOC 3E3QC 1PKQA 4E42A 1I75A 1U6AL 3WO3B 1AD9A 4P2RE 1UACL 2BX5A 3QISA 1QBMH 5FM4A 4PRIE 3GSVB 3LKRA 4MD4B 2Z8WC 2OI9C 1J12A 1IM9B 5CBAB 2NCMA 2WQRA 3S37X 4XP9H 4ZO9A 4R0LC 4XPAL 3HE7D 3OB0K 1SYVB 1BJMA 3FB7B 1GL4B 5GGRA 4HDIB 1XF1A 5LBSL 1OCWL 2BSED 3HZMB 4ZO6A 4PD4J 5I1KL 5I1GH 2DLEA 4B0MM 5E03A 5C0AB 3TIDA 5EU5A 2YSSA 4M7LT 1JZ8A 1UM5H 4OIIH 1X9QA 5GGTL 2P8MB 4JQVC 3MV7D 1OP3H 3BMWA 2K7PA 3Q3GB 1OARL 2AABL 4NDMB 3DI3B 2X1XR 3MR9A 4AY0A 4FQ1H 5F9OL 1YEFL 3OXRB 3BH9A 3HTLX 5GRZA 4LKCA 3C8KA 3QNZA 3Q5YA 3D0VB 4XP1H 2FL5A 4X9FA 1BBDL 3CPLB 4NO3A 4WEBL 1KEGL 3RTQB 4HG4K 5T1LD 3CFCH 2VDML 1FFPA 1FCGA 5HHNA 3RNKB 3ZE2E 3CSPA 4M8QB 4OKVA 5I1EL 2VSDA 4G9FA 4TUOA 4CL7A 5KOMC 1RUKH 2UZIH 5D1ZD 3MLPA 3NFPB 5BJTB 3SE9L 1B2WL 4U1JB 3VWJC 2EH8L 4KGJA 3BDBA 1FRGH 3RVWD 4LOUD 4LCUB 4FFZL 3MRFB 5DK2A 3K46A 3OJDB 4JFOB 2ZOKA 4GRMB 2D0FA 1U93A 3FB6B 2CXGA 1TJGL 4GRWH 3A0OA 4TTDD 5EO0A 3UDWC 5DDHB 43CAB 3F65A 3QXUA 1FFRA 5JW4N 3BO8B 2DIAA 3HRZA 2UUDH 3D9AL 3H42H 4I48B 1T03L 3DARA 1FC1A 1SY6L 3MJ8A 3BSZH 1BQLH 4KMTH 4MDJB 1FG9C 3BQUB 4PGZA 1WIOA 2JJSC 3H0TA 3OAUL 4XHJC 2I5YH 3DGGA 1RZIA 1OPGL 3Q0HA 4XNMA 5D7KD 2BJML 1I8LC 4QO1A 5ISZE 5IFAH 4LARH 4F8TA 5D71L 1AHWC 2F53E 2I9LA 3PQYB 4GQ9H 2N56A 2DQTH 1IC1A 3ZT6A 1BZ9B 5ESAA 4LEOA 5T3ZD 5DEGA 4OD3H 3DVFA 3MACH 5AG8A 1OGAB 3EYOB 2VZ1A 4NQCD 1MI5E 4DN3L 2GK0A 3U46A 1AIFB 4D9QE 4PG9A 3SDXA 5DFVC 2Z8SA 3KYMA 1K3IA 3QB7C 3GZKA 1G6RB 3HCVA 5D7IB 4UBDC 4UU9B 3MGOB 3PHOB 4PJBB 3P3YA 4MB4A 4FXKB 4TSBH 3KPOA 2OK0H 1A6TB 5JXED 4Y4HD 5D5MF 3DMMD 4ONFH 2YPLB 4X5LA 1TZHA 1F45A 3L7EA 3MV9B 5T5FH 5EFIB 1REIA 4OZGA 2AK4D 2H2SD 3ZYZA 4OBRA 1D5ZB 3BWAB 3TIEA 3HN3A 5JR1L 1RUAL 3QUML 2D7PA 3GMNA 3AM8A 5E2TH 1V7NL 4XCEB 2AJ3A 3R4DA 4JHWL 3VFGL 1VFAA 1ZLVK 4I9WD 1TQCB 3F12A 5FYLE 3G08A 1T0NA 4QTHA 3LQMA 3DSFH 1A0QL 4PRAB 4KHTH 3EOTL 1KGCE 3V4PL 4XBPA 5HGGS 1DP0A 4X8JB 4L8SB 1YUHA 1NMBH 2AKRB 4YH6A 1JIBA 2PNDA 4G6KL 5FYLL 4ZXBA 4F9PC 3K81A 1KJ2B 4JRYA 2GQHA 3MOAL 1KB9K 5EUOE 4P57A 3HI5L 3RTQC 1EHLL 1B9ZA 4WV1C 3GKZA 3PNWA 1MHHA 4GW5A 4BFGA 3C87A 3G5VA 1MCLA 5IR1A 4NQDD 1HXYB 4PRHE 3GBML 1F97A 1M7DB 1MWAB 5GSVA 3MBED 2IBZX 3TN0B 3JV5A 3DURA 1Q9OB 3SJVD 4E41E 5I8OH 3H0TB 5IB4B 3DGGB 4UZGA 1E27B 4PS4L 3GMOB 1PAMA 5I75C 2BNUA 2DQHL 1U3HC 3UTPE 4HKZB 2F19H 1N6QL 5HHOD 2ZUSA 3U9PH 4DUWA 2OL3A 4CGTA 4OLVH 4PRPA 4XVUC 1NFDF 1MRFL 1P69B 1ZT1B 3MLRH 1VKXB 4ORGA 5FA3B 3T0WA 4K71B 1KC5H 4GQPH 2X44D 4XP4L 4I2XA 3JVGA 5C3TA 1IGYA 2H1PH 2V2XB 2YKLL 4JFHE 1YJDL 2EDYA 4QHMB 4IRJB 2R1YA 1QKZL 3KYMB 3O45B 4P2OB 5F7EL 5IT2H 4O2FB 4OM0L 2PTUA 3O9WB 4Z7OF 3BYTA 5IB2B 4BSJA 3BQUC 2PYEE 4WGWB 2O5ZL 1A5FH 2V2TA 3VXRA 4LRNH 4UTBL 5EC1A 3ARZA 2APBA 5DVLA 1OB1B 1RV6X 1RULH 3GM0A 1T04A 5EBMB 5E8DL 1T1YA 4PLNC 4NKOB 2NX5E 3CFEB 5FV2A 1FLRH 2QKIA 1Y6NR 4H25B 3GMNB 3VFUA 4G80B 4OCRL 2EE9A 1AO7D 4JDTH 5I1IH 4P2RB 1OAKL 3BGFC 5I1DB 4PRIB 3WJJC 4EEEA 4KI1A 1T0NB 3CAFA 4LP5A 1CLOH 1TZIA 1XR9A 3FKUS 4MMZC 2DJUA 4MXVF 4YQXH 2HJLB 2VWEE 5FKAA 5F7NC 5DD3L 1XGTA 1KJ3L 5HVHB 4WUUD 3N50A 1OGTA 2J6EA 4YR6B 1JBJA 3ZTJH 5DFWH 4FA8A 1QFWL 4NGHH 4M7LL 2J8UA 4OZHF 1RMFL 4P4KA 1E6JH 1IFHL 1CLZL 4LQFL 3PJSA 5IR1B 3MV8D 4O2CA 3LQZB 4XAWL 4ELME 4CJ1A 1EZVX 1MIEH 1U8KB 2CLVA 1WZ1H 4OV5B 5GJTH 5GGVH 5E2WH 3U6RA 5C2UB 2P43B 4EI5D 3CVHH 1LMKA 4L8SC 4HUVA 4U0RB 4PLKC 3MZTA 1JPFB 3QCVL 3G5XB 3DVIA 5SWSE 2OL3B 3RVVD 1E4WH 4QNPF 1HNFA 1JNJA 1FIEA 3KXFE 4NC0B 5L88H 1GOHA 5DYOA 5DLML 3GB7A 3VFSA 1CLCA 3ZSTA 3C5SA 4NZRL 3RZWA 1U6AH 1U3YA 4YK4C 3BP4B 1UACH 5D70L 4FS0A 5HYJA 2I26N 4QRRD 3OJMB 3MMEB 1CFSA 2F5AH 3C6SB 3OKLB 1S9XA 2CXKA 5D6CA 1YMMD 5MI0C 3K4DA 1XF5A 1RJYB 4ZTPL 3H3PL 5IK3A 5LBSH 3PV6A 1OCWH 5IMMB 2NY6B 1BF8A 5IHBA 2E27L 1BJ8A 5HYFA 3UBXI 4EUPH 3VXSA 2JCCE 2XTJE 4GAGL 3HB3D 4K71C 3L3JA 4EVNA 5IBUB 3S97C 3R1GH 3RU8L 3U4BH 3ILPB 2OZ4A 2B2XL 2J12B 2DIBA 2DM4A 5GGTH 5K9OB 4S2SB 1KXVC 4X8XA 1UZ8B 2AABH 2A9ML 3OKNB 1IAIL 5F9OH 5ISZB 5D1XD 1X5ZA 1XGTB 3IB4A 1U8MB 4WI6A 3PWLB 1I1YA 1CDYA 2R0WL 1MVFA 4W81A 2F53B 1LHZA 4N9OB 3RWCA 1J8HD 4CADB 2ZUTA 4WEBH 2IBBA 4OZIF 4MB3A 4H20L 4J3UA 3VXMD 1HH9B 4LPCA 3KYOB 3BZFB 2BY1A 4BFBD 1A6WH 1MI5B 5I1EH 4YJZL 4XC1L 1J1PL 1NEZG 5I1JL 3ULVF 4JPIB 3ZKSD 2UV3A 1LE9A 1B2WH 3SDDC 1Y18B 1VACB 4UT9L 3ZE1E 2ITCA 3WFZA 1AR2A 5FYJU 2V5MA 3QUMB 3IDGB 5E7BA 4FFZH 2K3TA 4PJAA 1H15B 5DVOA 1N6UA 2WBJB 5MEOB 1YEJL 3TGXA 3RA7L 3EJYC 2DM7A 5FO9A 3CSGA 5F7LB 3C60C 4R26L 4H5SB 3VFSB 4P23C 2NY1B 3LMJL 1G9NL 1RIUH 4IEFB 4WW2F 1A9BB 3I6LD 1XIWA 3D9AH 3UEZA 3QI9A 4HGMA 3R06A 1T03H 1SY6H 1QHPA 1AXIB 1S9WA 5IMKA 2CRZA 5KS9F 4F2MA 1K2DB 2BJMH 4OCSL 4XBGB 1UM4L 4U0RC 3DX9B 1R3IL 1I9EA 1NGWB 4XGZA 1EXUA 5EUOB 3PV6B 5F1NB 5JHLH 2CKBA 5D71H 4ZUUA 4PJ5E 2DWDB 3QIWA 4IBLT 3EIFA 3QEUA 3DUHA 2VE6A 5I1LA 1Z6JT 5BO1L 3LHPL 1BAFL 4PRHB 3C5ZA 1E6OL 1RJLB 3IDYC 3TNMA 2V2WA 5DJAA 4DN3H 4XT1C 4PP1C 4HFWA 4E41B 3RL1B 2ICWB 4F37K 4U1MB 4G6JL 3BD5A 3GMQA 2GY7B 5GRUL 4ORZC 1S7TB 2D4FA 3TT3H 1KBGH 4Z76A 1NANH 3KPNA 5JR1H 4Z7WA 3U4AA 1BLNA 5I15H 1MCWM 5GS1B 1DANU 1V7NH 3WXVL 3H3KA 4FXLA 2D9QB 3QUZC 4JHWH 4MA3B 3VFGH 4ZG1A 5HY9B 4CMMB 4PJ7F 1FO0L 4O00A 1L9MA 1AXSA 2PYEB 3B9VA 1A0QH 5ABDE 2NZ9C 4AENB 3EOTH 3V4PH 5FUCE 3TBYA 3IDUA 4NZTL 1A4JA 4M9PA 2HVKB 2XFXA 2FR4A 2BK8A 1T22A 3O2DA 4LLAA 3B9KC 2DTSA 4R6UA 2NX5B 1HWHB 3MOAH 2EKSB 5DZNA 5CINL 2WP3T 4YDIH 1EHLH 3V6FA 5CMAB 4JFFD 2EEDA 4MD0B 4O58L 1ND0A 5LVEA 5DC0A 5LGHL 3GBMH 4FABH 4ZFOL 3MLUH 3KPLB 5HVWA 4HS3A 1TENA 1NLBL 2MKWA 1W0WA 2VQTA 3FONA 1QEWA 3MRIA 5B21A 3RDTA 2ADJB 1RUMH 3QIBB 1U8IA 2DQHH 4KROC 3LRSB 3TH2T 3DX6A 2MOVA 2F54D 1N6QH 1MAML 1RY7B 1MRFH 1ULVA 3V6OA 5EN2B 2YC1A 3K8LA 3GSOA 4I18A 4MJ6A 3QEUB 3O6ML 1ZMYA 5I1LB 4LSUH 2EDWA 3C5ZB 1Z5LA 3KPQB 3STZB 5INCB 5F7HA 2V9QA 2YK1L 4ELMB 2YKLH 3CU7A 3IDNA 5DHXB 1DQDH 3QULA 1QKZH 1PBYA 4OQ1A 5BRZA 1D6EB 2DL9A 4MXQC 4ZPVA 1P4LB 2MQCA 4I8DA 5IB1B 1A3RL 4MWFB 2O5ZH 4HPOH 2PO6A 2P5WD 3I02A 3EYFA 5SWSB 1QYGL 5E5UB 1T6VN 3RFZC 3HR5A 5KJRH 4Z95L 1DSFL 4AK1A 4P4RB 1KB5H 5E8DH 3X3GL 1EV2E 2XICA 3BISA 3KXFB 3ZKQD 1T3FA 1BLNB 2BVPA 4TOYL 1T0MB 4CMHC 4OCRH 2W0PA 3HZVA 5FV1L 5E95B 3DO3A 2IANE 1OAKH 3TA3C 5J6GB 3DUUA 1ZA6B 5GS0D 4QHLB 3WS3B 1T83C 1MCNA 5IM7A 1T4KB 5TPWL 2F8XC 4JE4B 5D1QC 5KBNC 1VFBA 2AV1A 1JFQL 1ZA3A 2XFXB 2YD1A 1IKNC 1KJ3H 4HV8B 3BAEL 2O5XL 4KPHL 5C71A 4TVPE 2A77L 5IEHB 3VRLF 43C9B 1KFAL 1YJDC 3STBA 3L7FA 3ZLQC 3RGHA 4LSRL 2JCCB 2XTJB 1RMFH 2DJ4A 1NC4D 2E6QA 2P8PA 4N1EA 1IFHH 2WIMA 3L6FA 3EDKA 4LQFH 4P9ML 5FOBB 2C3GA 1BJ1J 5GS1C 3WJLC 4M61A 3KJ4B 4G7VH 1JMZA 4MZ3A 3RIFK 1KCKA 2FH6A 3QDJD 1F4WL 2AEQH 5E24E 5FXCH 5BOPA 1ZLVH 2PETA 4XAWH 2OBGA 5KSAA 1CFQB 1Q94B 1U91B 3VFNA 3ROOA 1GGCH 2FEEL 5IVXE 3BP5B 5C9JA 3CFKB 1S9VB 4HAFA 2BNRA 3ARBC 1OM3H 3MYJB 2WMPA 4BSWA 1BP3B 2VITA 3HAEA 3P4MA 1W0VA 4P5TD 2LE9A 5CD5C 2X4PB 1EFXD 3FB5A 4M7KL 4GLRH 3RBSA 5ANMA 3FN0L 4ODVL 4N1CA 3O6FD 4N0RA 3IAGC 4KK8C 4NZRH 5I1HL 5HDOA 4KJYA 5D70H 3VXTA 3WE6B 4W4OC 2VWEC 2VLRE 3B5TA 2Z31C 3VE0A 4MD5A 1IC5H 1NAKL 4PRNB 3C5JB 2XTJC 4MNHB 3H3PH 4Z7VF 2VN7A 3AGVA 1UEMA 3ZKND 4JM2B 1ETZB 2R2BA 3SCMB 2E27H 3A6BH 2YHGA 3GUTB 1NH6A 2BVPB 5BMFH 1CFNA 3NIDF 4GAGH 4LF3B 4HIIB 1CICB 2A6JB 4PTTA 3RU8H 4FXGA 1HSBB 2B2XH 3MLTA 2NXZD 1DQJA 3G6JF 5D72H 3MLYL 4U1KA 1GGBH 1YQ2A 5GS3A 35C8L 2A9MH 4AMKL 1FG2B 4POZD 3T3MF 4LLWB 3VWKB 4HKXB 4HLZG 1IAIH 1J18A 1G1CA 1N2RA 2X1WL 3HNTL 1V3MA 3P2TA 3VG0L 3CDFA 3X11B 3TO4A 2DWEA 4BM7A 4PJ5B 5C0FA 3EZ8A 4XWGL 5I1CL 2AK1L 2GYSA 3FRUB 4H20H 5IHUL 4Q58C 5FECB 4LKXA 4P46D 3MV7E 2VDQH 3PE9A 1P1ZB 1D9KB 1IGCL 3U82B 2ATKB 1I7ZA 1J1PH 4JKWA 5I1JH 2BY2A 2BFVL 4YDLB 2XXCB 1MREH 1K9TA 4LAQH 4AEFA 4JO1H 1F00I 3ROOB 3P40A 4UT9H 4GXVH 4WUKL 4X0KB 3H7LA 3P9MB 4TSAH 5JDSB 5MENE 2XWJB 5JOFA 1UXWB 4U1IA 1JPGA 3BD4A 1AKJA 4XMPL 5FYJL 1DBAL 4HGWB 3L95B 3RA7H 3TBWA 1UWGL 1EEUA 1RU9H 1IARB 3BP7A 3MXWL 4KV5E 3ARFD 1QOKA 2ZUVA 2NXYC 4R26H 3LKOA 4M6OL 3TVMB 4LRIA 2ZUWA 4RZCB 3LMJH 5DI8B 4BFEA 5J7CC 5E7FA 4WO4A 1NC2A 4NQSB 1OW0A 3L1OL 3RGVD 5T3XE 4DEPC 1XF4A 4ISVA 1R5VB 3MOBL 2ZUQB 2N7BA 2UYLA 4KKLC 3UROR 1NEZB 2XPGA 4OCSH 5T3XL 1UM4H 4NQXA 4RA3A 4KH2A 4ZFOB 4KK5C 5A1AA 2BNQD 1JUFA 1F58L 1FFQA 3O41B 3D69B 2GCYA 3HE6D 4XMKL 1YPZF 3FRPA 4WNQB 2IPKA 1D5MA 5BO1H 1BAFH 3ARED 3LIZL 3QIUC 3GRWL 4Z7QE 2HTKD 3U2SA 2EYRB 5FKPB 2RIKA 1P6AB 1XH3B 4RAUA 4PRBA 4Z7UA 3MJ9H 4Y5YA 3CDGA 3GSWB 4CVZA 3VJ6B 1C5CL 2R0ZL 1JNNH 3S88H 2QHLA 4TUKL 1G9NC 3VFVA 3WL9A 5CP7A 2YEZA 1KLFA 3TO2A 2GUOA 4WWKD 1G7JA 5E8OB 3NFSL 2BOCB 1BD2A 3S4SA 5IJKC 4S1SL 1DQML 2IAMA 4NJAH 4NQCE 2GJ6A 5SWZD 1H5BA 4JPVL 4OFYA 1CICC 3JV6B 3WXVH 2VIRB 3EAKA 3QJHB 4OTXL 2XIDA 5DSCA 3MTRA 1FO0H 3BRFA 1H3GA 3CFIC 4PJFE 2A74B 4LFHD 3RWJA 4O5LL 4YE4L 1U8PA 2JB5H 2VLRA 4NKMA 3UC0L 1QSFA 3PABB 5IV2B 2QSQA 3BH8A 5I73B 3MNWB 4S1RL 3UMTA 4NZTH 3UTTE 5CJ5A 2FBOJ 4JPKH 5D96C 3U9UA 3KPRA 2DYPB 3W11D 1AH1A 5JPNA 3G04A 4LHUG 2H6PB 2P5ED 3BT2L 2R4RH 3LDBB 4HXBL 3RWGB 1WZMA 1I1AB 3BWUC 4I9WE 3IGAB 2IANB 4O58H 3QDGD 1IEHA 4LPYA 3X14A 4NT6B 3RKDC 4I0CC 4KVCH 2OXGA 1NC2B 4GG6A 4OF5A 5A2JH 5LGHH 1JVKA 4WEMB 1JWUA 5E2UL 4NKIL 5E6YA 3HE7A 3Q1SL 4FFYH 5JDJA 2GAZB 5F70A 5DJXA 1NLBH 5CGYC 1SHMA 3JTSB 4JHZA 2GITB 2PCPA 4L5FL 1S7QB 2MQ3A 2EE3A 4NO5A 2ADGA 3FO2B 1MAMH 5C6TH 2GCYB 2PTTA 1J10A 3GSXA 1BVKA 1YEDB 2E6PA 3O6MH 2GK2A 1BX2A 2Y9RT 2QSCL 1BEYL 3MJ7B 3WUWG 5D7JB 2NY7H 5IIEA 2YK1H 1FZOB 5DJ6B 3TFKC 3W9DB 3OJ2C 3U2SB 5HHMD 1TTUA 1FVCA 4GBXC 2LVEA 4HIHA 4XVJH 5IVXB 4I3GA 3EGSA 3MREA 4MA1B 4NCC2 4YGAB 1NGQL 1WBYA 2OJEB 3AS2A 1A3RH 2X1QA 1S3KL 3BZ4A 4DUXA 5HHOE 3VMNA 4JG0L 4O51A 1QYGH 4LU5L 4K3GA 5T1LA 2C3VB 1CT8A 1NCNA 1H8SA 3ARRA 3O3DA 5F3BB 3MOQA 4I3SL 4Q2ZB 3U0WL 4PTUB 3A6OA 4KMQA 5HYSG 4TOYH 4PP2A 3HPJA 4ZDHB 4CNIB 3FHQA 3ZSSA 1K4CB 3MRCA 5DA4A 3K3QA 1HKLL 1ZT4B 3MRMB 3IAPA 1K4DB 5C0NC 2P1YA 2RJMA 1CBVH 2VLRB 4ODWB 4G3YH 1KIPA 3IJHB 1QSED 1YEEL 1MCRA 1CD1B 2ICEB 1EO8L 3IETB 5H35A 1WWWX 5F6HI 3BKML 4QRSB 1JFQH 2E6JA 4N90E 2HG5B 4R7DB 4BKLA 2A77H 1WISA 5JZ7D 1A2YB 1M6OA 2B7DT 2IADA 1U58A 3T2OA 1OAXH 4LSRH 3UAJC 1OOAA 1M7XA 4RGMB 3LZFL 2AGJL 1QBBA 4WTZA 2YN3A 4WHDA 2XQYG 1I1RA 2DF3A 1NANI 4ONHB 4U1SA 1ZANH 1F4WH 1M7IA 2X4QB 2CLRB 4H1LG 3DETC 5SWQB 5ITFA 3LKSB 3SKNA 2HLAB 1I9RL 5F1KC 3KPPA 3FFCD 4R4ND 2YA2A 1LO2L 2M2DA 4XMLH 1M05A 4OIAA 2PW1A 1I8KA 5JORA 3DVGA 1UYWL 1CN4A 2VLME 2PTTB 1NCDL 2Y1VA 4YC2B 3O2VL 2H32H 1P9MA 3WXWL 3MV7B 1BX2B 3LDBC 4J4PD 4KRPC 5HYEA 2VDOL 1A7BA 5H37H 3FN0H 4ODVH 5BQ7A 3MA7B 5IIEB 1RZJL 2XWTB 2Q6WB 1QFOA 5T1MB 5D8JL 4GW4A 1LP9E 4Y4KC 3CZJA 2CDFA 2X09A 4AEIL 4MHHI 5JXEA 4Y4HA 3DMMA 2R2HA 3CC5A 3EJZC 3R8BB 5MENB 5K59F 2NNAA 2AK4A 4HD9A 3UZEA 3MRHA 5TF0A 1VFOA 2DKSA 4XXDA 1VGEL 1R5IA 1FNEA 1NAKH 3SBWC 1MVUB 5H94A 5HGHB 2E7MA 5D1ZB 2ENYA 1LK3L 2RR3A 2ZKHL 2JJVA 2Y23A 4NQEE 4Z5RA 1MPAL 5F8QC 3ARGD 4D8PB 4MZ2A 1KCRH 5A3IC 4FHBD 2D7OA 1L0XA 3UTSE 2ICWI 3P0YL 1YEIL 1HSAA 1YY9D 3TH3T 3MLYH 3ORJA 4WCYL 4XNXL 4MAYD 3IVKB 3WNKA 4UAOB 4Z0BH 4V1DD 2Y25A 2X4TA 3ULUL 1KXTB 4DWHA 3M17A 3HNTH 1QFPA 2XNAB 3VG0H 1J8KA 2MKLC 4K7PH 1S78C 4EDWL 5LWYH 2I27N 3VXNA 5IFHH 5EB9A 5FYKU 3O0RL 1PG7L 1ZHNA 1U58B 3EUUA 4APQD 4G9DB 4XWGH 3ULVD 1PZUB 5JIKA 1VHPA 2AK1H 4NQDA 4Q6IA 2UWEA 4F15C 5ETUB 5HYIA 3LRHA 4HQQH 3MBEA 4HT1L 2W65B 3SJVA 1IGCH 2PW2B 4KK6C 3DUSA 4UB0L 1HI6A 5ACLA 4FFVC 3F62A 5J06A 1JJUA 4HWZA 2ZCHL 4WUKH 4NZDA 3KLAA 2V7NA 3K2MC 5KW9L 3CMGA 5HVFB 4OZFG 2ATPB 1C5BH 2Y6SC 1T7YA 1GYAA 1A3QA 2EH7H 1A7PL 2X1OA 1CGSL 1W8NA 4XMPH 5FYJH 1P7KB 1UWGH 4NQCB 2EDBA 3GSNA 4EOWL 2DRUA 2ORBL 3FO9B 5BQ7B 2A6DB 1QFWI 4M6OH 4HWUA 4L4TD 3VFPB 3M1BB 4FMFA 2J6EL 2RFXB 3D18B 4PJFB 5E8NB 4UOJA 5DHYA 3L1OH 5D2NC 3MRNB 3MRJA 3NCJL 4RMVA 3MLWL 2FD6H 2H9GA 2BHZA 2R9HC 4Y4HB 4GKOA 2R2HB 1BFTA 1FPTH 1FZJA 4OGYH 3OHXA 3UTTB 1LEKB 3EO1A 1FSKC 2NNAB 1DQQA 1WC7A 1D5BA 5I6XC 4LIQH 3PWPA 2XG4A 1FFOA 3SGDH 5FM5O 1EPFA 1JHKL 5BZWA 3LKNA 4X5XA 1IGJB 3GM8A 1I7UA 3WN5B 1AO7A 4J1UA 3GGWA 1F58H 3QZWA 5FGRA 2HP4A 4LPWA 1TNMA 1KPUB 4Y1AA 3QXDA 3BUYA 3SE4A 3I6LE 4HC1A 1WFOA 3CFJB 1U8QA 4YHZL 4JDZB 1S7RA 1EHNA 3KYKL 3GRWH 5DD0H 3RAJL 1AR1C 3G9VA 4GLRI 3BEWB 4M7ZB 2DQUL 1IC4H 1AY1L 2FCBA 4WUUA 1NJ9B 5AAMA 1IQDA 1NLDH 3SGKA 3T8XB 1RZ7L 3UYPA 2R0ZH 5HJ3B 1YYLL 4TUKH 2XKNB 1JPSL 3C9NA 1MHCA 4D9RD 5E1AB 4WI4A 3DX8B 4RIRA 4G6AD 3NFSH 5J1SC 3MV8A 3QFJA 2OTWA 3N06B 3BIBX 3EOAB 3QXWA 1S5HA 1JNLL 1W0YT 4KHXL 3A67H 3O3BB 3FT4A 4JPVH 1HI6B 4PJCA 2VB5A 3ZE2F 3MRBA 1R3KB 4OTXH 3RY5A 4LLUA 4O5LH 1CFTA 3L3KA 1LILA 5GISL 3V79C 2ED9A 2V7NB 1R3JA 4OB5L 5HHOB 4ODUA 3NCYP 3PUCA 4JCLA 3VDCA 3ARDB 4S1RH 2OZ4L 3GIVA 5LAXA 1JZ3A 1IAII 2V5TA 1JGDB 4ZTOH 3OQ3B 3GSNB 1H8OA 3BT2H 3NCFB 4HXBH 4PR5A 3BXNA 1YEKL 1FJ1A 5CEXA 1UKSA 1DVFD 4QRRA 3B2VH 1E0OB 4OI7A 3KHQA 4YHYB 4XCNB 1T7ZA 4M43L 1PQZA 2KZ1B 3QUXB 1YMMA 3DV6B 4NKIH 4JZNB 2J5LB 3TYFB 4YO0A 3NZHL 1ONQA 3Q1SH 3EO1B 5KZCD 3BDYL 1JV5A 5I74C 4ZOAA 1OF2A 3BPLB 3WNMA 3VRJA 4UTAH 3WLBA 2JIXD 1XZ0B 4Y5VB 4NP4H 1CXIA 3UTZA 1MJ8H 5HPMB 2MFNA 5L6YL 2NY0B 3Q6FA 4LPVA 3WLWD 2QSCH 1BEYH 32C2A 5F9JB 4P2QD 3STLA 1CXLA 1QVOB 1TJHL 4LHUB 2DMCA 1G7MA 5D1XA 1E4KA 3BEVA 3QRFM 1CD8A 3LRGA 2Q86B 1I8MB 1YEHL 1FN4B 1DDHA 5CHNA 3TBTA 4ZS7H 2UZXB 3ROLA 4MLSA 2YRPA 1NGQH 2F74B 3TZVC 2B5IC 1X5FA 4HWBA 2E7LA 2F54E 5CJXC 1J8HA 4AIZB 1S3KH 3D5OF 4PJGA 1GGIL 2WUCH 3F5WA 5DD5L 4KJPC 1DN0A 4JG0H 4LU5H 4N5ED 3VXMA 5B8CA 1MY7A 2NYYC 3U0WH 2EIZA 1NGXB 2C3WA 1MCQA 4AIXA 4I4WB 3EBAA 1T7VA 4U3CA 3QNYA 2ITDA 5GHWL 3IS1X 4X6FA 1HKLH 4EI5B 1LP9B 5F7UA 5HI4D 2CKBL 3TC9A 5C09D 3VD9A 4IIQA 5GRWA 3SGJA 2R0LH 1R3JB 5F7WC 1YEEH 4ZMAT 3WUWB 3VI3E 4G42B 1QR1B 3WFDL 1VADA 4YXKL 4JZOB 3EYUL 5L2KA 4X7SH 2HVJA 2R56L 4L4VD 4MJ2A 5DJZB 3RNQA 4NQEB 4ZQKA 5D6DA 1FZMA 5JTWA 3UX9B 3U7WL 5EUOF 3LZFH 2AGJH 4V2BA 4ERSL 5J3HC 4DW2L 4NC1E 3JTTB 4XPTL 3HNVL 1CGWA 4DVBA 4MXWL 5HYSB 3U48A 1QO3B 3E0GA 4XCYA 4Y4FC 3CSBA 1I9RH 4O9HL 5F93C 1FYTE 1RFDL 2HMID 2A6IB 1JV5B 1LO2H 5EIQA 2C1PB 5C9KA 5EU3A 3INUL 4BH8B 3NIGE 3H6JA 2VXUL 2IGFL 3TWCH 4DGIL 1UYWH 4F80A 3BOVA 2H3NA 1NCDH 5HGDA 1C5DA 3O2VH 5IW3A 5HI5C 32C2B 2ZG1A 4ZYKB 4NRZA 4XNZB 5ILTH 3H8NA 3HMXA 1RZJH 3O2DL 1I4FB 4KJWC 5ADPH 5C0BA 4YHYC 5D8JH 8FABB 1I9IL 2GSIB 3NMEA 4HK0B 2Q1EA 1FYHB 4JDVB 2J5LC 3FT2B 4JFZL 4WWID 1JNHA 5CJOL 1JWSA 3VFOA 3QUYA 1ITBB 1J8HB 4X6CE 3RX8A 2NTFA 1NDGB 4NN5B 3SPVA 4H1LB 1VGKB 2FECL 1KT2A 1CZ8H 2CDGB 3DV4A 4EN3D 5JNYA 2EIZB 1LK3H 4Y5VC 4WHYH 1ZKAA 2B1AL 3BKJL 3AFLA 3G6DL 2YUVA 5D7SL 3TCLB 5GZOD 5I8CA 4P2CG 2MNUA 3AM8C 1XGRB 4HAGA 2HJFB 4HHAA 1SYSB 1J0HA 3RX5A 5HXMA 5MERA 1X5YA 3P0YH 1YEIH 3LKPB 3CXHK 2OL3H 2CLZA 4QYOA 1UXSB 4WCYH 4LCCA 1BFOB 3B9AA 2HFEB 5TH2B 3HC4L 1SJEB 3H9SD 2FO4A 2LVCA 1A6ZB 3ARUA 12E8H 2BSTB 3ULUH 1KOAA 5DEFA 4ZXBC 3UTOA 5DO2D 1RZJC 4KC3B 4EDWH 1TNNA 2CIIB 2B1HL 3O0RH 4JFFA 5IB3A 4UNVA 5CZVL 1M4KA 4RFNC 1N4XL 1DZBA 1UQSA 2R1WB 1BIIA 4HX1B 4LBEA 4WU5B 4F7EB 2IQAB 4HS6B 3CLEL 3GSQB 3AXLB 1W2KT 5FYKL 1KPRB 2XZCL 2AJSH 3LPGA 4HT1H 4EQ2A 3RZCD 1U8NA 3HMWL 3WFEL 2VZUA 3UYRL 4BQ8A 4G8IA 1CGVA 1JGLH 2GHWB 3T2QA 5K93A 4ELMF 4LCWA 3QO0B 5KW9H 2LV4A 2QQLL 3KVQA 5I71B 1I1FB 1A7PH 1KLGB 1X3DA 4YHPB 2JK5A 4JO4L 2KBGA 4EQ3A 4EOWH 4YHKL 4HUUB 3DSNA 3J8F7 2ORBH 4NRZB 3ULUC 1IGTA 2AXFA 5GS2H 3VWJD 1U92A 4PJHE 2J6EH 3MLVL 3WIIL 3REWB 5T33L 3VFRA 1Z9MA 2ZSWB 2DMBA 3QEHB 1QSVA 3NCJH 3MLWH 4MJ4A 2P5WA 3BKCL 3V4VH 3D25A 4NNXB 5JQ6H 2DLTA 5DUML 2IPTL 4WDIA 4XXCA 1N6VA 2FEEI 1U8JB 3W0WD 1UZ6E 3KPMA 4UQ2B 3RHWK 1FE8H 4OZFB 4Z9KB 3T1FB 1J1XL 1BOYA 1VFUA 5BVJA 2JCCF 3KYKH 3HPLB 4FQQA 4KZDH 1P7QD 3RAJH 4MJID 3QPQC 1P5VA 1J05A 2DQUH 4XHJD 5FK9B 1AY1H 4GRLC 2QR0B 3VH8G 2WIIB 5FA4B 2HFTA 5M94B 5IW6B 3U83A 1ACZA 4KRNA 1RZ7H 3FQUB 4HMDA 3T4YA 5J1AB 4L8CA 3SDAD 5JOEA 5E6IB 4ZAKB 3ALWA 1NC4A 2R8SL 1PSKL 4XAKD 1HHHB 1JPSH 4NN5C 1YECL 4YUEL 1WBXA 1QQDB 3QDJA 2YRLA 4P4KC 2PN5A 4FTVE 3IYLW 5LGJA 1F11A 1P2CA 1JNLH 4H0HB 2Z93A 5AG9A 2HFFA 3NACH 5FGBA 1IQWH 1T1WB 4J8RA 4UBDD 4JVWA 2Z35A 1V05A 1IBGL 1KJVA 4TQEL 2F54B 1R3HB 4OB5H 3GMLB 3DIFB 5KOVC 3SKMB 4P5TA 3ZE1F 3WCYA 2JELL 2OZ4H 5CEZL 4ODXB 1CK0L 2ZCLL 3UTQA 1BWWA 3O6FA 1MFEL 3BPCA 4R4FL 2C4XA 2P4AB 3IFPA 5C0AD 6FABL 4JANA 1S7XB 3T77B 2VDPL 5E9DE 4HH9A 4QHKI 3IXTA 4JM2F 1NCCH 1ZHKB 1IAIM 3CLFL 4KY1H 3V5KB 2NZIA 2P5WB 2MPAL 2WWMD 2X05A 3MZGB 3LEXA 2VUOA 4C56D 3NZHH 4IOIA 4D0DA 4KI5E 2Z92A 3D39A 4X7FC 4J6RL 3OV6A 2H26B 4HUXA 1JZ7A 1HZHL 2XTLA 3RTQD 3GJFA 4NHUB 5T1KB 2GKIA 4NYLB 3ZDYE 4LLYA 5L6YH 1L7TL 5IFJA 4XH2A 2CSPA 4LVEA 4HEME 3T0EA 1TJHH 3MGTB 1BREA 4PBXA 1NFDE 1SEBA 1J05B 4DCQA 1D5IL 1ZVSA 5FO8B 2QV2A 1SMOA 4B53A 3QFDB 5IQ9B 1FYTB 2CRMA 4BUHA 3CX5J 3IAQA 2EDLA 4RFEA 1CIDA 1NUGA 4ONGL 4LLDB 5DGQA 4J3OC 4MQXC 4IRSC 4XVUD 1EUUA 4Y2DB 4P46A 5IW1A 2NY5L 5ICXB 4N9GA 2D0GA 5DJ0A 1P2CB 4R3SA 2V7HA 3O81A 1HILA 3I9GL 4QOKE 4BSVA 4U3HA 5GHWH 1MJ7L 1WBZA 2CKBH 1BGXL 3VA2C 5DMYA 3PXJA 1WCQA 3BQUD 3H2WA 4XTRC 2MCG1 5CJBA 4YX2L 3WDJA 4X6CB 4P5TB 4P3DA 5CP3A 3S5LA 1EFXB 4YXKH 5A2FA 1NCAL 5HD8C 1CDCA 1IEAB 1MAJA 5E6IC 3AAZB 1JF5A 1LE5A 4ZAKC 2R56H 1IE5A 3CMOL 3PQYD 2CGRL 2YZ1A 3CUPA 1HHGB 4X6DF 2QHRL 3IFPB 4ENEC 1ES0A 4JANB 4F7TA 3OKOB 1NAMB 4KRMB 4NUGL 1OGAD 3U7WH 4R96A 5JO5A 4DZBA 2C26A 1HHIA 1LO3L 4ERSH 1F6AA 4DVRL 4GKNA 1QSEE 4XPTH 3QI9C 2DB8A 3HNVH 3VXPB 4JN1L 2WSKA 4JFEE 3W9EB 4OZHE 3N0PB 4ODTH 1ZGLM 2YD9A 3BJLA 4MXWH 4PJXE 5HHXL 3R0MA 2EDQA 4C59B 1GGYA 2BNQA 4U6HA 3MV9D 4NUJA 3INUH 3B9EA 2WV3A 1XEDA 2IGFH 3C6LB 5DRWA 4DGIH 3RL2B 4K94H 3AREA 1JL8A 3EHBD 4ZO7A 1JWMA 3QIWC 2BP3A 4GG8B 1T6WA 2SEBB 2ZG3A 2D0HA 5D5MA 3HLAA 5E2JA 4Z0XB 2VLJD 1BHGA 1NGYA 1BBJA 4LLQA 3O2DH 3VCLB 2H45A 3T08A 5DJYB 1I9IH 4XI5D 5IHLB 3JV0A 5A2LH 4JFZH 2LQRA 5CJOH 2P24A 1C16B 4WWKA 3PL6B 4QTIL 1MQKL 2VQUA 3GSRA 3GK8H 3LN4A 5K9QG 2WP3O 3QXVA 4QHUA 1KCUL 5SWZA 3CFDA 4QF1B 3C8HA 5IB5B 3VFWA 1RHHB 1TCRB 3BKJH 2B1AH 2M1KA 3VFMB 1C12B 3V5DB 4Y5XB 1UENA 4PJHB 1AQDA 4LQ1A 5DHVB 2RCSL 4U6YB 4CN4A 1KCSL 1WBZB 1FHGA 3OX8B 1Q0YH 1ZS8A 5C2BL 4JFDA 4MNQD 3OKMB 3HC4H 2A83A 1G7PA 4L3EE 5AD0A 3RWHA 1LNUA 2P5EA 2W60A 5E5RB 3ARFB 4ZODA 3NABL 4U1GB 3CUPB 4GMSL 1PZ5A 3O11A 3B5GA 3QDGA 3V6ZA 3VA6A 1N4XH 1EEYB 4AM0B 3RGVB 4CVWA 4JAMA 4OCNC 3CLEH 4G6MH 1EEZB 1NGPL 5FYKH 2XZCH 4HIEB 1NFDA 4JGMA 2CUMA 3UYRH 3ZKXC 3TLRA 3QH3B 3O9WD 4JREB 3RUGE 4ZNEA 4I3RH 1B4JL 2G2RB 2XN9E 5E00A 2ESVE 1PYWA 4L8BA 4PJDF 1WT5A 1TMCB 25C8L 4KXZH 1IM3A 3HE6B 3ULVE 1L0QA 5IVXF 1BOGB 4OLUH 4PGEA 2QQLH 3OR6B 2VISA 3V0VA 4TUJA 3V6OC 2RAMA 4FTVB 5EIIA 1CDIA 3PG2A 2B39A 4I18C 4JO4H 4YHKH 4P2RD 2Z4QB 1HYRC 3KDMB 4JHAL 3VGBA 3V0WL 1NGYB 3ET9F 3SDDD 5C8JA 2W0FA 3KLSA 1D5XA 3MLVH 1S7UB 5ID0B 3FL7A 4UV7L 3HFMH 3QQ4A 2DN7A 3PGDB 5DUMH 1R5WA 4WU7B 3EJYD 4M5YL 3QHZL 1I8IA 3C60D 5EU4A 5E9DB 5EU7E 3PDGA 4L4TE 4MVBC 5KS9E 2EIDA 3THML 2YUZA 5JW5A 1XCQB 4W6YB 5IBTH 4LAJH 1J1XH 1ORQA 3HAEH 4KVNL 1CE6B 2JLLA 5HI3D 2HT2C 4K8RH 1P7HL 1N0XL 3MCKA 3MO1A 2BERA 4KU1A 1YMHB 4KKAD 4KTYA 4Q9BA 1QRNA 3QAZB 1DUZA 5DMKB 3ARXA 2G60L 3GMPA 2R8SH 5EO9B 4YUEH 4QRQA 2Q8BL 3L9RB 2OCFD 5CBEB 3QJFA 3FO0H 4MB5A 4FMKA 4QXUL 4N0CC 4Y5XC 4OCMC 5E8PA 4PP1D 5I2IB 3K4ZA 1NFDB 1K6QH 3FFCA 4KAQL 1QLRA 1NBYB 2K7QA 4R2GB 4RGNE 4PV9A 2GEEA 1P84K 2PYFA 1IBGH 4TQEH 5E00B 4S1DC 2BCKB 4WY7L 1NUFA 1R6VA 1VESA 4AEHL 1JRHH 2DOCA 4U2ZA 4NNYB 1H9VA 2NPLX 1O5DT 2JELH 5CEZH 1U8LB 4X7TA 2ZCLH 2X70A 2VZSA 1RZGB 1XF3B 3SEPA 5LGKA 5J6HA 4K8RC 1AP2B 5F7DA 3VH8B 1TQBC 4R4FH 1X5JA 4IMKC 4H0IA 4YDKL 1A3LL 3LD8C 4EI6A 6FABH 3V8OA 5FDWA 4QOKB 2YBRB 3FQWA 4OQTL 4FQJL 4AZ8A 4KV5F 3FO1A 3MX0A 5E56A 1U3JA 4DK3A 2W92A 3B43A 3WS6C 3U0TA 3CLFH 4JRXA 1FFNB 3I3BA 2A38A 5JA9A 1GSMA 3P9LA 3T4AA 5ISZD 3NGBC 1MRCH 1GXEA 4K3HA 3SO3B 2A6KA 3L3DB 1MSPA 4J6RH 4FQXA 1MFCH 1PGRB 4NHCL 2D7TH 2DBJA 3W39B 3ARGA 1OHQA 3VGAC 1I85C 2AJZA 2P7TA 5K9JL 4NM8L 4P9HL 4CN6A 3IDXL 1MI5D 4CRPA 1OAZL 3MRQB 1OAYH 1L7TH 5EIVA 3WFHA 1U95B 4G8GE 4D9QD 1G9MH 1S7VA 4MAYA 2HFGL 4JY6A 1QSEB 1WICA 4L9LA 1TVBA 3FQRA 2BSSA 1Q72L 4JFEB 4JN2B 2APVA 4OZHB 4MA7L 4V1DA 4GO6B 4OZIA 1INDL 4MAUH 4PJXB 5JMRA 3QEQE 4K7PY 2KPNA 3E6HB 4WHCA 5KVFL 2NQCA 2X2YA 4KROD 4Y19A 4X80H 5F88A 4APQA 3O4OB 2I9TA 3TO4C 1N64L 4A6YA 2YD6A 1JZ2A 4GAYA 1MJUH 4OCLC 1NDMA 1I3RB 1YN7A 4P2QE 2IH1B 2NY1D 5K9KA 3BN3B 4F7PA 3X12A 1FZKA 2P46B 5FYLD 2BVQA 2DQEL 3WDHA 5JQHC 5I16B 4HUKB 3I9GH 3LN5A 4Q9QL 1J0IA 5ID1A 1CD0A 4XRCB 4MXQD 1ZTXH 1MLBB 5HDBE 1BGXH 1OT1A 3OKKA 2CMRH 3L5WB 4ZFZA 4ELKA 5E94B 3MCG1 4HC1L 4YX2H 3EOBA 4PJFF 1LQSR 2VLLB 3BGMA 4WW2A 2NY4C 1F90L 4JZJA 1G9MC 1NCAH 3WD5L 1TZGL 2FLBT 2X70B 1ERNA 2C5DC 4G5ZL 3CMOH 1RAMA 5FB8B 3QXAA 2VRAA 1Q0XL 2QHRH 2OM5A 4L4TA 3NBNA 3WIHA 4EI6B 3V6BR 1KJMA 5FDWB 2MCPL 5CD3B 4PRHD 2C4FU 5DJDB 1X5XA 4JFXB 3TA3D 1R3LB 1HCFX 4GUPA 4UUJA 1LO3H 1NL0H 4MX7A 3MNVA 4U6VL 3FQNA 3VRLE 2EXYC 4E41D 4PGDB 4QCIA 2AP2A 3HR6A 2R1XB 4QGYA 1IAKB 1D3CA 2NY5C 3O6LH 3I50H 5D1QD 2EYTB 4L3EB 3UTPD 5HHXH 1AC6A 4L4VE 2NW2B 4FQCL 3JUZA 1BZ7B 2H2PD 4DKFL 2EDRA 4DGYL 1Q8MA 4OI9A 2NLJB 3BZDA 4YGVB 3MRLB 2NY3C 3MUJA 4QRPA 3BRGC 5LQBL 4JFHD 4PB0L 2C7UB 3WFHB 1JYNA 1SMAA 1N3NA 3BPNB 1A1NA 4P2YA 3RUGB 3WKML 4Y16B 2PYED 2XN9B 4X7EC 2QADC 1N5AB 1GGTA 2ESVB 1XGYL 1EDQA 1FV1B 3QHTC 4JB9L 3NZ8A 1S9KC 5JLZB 4Y5YC 2VR5A 4PJ7A 1MQKH 2G9HB 1E28A 3SY0A 5CD5D 4OD2B 2NX5D 4GKZA 1FQ9C 3GMMA 1U2CA 1KCUH 1CXEA 3CCHB 3D2UA 1EHAA 4BZ1L 5ICZB 1YN7B 2IAMC 3A6CL 2N7AA 4ZUVA 2VXVL 2LTQC 4JG1L 1H5BC 2Y36L 2R69L 2G75A 2BHYA 1U0QA 5I76A 4GW1A 4ZFZB 3ARWA 3OG4B 3DVNA 4L3CB 3Q5OA 4HCRL 4NN7B 2Z31D 3NIDE 4S0TD 4NSKB 4ZPTA 2HRLA 2DLFH 1MUJB 3SDXF 2C4FT 5EBLA 4AL8L 3TF7C 1NCWL 1DL7L 2DQCH 3MRKA 4U05A 3MJ6A 2CJUL 3G6JE 1N59B 3I75B 3X13B 4GMSH 3E3QE 3QDHA 4L4TB 1BQUA 5DQ9B 5KS9B 1DVFA 3PWVA 5I1AA 3IT8D 3MNZB 3LEYL 4AT6B 4OUUB 4POYA 4QY8A 1OSZB 2XY2A 4LVOB 2FSEA 3HZYB 1E4XL 5ALBL 4MX7B 3TBSA 1PY4A 4BUGA 3R0NA 5D4QA 2BMKA 3O3AB 4GSDL 5JHDD 1H8NA 1UCBL 5IG7A 3HE7C 1T1ZA 1B4JH 4X99B 3DX7A 4YHNA 2VXQH 1ZAGA 1G7HA 3FOMA 2JIXA 25C8H 1CR9L 3D3VE 1UEYA 4KKBC 2GFBA 3HS0B 4L8DA 3K4AA 1ACYL 3ZHDA 3KXFD 1QPXA 1ZT7A 1QNZL 5DJ8A 1S5IL 3AU1B 4Z78B 5C07A 4YHML 1N5YL 5JMOC 1NGZB 3JZ7A 1N3NB 3L3GB 4JHAH 5E99L 3V0WH 4RGNB 3NPZB 2Y7QA 5IF0A 1IGMH 1YN6B 5F44A 2PXYB 1H3WM 4UV7H 3IDJA 4NO2A 2P49B 4RNRA 4WJ5B 3DO7A