5JYLA

Human p-cadherin mec1 with scfv tsp7 bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
VAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Cadherin-3
publication title Disruption of cell adhesion by an antibody targeting the cell-adhesive intermediate (X-dimer) of human P-cadherin
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5jylA00
1L3WA 1NCHA 4AK1A 4ZI8A 3FF8A 5JYLA 4ZMQA 3LNDA 4ZMTA 3K6IA 3LNFA 3UBGA 2O72A 2OMUB 4AQEA 4ZMPA 4NUPA 4ZMNA 3Q2WA 2OMWB 3Q2NA 4APXA 4ZT1A 3K6FA 2OMYB 1ZXKA 3K5SA 2WBXA 4ZMOA 5CZRA 3MVSA 3K6DA 4ZMXA 2QVFB 4ZMVA 2V37A 4OY9A 4AQEB 2OMZB 2EE0A 3LNEA 2YSTA 4APXB 4AQAA 4AQ8C 2WHVA 3K5RA 3FF7A 4AXWA 1SUHA 4XXWC 2WCPA 4ZMYA 1NCJA 3Q2VA 4ZMLA 4AQ8A 2OMTB 1EDHA 5CO1A 3UBFA 3Q2LA 4AQAB 4NUQA 1FF5A 5KJ4A 1ZVNA 2X2UA 4AXWB 5JYMA 1O6SB 2QVIA 5DZVA 4ZMWA 2WD0A 2YQGA 4ZMZA 1NCIA 4XXWA 3LNIA 2A4CA 1WYJA 4NUMA 4ZTEA 4QD2E 2OMVB 2OMXB 1OP4A 3LNGA 2A4EA 4NQQA 3LNHA 1NCGA 1Q1PA 1WUZA 3QRBA 3UBHA 3PPEA
chains in the Genus database with same CATH superfamily
4PJ5B 4EUPH 4QKXB 1O7SA 5IW3A 1BIIA 5DDHA 3WLWD 4G8GE 1UJ3A 3KJ6H 5ITBL 3CFQA 5G4MA 1XF2A 4JQVC 1MCNA 4AZ8B 1SXNA 4ZPTB 3TTSA 3CSYB 5KBNC 3BZ5A 4UQ3B 1SVZA 3RU8H 3O6ML 3QZWG 5LCVH 3DX6B 4JQVA 5HXMA 2VDKL 4ONFH 5EZLA 2X1XR 1BZOA 2ICES 4N85A 4L37A 2AP2A 4A2FA 4DO4A 3P4OA 4EDXA 4NNYA 1Q9OB 3QJRB 2OMYB 1ORQB 4YXLH 3X13A 4XVSH 4PGCA 4NZFA 4PI2A 4WDIA 3KHOA 4DT2A 2G4EA 3IDXL 3EZJB 3MRCB 3FUMA 5T5NF 1Z3GL 3OKMA 4ELDA 3BPCB 4MA7L 1IGYB 1UB6A 4M3HA 2ZWSA 4PWHA 2CBPA 4WEUD 1A6VH 1UCBL 3L3OC 4FYTA 3WNOA 3ARQA 1IBHA 5SX5K 5C2UB 2ZX5A 2WXKA 4N2AA 2X88A 1FVCA 5D7JB 4ONGH 2FUTA 4JO1H 4JQIL 2G3MA 4WIQA 3BDXA 2WYIA 2HJLA 3L3OA 3GRBA 1JUFB 3GF8A 1CT8A 3IRZA 3TU6A 3I3EA 5KUKA 1SHXA 4P57A 5I1KH 2AK1L 2MHAA 4P2QA 4C4KT 5AL8A 4R2GC 4LOFA 3D85A 1UUNA 2C34A 3QEGL 1F58L 4ZNCD 3FTZA 5DGRA 1F97A 1NCCH 1TJIH 3H9SD 3JVGC 3SE4C 3X14B 5F0PB 1I9IL 2YFOA 3CK0H 1GMEA 2MNUA 5JMRA 2BVUA 4ZPVB 1E7VA 1GJWA 2VZUA 4MCMA 3ES6B 4IDJH 5TFSL 3TTYA 5GIRA 1UFGA 4N2KA 1WD8A 1M57B 1QLFA 1Q1JH 2PWGA 2FCBA 2VR7A 2ZD0A 3NFSL 3DVGA 4P9HC 3R4DA 1P7QB 2YGNA 2GHZA 1KIUA 3TA4D 2D3JA 1DBJH 2VLJE 1JZDC 3STBA 2QLYA 1OCCB 3VXUA 2YPKA 4K3HA 4J3BA 5BS0D 3IFNH 4LPTA 3WHE1 1U8JB 3NJXA 4XN8A 3MNVA 1TZIB 4G8EB 3ML9A 4IMKC 1MQKL 2BXZA 2V9RA 4PR5A 5CP3H 2FK9A 3SDAA 5FR3A 4XO5A 2NYYD 5M7QA 4S1SL 2VLRE 3FPYA 2FDBP 3C75A 4K3JH 5E94B 4EKJA 3GMQB 4IMKA 5FA3B 2H2PC 4YSAA 4BFKA 1XF3B 1SQMA 1R6VA 1HYSD 4KY1H 3M8OL 4G43B 4OCWL 1IC7L 2WZ5A 2JJWA 3H54A 4FQLH 3VSTA 4A1RA 5CFHA 1FC1A 4R4BA 5LNEA 4ZXBB 2DTML 4ZD3L 3AREC 1XEUA 3IGAA 4KUCF 4PJ7E 3D1MC 1MKFA 3BO8B 5GXBB 4X6DA 5KVDE 3QQNA 2VE6B 4QJ3B 3AREA 5AW3B 4IKIA 1XGRB 4MXVE 4V1DE 5K33A 3CZNA 3QIBD 1WBXA 2OMZA 3L5JA 3S3DB 5F7YC 2DQTH 3O3AB 1JHKL 3LKPA 2Y23A 4HK3J 3PY9A 5CP7A 1BECA 1QRNB 5HD8D 5L8KB 1IM3D 2CGRL 3BN3B 3PRZA 1I1AD 4WENB 1BZ7A 3WFHB 2JB5H 1GZPA 3BUYB 2FTAA 2X3BA 3KPOB 5CN1A 3H7BA 4IBZA 5F88B 4JFEE 1LP9E 4N2LA 5AKSA 1RU9H 3P9LA 3K8MA 1C7SA 5I24A 4MJ6A 3T1FA 2YMXL 3V0AC 5A2IH 5KSAB 5EULV 2BSTA 2WUCL 1AANA 3CZSA 4L29B 4UV4L 2A0LD 1JV5A 4J2QA 3RKDD 3DGGA 3NCJL 5DT1L 4D0BA 5DEGA 4WSJA 5HGHB 1T2QH 4KDTA 4KKBC 2BP0B 4XN5A 4G6JH 1XSJA 4OD2B 4AQAA 1MHPH 2F54A 3HBGA 4WNSA 4LRNH 4FQXB 5D5ME 4K9EL 1XIWC 3ALWA 4X7SL 4N68A 1ED3A 3W11D 5LKNA 2IBBA 3PHQA 4JPQA 4TUKH 4LSVL 2BSED 4NBYB 4PMEA 1N26A 4FLOA 3QJFB 4CU6A 3K7UA 4X4KA 3L48A 2PXYC 2XFXB 2WQAA 4MNHB 1DE4B 4JFQA 5C71A 1NBVH 3H3KA 3QHFL 3ULSB 4XNYH 2QQQA 2CQVA 5B3JE 2D7QA 2XJKA 5GGSY 3GHEL 3NDZE 2PXYA 4CVUA 3SO3B 5D8JH 1SDDA 5EEXA 1MCDA 2P80A 2D03H 4WV1A 2C9SA 3MNMA 5HVHC 1G9NC 5M95B 4L4VE 5HDOA 2OKMA 4JM4H 3H53A 4QF1B 3FAWA 1GGBH 1TO5A 4L8BB 5BJTA 1WCBA 1FVDB 1T1XB 4XNZB 2ZYSA 2J8UF 5EZPA 3UP1A 1RZJL 3Q8AA 4KH9A 3WUWB 1ZVSA 1FFOB 3LPOA 3MGTB 4OZ4B 5DI8A 2QSQA 3L4CA 3W2DL 1QX1A 1UZ6E 4MJIB 5C08E 5JXEC 1AJ7H 3DSNA 4XPHL 5C6WH 5KBMA 2A9AA 4Q6YA 3X11B 2Z7UA 4R83A 2OSWA 3KYMA 3LZQA 4JFPA 2LOEA 3IB4A 1ZA3B 2ROYA 5IOPB 3QQ3B 4IOSA 5JXEA 3O9WD 4GSRA 4JM2F 3UL4A 3VI4A 4MRBA 4PLKD 5KVDH 3OR7B 3OMAB 3LTVA 3B9KD 4WTXA 1AO7E 3MCYA 4U1IA 4Y5YB 1I8IB 3CH8A 1EXUB 3ZMEA 4ONHB 1TKWB 1UC6A 3BHBA 1AGBB 5FYLD 5IHUL 4XMPH 2EYSB 3DETC 5DTFA 3AQDA 5F7FA 4X5QA 1L9OA 1VGEL 2OJEB 3D8MA 2ICWA 5EZIH 2PKDA 3PGCB 1GZQB 2EIBA 4ZQKA 3T3PE 3VX1A 2JKRM 1OWRM 3APCA 2H9GA 2JV6A 1A4KA 3ZDYF 2VR4A 4NO0B 3GYRA 3TBCA 4FE9A 2HUEA 1F13A 1F1GA 1EQWA 1YEIL 3PHOA 3ROLA 3DPBA 3RX7A 2ZCZA 3FFCD 4IOIB 2OYLA 5I15L 4YDNA 3RVXC 2BIHA 3IKKA 5HI5C 2K0RA 3WJMB 5IGXL 4LHQB 3H55A 3HE7D 3STLB 4HBQA 4JG0H 1LEGA 4NX0A 2R83A 4H1LH 1Q4NX 1VGKB 1QBLH 2H8PB 1P9MC 4UDUA 4P5KA 2XQBL 1WFTA 3RWFB 4R3SB 5H2BA 2VDMB 3BZEB 4N2OA 3LQAL 4OLZH 1VRSA 4Y16C 2OTPA 5I6LA 3GHPA 3Q2VA 3A67L 4Q9CA 1P9MA 4HWNA 1G9ML 4N0UE 2AZUA 4G72B 4U1SB 3VI3E 4N2CA 1FIGH 4KO7A 4CSSA 4Y16A 3W5NA 2N1TE 3N1QC 1OCOB 1JD9A 2B14A 4G42A 4AYSA 1CGWA 1X5GA 1H19A 4M6OH 4WKXA 3VWKC 4ETQA 4CMMB 4DKAA 4DO6A 1NCWL 3E1ZA 4R26H 3BZDA 4N0CC 3RHWF 3MJGX 1YNTF 1NCDL 3KVDD 1S8DA 3GMMB 2ZG1A 3MSPA 4KQ4H 3TX4A 1L6XA 1A6WL 1AS7A 1RUPL 2WD0A 4M8QB 5GRUH 1YEHL 1ZWIA 4ANUA 4MWFA 2H26A 4XCNB 5DMKA 2BWIA 2E4TA 1IQDB 4JMXA 4P3CL 4IGBB 1WFJA 2VDNB 5JUEH 5F7NC 1BXUA 1YEJL 2HPOA 5E5RB 1MLCB 1L7IL 2R8SL 5AOKA 5FUCC 3CFEA 1BQKA 3X12B 3D4YA 4KXZH 1A6ZA 1QZ1A 3TJHC 3WMPA 2ICEB 4Z7NF 1YJDC 5EA0H 5HJGA 2GCYB 4WUUA 5EF2A 1GZHC 4HUWB 3U30B 3CVIH 2V2WB 3V5DB 3OC5A 4NO5A 4XP9L 4MDIB 3D3VA 3GTVA 5ISZB 4W4NA 1M1XB 1WQVT 3U9PL 1IC5L 5D7LD 4OFYD 4AH2A 2YPLE 1DP0A 1K85A 3KJ4C 4HA1A 2IAND 2PPDA 1ZT7B 1F4WL 1GZHA 5C0BD 4YGVA 2UX7A 3QUGA 5FM4A 2HTLC 2JQMA 2MKWA 5KOVC 3WE6B 3EBHA 5F7KC 1KIPB 3QDMD 4NQCA 1S7SB 1Y6KR 1OAXL 4Z3JA 1T3FA 3GSXA 2QQKH 3IU4H 4MCNA 1BFVL 4XNUH 2OL3A 4B9KC 1FZJA 4PJCA 5DK2B 1P7KA 4PJIA 4N8CH 1J0IA 5IY5B 3MJ9H 2XQYK 3D30A 3MV9D 4C56B 3QUZC 2ILLA 3TZVB 3E8VA 1A64A 2J73A 2NY1D 3KWWB 5E8NB 3IMTA 2CHXA 3X1GA 2I07A 4YSQA 4FNTA 1K8DB 4HCRH 1X4XA 2VXSL 1UASA 2Z3FA 4W9IC 3QUZA 4PSRA 4JDZA 8CGTA 1PG7L 4O2FB 2XV2A 1MJ7H 1CQKA 1CD0A 1UD2A 3L13A 1E5UI 2F7PA 4WQOA 5AOMA 2GTZA 1JNHB 2BMKA 4G5ZL 2AGJH 4X0NA 1YEFH 4QDGA 4I8DA 2WXFA 1KWGA 3DV4B 3MBED 2RGSA 3MV7A 4L3CB 2ERJC 2EVFA 2ADIA 3EHBD 5B22A 5IQOA 4NZ8A 3DK0A 1IGTB 5JHDB 2BVEA 3DRTB 1DFBL 3HMWL 2J72A 2AAAA 5LBSA 3VXNB 1NC4A 3CVHL 1BM3H 3Q48A 3QQ9D 1FH5H 4B95C 1XGQA 3LCYA 4MZRA 4UZGA 1UD3A 4RFNC 1AHWC 4LQ1A 4QHPA 5DZOA 2ZUSA 4HIIB 3V6ZA 1BVOA 3ORJA 2W38A 3VD4A 3U2JA 4BSVA 5K9KB 4XXCC 4U3SB 3CQQA 3WGUB 4FL4B 3WY3A 2AKRA 3VNZA 2IIJA 5SWZD 5MEOB 2BM3A 4X6DE 1QTPA 3BP7B 3C9NB 1QBML 3GMNB 5TK2A 3Q7JA 4QRPA 1A3ZA 1M7DA 5FHAH 4HZ1A 2AJZA 1RP8A 1JN6B 3QPKA 1ADQL 3P77A 1F6AA 2EDQA 1OCWH 3LNHA 2GI7A 1HXMA 1LL1A 2RTTA 1PLAA 4KHTL 5EU6A 5EOQH 1KB3A 3T04D 3T0EB 4O02B 3X3FH 4PRPD 2OMBA 5HYJD 4AV0A 1YECL 5D7IF 5BV7H 3LKQB 3O3BA 2EYRA 4N5ED 4MMYA 2AQ2A 4JDVB 1TVBA 5KSUA 4KTGA 1U8IB 1MWAL 4ZFGH 5FYJU 2XXCB 4Z8FH 1I9EA 2XLLA 5IW6B 5B4MD 3KPPA 2P5WB 5T1JA 4PWKA 4WHYG 3T4YB 4OFPA 3BSZA 4POYA 1MCPL 3N44B 4DQOH 1NUGA 4O5LL 5I18L 1Q38A 2WGNB 4I3GA 4F8TA 2H0JA 1EO7A 1PZ5B 2XUWA 3GJEA 3J07A 2VM9A 5DA4A 4WNQB 5CEXA 5IFJB 4PY7B 5LVEA 1MQ8A 3HG1A 5D72H 3B37A 2B08A 5FF6A 3WOVA 1ZGLB 3T2PA 3V4PL 1IU1A 2BP8B 5LGYA 3L95B 3VRLE 1UWEL 2E59A 1G7JB 3O2DH 4JRYB 2IWEA 3UEQA 5KJ7E 5FW6A 5D6DC 4HT1H 1WG3A 1S9XB 4G9DB 4HV8B 4RX4A 2B1HL 4A6YB 1KJ2H 4WJG3 1OAQL 2GK0B 1NOFA 4TNFA 5IVZA 4W9KC 5F9OH 1HINH 3FQYA 1R24A 3BT2L 1BOGB 5D6DA 4GRLC 3E7JA 4ATTA 2IOMA 2OZ4L 3TVMC 4EOWL 4D0DB 4MAUL 1IZKA 3EF4A 5A2JH 4NIKB 3D25A 4GRLA 2J88H 4QXUH 3TVMA 3QPXL 5C2BL 1H8LA 4YE4H 2IFGA 2QEJA 1ET8A 2O6CA 1EJOH 2JJVA 5J56B 1RXLA 2HKFL 2D7OA 3O4LE 4F24A 4GFXA 5EU4A 4U1LB 5HJ3B 4P99A 1DBBL 1ZRUA 4MNGA 1PVHA 2LVEA 3GI9L 3QDJD 4R7LA 4F9LC 4NUJB 3SEPA 4Z7VA 4D9LL 4JANB 3G04B 4DGVL 3AVEA 4I77H 3UMTA 4KZEL 5FYJL 4X42A 3GMLB 3PWVB 4R96A 4F9LA 1M71B 2YPVL 3N0AA 3QWRA 2DQEH 4GQQA 1HXYB 5ACZB 3ULVC 4D8OA 4PJHA 5LNGA 4O9HL 4BCZA 4XPAL 1HH6B 3ZE1F 5H4ZA 3KLDA 3HB3D 2NX5A 1BOYA 2J8UB 3C87A 2B20A 4NM8H 4YMPA 2VL5A 3L2NA 4JFDE 1C9SA 3KPSB 4NRZA 3GKWH 2ORBH 3II3A 3T8VA 3U79A 1PSKH 3DJZA 3QARA 1CTMA 3V8CA 4OZGE 1J5HA 3U7YL 3GBNH 4PVMA 1W8NA 4JPKL 4A2EA 2W92A 4E9WA 1ACYH 5F1IB 3GUTA 2WTPA 1GC1L 1DUZA 4QRQA 3WTXA 3RGVC 1TXKA 1NPNA 3JYBA 4HFUL 2YD0A 4OIIH 4AUJA 1GSMA 1UD5A 4G2AA 4KO9A 3CPLA 1J7VR 1E4KC 2AJXL 1EHXA 1AZZC 3RGVA 5LHDA 1YPZA 4ZUVA 1A3RL 2O6PA 4TVPD 1DQQB 3LS4L 1AIFB 4LNRB 4LRIC 5D1QC 5D2LF 2DYSB 5C3TA 3WKMH 1IAIH 4K2UH 5C0CB 1E4KA 1MCWW 5B1JC 1IVTA 2C9XA 3VD7A 3L8QA 1HZHH 3WBDA 4BYHA 1INQA 5D1QA 2K4AA 4LRIA 2J21A 4MNQA 2G0KA 4AQEB 2Z93B 2QR0A 3CQPA 5B1JA 4JAMB 1XGTA 1JYXA 1F3JB 4UI2A 3PAYA 3MLZL 4GMTH 1TMCB 2DBLH 3RZWA 3BEVA 4FKHA 2BCKB 4M8RA 1SXZA 2DEXX 1G7PA 4FTDA 2Y7QB 2ADGA 1DL7L 3OAYH 5CSZA 1HHGB 4EIBA 1MCHA 2AXFB 2QKIB 2CJUH 5C3LD 3L16A 5ID1A 4P4KB 4UQIM 1R5IB 1HNFA 1M2VA 1WGOA 1T0PB 2Y9RT 5FUZH 2F9BT 1HH9A 2CLRB 1NPJA 3MUGB 4KRPC 3SCMB 1KGCD 2ZXCA 3AFLA 2DY2A 1KB9J 3LN5A 5FA4B 2JJTC 4WUUE 2BSBA 3U46B 3RTQD 3VVVA 5JOPE 2JKLA 3K1KC 3D3VE 1J8SA 3FULA 4TQPA 4WKZA 2X4NA 3KXFA 4KK9D 5I1DA 1YNTB 2CDFA 3U0TB 4NFDA 4OFQA 4K3EL 4HW6A 1FAIL 1BM7A 3LZFH 3G08A 3NPSB 4NQCE 3GT6A 3MX0A 1FPTL 1N68A 2J1XA 4HUXA 1AD9A 2Z0BA 1FNSH 3D2UB 3IFOA 3HVNA 1IL1A 3MRIA 4PREA 4WW1A 5SV4A 1ZV2A 4OLWL 4ZX5A 4PJCE 4AV5A 4Z7NB 4HH9B 3K6NA 3PUUA 1SEQH 2BSDA 4YBQC 1AD0B 4ALAL 5I19H 4JY5H 3DHUA 3UBXA 3S97C 5ICYB 1QNIA 2NXZC 4X8JA 4JKPL 3LPGA 3IMSA 5FAAA 2ZAGA 3SOBL 5HDQL 1I9RH 4P3DA 4P2OC 5KS9E 2E56A 1MFDL 1MNUL 3QG7H 4ZOAA 5GGVL 1D6EB 1QSEB 1M3JA 1ZIAA 5IF0B 4AYID 3QUKB 2UXGA 2J6EH 3BKYL 1T1WB 4IKLA 4BWTA 3OGCA 2XTJC 25C8L 1I7TA 4Y1AD 1JP5A 2YUZA 3PL6C 3QZLA 4P2OA 1Z0NA 3G5YB 1IFRA 3FT0A 3LEVL 3QGVA 4BZ1A 4ZTOL 1QSFB 3R0NA 1TJGL 4MA8L 3PL6A 3VQLA 2YBGA 4L1SA 2B4CC 5I8CA 4LSSL 2BOCB 3E6FB 3MREA 3S48A 3V0IA 1ONQB 4PJ5D 4MCZB 1OPOA 1AKJB 3HPLA 3T2NH 3GMOA 2GC7C 1DQML 1DVYA 4GUPA 2R23A 5E08L 2B5IC 3OBAA 2YEQA 3K4AA 4KFZC 5DRXA 1DANT 3JV6A 1PAZA 1JTPA 1GS8A 1JCKA 4MAYB 5C8JA 3DURA 1FC2D 4JN2A 2VZVA 4LLDA 1F0LA 4X4ME 3QUYC 1NFDF 4XAKD 3L3IA 5JO5A 2EH8L 1DYZA 4PJDE 3WV0A 1KLGB 4OKVA 4M4RA 1R0AH 1NMAL 4M7JH 2VT0A 1I3RA 1P4IH 5KN5B 3QUYA 4KZ0A 7PCYA 1ZLEA 4J4PD 1CFMA 3MUY1 3O2VL 3OAUL 1NLBH 2WKGA 2N7BA 1IAKA 1Q9KA 2FX7H 1UA6H 3EFDH 1AFVH 4LLQA 4RVBA 1E5ZA 4FNRA 4IRZA 1M56B 3SDDC 2MCAA 4A39A 5DJCB 4M7ZC 1DQLH 1GAFH 2KDYA 1IX2A 5C0AB 4XCEB 4CN6A 4OTXH 3DTXA 3OXRB 3ZBMA 1FNAA 2PYEA 4QLRA 1TSHA 3CVDA 3OAZK 4Y2DB 5EU6E 1IE4A 3HVDA 3EYQD 5KSVA 4U4IA 5I1CH 4OCRH 5IROD 4NQVB 2APBA 5KYYB 1G7IA 4NIYE 1OTTD 1KPVB 4PJ9C 1ILSA 5I76A 1ZJBA 4IIQB 4RGOH 1EO5A 3ZOAA 1YJDH 5ESAA 32C2B 4U1NA 3RAJH 2HFEA 3GSQB 3H9HA 1EHAA 1CE6B 3QIWC 2I5YH 4HIXL 1JI2A 2C9RA 2HJKA 4PJ9A 4XXWA 3S3SA 3HR5B 1B0IA 1R3KB 4DP8X 3OKNB 1M7IA 3CMOL 3QIWA 5KBPA 4LF3B 1ACZA 2JIXA 2OMWA 4Y89A 1G1KA 4I0PD 2OL3H 4K94C 3IDYB 1TQBC 1RPKA 3FF8A 2UWEB 3ZMRA 3MJWA 3M17A 1HILA 2EACA 1NC2A 3HG1E 2R2CA 4NAJA 5D7IB 2N59A 3AWGA 2XIBA 5I73B 4NWTL 5FK9A 4J27A 1DVUA 3LQZA 4ZTPL 5DRWA 1P7QD 5E6SB 1D9KB 1T66D 4R7DA 4JHZA 3IRPX 4CVXA 2ED9A 5L6YL 4OM1H 1S7WB 3IJHA 9CGTA 3Q1EA 4HWEL 2EH7H 4IRSB 4N86A 2YAEA 1M6OB 3FT2A 4JZOB 3EG9A 4KKCC 3NBNA 2VKWA 1X4YA 4UWQB 3PP4H 2QL1A 4HG4K 1E65A 2YD8A 1HOCA 4AT6A 1NQBA 1OE3A 1AXTH 3LKNA 4XR8C 2XWJB 2PP8A 2ENQA 4AYEC 5F6HJ 1W6WA 5D70H 1TPXB 2XA8L 3FQXA 4DZ8B 4NN7B 3RWIB 3FJTA 3PJSB 2PCPB 4ZXBD 3B5GA 4MLIA 4R0LC 4E41B 3NSJA 5IWLA 3DUHA 5LBSH 5FDWA 4DEWA 5TPWH 4HD5A 4X80L 3WY4A 3VGEA 3ERXA 3UCQA 4TYUA 4HUUA 1INEH 2ZYRA 3T08A 1CGUA 1NDGA 2YS4A 4Y19E 4R0LA 2IQAB 4FNSA 2HT3C 4JRLA 4JVWA 3T77A 1SHMA 2YD7A 2OCCB 2UZIH 2WQRA 4MNGE 2Z6FA 4R90L 2R69H 4TNVF 2B1OA 2CPUA 2ZAHA 4LIQL 1ZY9A 1EJ6A 3KYOA 1QRND 4YR6A 1SUHA 3RJQB 1V7NH 4FTVE 2IPKB 3L2LA 2X6AA 1OAUL 4NS0A 2BNUB 3KLLA 4ELMB 2EEBA 1P4BH 3BGAA 4OLXH 5I1EL 3RWGA 2GEEA 2K6YA 3MV8D 4JHAL 3LH8A 3SPGA 5B1AB 3ATDA 1VEMA 5E1AA 4E9VA 1SM3H 4I48A 2OTUA 3ULVE 2Q7AA 3BZ4B 4CC0A 3KLHC 3AMLA 1YC8A 1KG0A 3FRPB 4JREC 5D7KD 5KSAD 2Y5QA 4XGZB 3J27A 3IFLH 4BRVA 2J4WH 3KNBA 4DK3A 3F84A 1E3ZA 5CINH 4QR7A 1OKEA 3RL1B 4HS3B 3KAAA 3VFTB 5LUMA 4R4FL 4OJYA 2GIXA 4HK0A 1PIGA 1SOKA 3NK4A 3CFJB 4K71C 2ADFL 4NGHH 5DQDH 3ZKND 4FQXD 1QAWA 1NBQA 2PLTA 2XXFA 1OPGH 1QLRA 2F58L 1XCTB 3COOA 4EI5B 1LEKB 2FYYA 2PTTB 2ZCHH 4HXBH 4D94A 1A1OB 4U1MB 4D9QE 1U8QB 3ZE1B 5JIQA 1YYLL 1L3NA 4FFZA 1CF8H 3O81A 1UM4H 3U2SA 3INUL 4AIZA 2MQ0A 2JH2A 2APTA 4G83A 5I71C 4L1LA 4MJ5B 4BZ2A 1EZSA 5JTWA 1NBCA 5AENA 4I5BA 3UTQA 4R6UA 3ZTJG 2PUQT 1MHHA 5D1QE 3GFUA 4HK3N 5G5DA 3TT1L 3QNXB 5EOCH 4MNQE 2WLLA 4KNSA 1EUTA 4XMKH 3CPUA 4NP4L 3BLPX 4NAQA 4YK4B 3WL9A 2M26A 3DWTA 1MUJB 3W0WB 3O6FB 1PFOA 2N7SA 1A7PL 5T1DL 3WO4B 5IB3A 3QXAB 4GBXC 5MP6H 2WXMA 4NT6A 2DQHL 5BS0A 3NZ8B 4UNIA 3V4VB 3A4AA 2VISA 2NYYC 4PJ6A 1J5OL 5T3XD 4B9FA 2X4OB 3RNQB 5L9DL 2P7TB 1TQCB 3ULUD 2ZUUA 3BH8B 4GLRI 1JGLH 1WRFA 3D4GA 4R7XA 5D2LB 3SIKA 3FHAA 3UBXG 2AMGA 2B16A 1NCAL 4AMKH 3WEAA 3F12A 4MJID 3MC0A 2BINA 4UIMA 4CSPA 3VFWA 1MFBH 2V37A 1RZFH 1EUUA 3MR9B 2F7RA 1GMIA 1LK2B 2FSEB 2ZP0T 3F58L 3P3RA 2IGFL 3M88A 3C60C 3JV4B 5EEWA 1LE5A 3NAAL 5ELIA 1M05B 1I8KA 2DKSA 3QIBC 4PLOB 2FBOJ 3MRPB 2YXWA 4PRIB 3MTRA 5HD8C 1J8KA 2A83A 1GKOA 3KXFE 4QRAA 3DV6A 3UTSE 1BQLL 1WE5A 3QIBA 3QNYB 2WIMA 4GUQA 4NFCA 2QT6A 3QO1B 2NW2B 1IAIM 1RY7B 5JDJA 1EGJA 2W65B 2YD5A 5IJDC 1IM3A 2D3LA 3CVHB 3N6YA 3L3HA 3G9VA 3EJSA 1I1AA 1T5XA 3DYPA 3HI5H 1DR9A 4H8HA 4GG8A 3DBXA 3DGCR 3ISWA 2V9TA 4BH7A 4WO0A 4Z7OF 2XZQL 4W9GC 2YLKA 1YEDA 4XPFL 4BRJA 3ULVH 1AS8A 4L1DA 5AUMB 2WXPA 2CKBB 3MROB 4PGEB 4WO4B 5ALCH 1JPSL 2WINA 1JXGA 1WUNT 1S46A 3IDGB 2A0LC 1KEGL 1I53A 1N64L 3DHJA 3AABA 1TU2B 4N25A 1QNZH 3W9DB 4AEFA 3P0VL 2ZG3A 4FQJL 4AGLA 1MG3C 3SDXB 1E2ZA 2LU7A 2BZ7A 4LCYA 1LE9A 3T8MA 5L2JA 4XXDB 1BXAA 2N01B 4YHOL 1NBZB 2B0SL 3P9WB 3UABA 4PN6A 3W11C 4IHOA 5DHVA 5FWRA 1WYJA 2QSTA 1U8LB 1WUZA 2NYZA 3UBHA 1EX0A 1N2RA 4ORGA 4C83B 5IHWA 1WISA 1XCXA 2XTJE 1ZS8B 5TGBA 2W80C 5C0GB 2BSEA 3BLKA 5BVJB 3EBAA 3I6GA 1U9KA 4HEMA 1DHKA 3R18A 1C5CL 3IDJB 4JHWH 3GUFA 3QK0A 5DXWA 5SWSB 5JOFB 3BMWA 1E42A 2JB6B 4UM9B 4JRWA 1G6RH 3WDIA 1XB6A 4BA8A 1FGNL 4O58H 3CSTA 3FB6B 4TUOA 4X83A 5ERWA 3CFIC 3OHXB 3VA2C 1D5XB 5C1MB 2BDNL 3THML 3MLXL 3PDOA 1OARL 5IW1B 3QI9B 4UINH 6FABL 4UT9A 4ETYA 1MHCA 4W6WB 3FTVA 4PJFA 1XVSA 4QJ4B 2KMWA 4JFHD 4Z3IA 3LRSA 1DBML 3AS2A 1B0RB 1TZGL 4GSDL 3V95A 5E2UL 4ZS7H 1BPVA 5PCYA 2A9DA 5I75B 4EDWH 4ZFOL 5ISZD 2G5UA 3R06B 4NRYB 1G7HB 3DVFA 3LY6A 4MYWB 2QVTA 1V7ML 1T6VN 4H20L 5HHNA 4AJYV 4X4ZA 2ZX6A 3LNEA 4HQQH 3TBVA 3ZE2B 1SHWA 1EZVX 3I6LE 4H88H 4WFHD 4YWGH 1AR2A 4PLKC 4UM8B 3FU3A 4MX7A 2F53B 4PJEA 5CGYD 1KB5H 5KYWB 1J1XH 2YC1A 4X99A 4F15B 2E9WA 4PV8B 5TD4A 43CAA 4QHKJ 4YHNA 3FF7A 1R3JB 3RPIB 4HKZA 1BZ8A 3TONA 1YN7A 2ZOLA 4KJPC 3WD5H 1C7TA 3RIFF 5AVSB 1PD6A 5EU3B 3RGHA 3NIFE 4QT5A 3SGEI 2YGPA 2OP4L 4WW2C 3DX1A 4C56D 1OIOA 1A7QH 4J3OD 3SQBB 3AWEA 3AXHA 2J43A 2PETA 2WUBL 4J3UA 1GR7A 3AS1A 1WIPA 1MRDH 5IJBC 1VLXA 1QW9A 4PCSA 1BVZA 4QHNB 4XB7A 2W07B 3IVKA 2NSXA 4GKOA 3HZKB 1HHIB 3TF7C 3FFCA 3HE7C 1ZLSH 1IGJA 3HUJA 5GJTL 1W0YT 5BUGA 2XIDA 3MODH 4P8QA 2DKUA 3AM8C 4BHUI 5IQ7L 2VQ1B 2WWNA 4LSPH 2WTOA 2YQ2A 4OD3H 4QXWA 1TVHA 4ICXA 1DSFH 3HE7A 1JOIA 5E9NA 2WB7A 3MRGB 2BY3A 3AM8A 3B5HA 5EO9A 3ESPA 3SDYH 3SKJL 5ICUA 1X5KA 4TLTA 2HFFB 4Y4KB 2E6QA 5JHDD 1CIUA 3EFFA 2HT2C 4FULA 1VIWA 4GO9A 1EVTC 1A4CA 1B90A 3GZPA 1AGEB 5L88H 1KOAA 2N1KA 4H8PA 2MPAH 3FKUS 2K4WA 3MA9H 3L1EA 5DO8A 2FT8A 5CM1A 2IALB 4XNAA 1I31A 1S9YA 3QRGH 3VO0A 2W95A 2HRLA 1JHLL 4U6XB 4KJWD 1CL7H 4XHJD 2DQIL 4AJ0A 4N0FA 1FZMB 2B4CH 2VW4A 4UT6H 4FEMA 3ROOB 6PAZA 1KEML 1MIEH 4YJZL 1Q94B 3KYKH 1N59B 3SDCC 4PY8I 3RWDA 2LV4A 1SOXA 1LO5A 1QRKA 1E9PA 2KT6A 2WCSA 4O4YL 5DS2A 4GRMA 4BEIA 3H1ZA 2VIRB 4M3KB 3SDCA 2QMJA 3OXSB 2VW6A 3CDZA 3QNZB 4M6AA 4WUKH 3NJNA 5GZOC 2QPFA 1L7TL 4FZEH 4OFDA 2CO6B 2XWEA 3C09B 3DMMD 3H3BC 4PP2B 4FG6D 1XHHA 3QQ4A 4FJZA 3T0ED 1NL0L 2XA3A 3US0A 1DVQA 4HC1H 3D0VB 1QKZH 3G6JA 1UD8A 3HN3A 5GZOA 2WLKA 5IT2H 5EC1B 1H9VA 1V3JA 2WBWB 1ND0B 1SGKA 5C0DA 5FO9A 2NNAB 2R29H 4KUCD 1TCRA 1E9QA 3B1UA 5FWQA 3UJJL 3WS6C 3K2KA 5D7LA 1U2CA 4OFYA 3WFBH 4F58H 4UTAA 2IANA 3PNWB 5C0BA 2C9AA 1BQHG 5KANI 5DVMA 1DVZA 3WS6A 4FFTA 1T1ZB 3QB7C 3CFKA 2X87A 5IQ9B 1W72L 3QDMA 3MRFA 3P3YA 5DFAA 3D33A 4MSWA 3CC1A 3VG0L 4J3SA 2HG5A 3HNTL 4MDJA 4BFBD 4PWJA 3HZMA 3ECQA 1WFUA 3V5KA 1KXTA 4NCDA 5TTRA 2XHNA 2Z0UA 5E5MA 3MFFA 1T7YA 4N90D 3CNKA 5B7EA 4QY8A 2ZUQC 4JRYD 5BXFA 3S8FB 3D9AH 2OXHA 3MV9A 1FO0H 3LKRB 6CGTA 1D5BA 3F62A 3JZ7A 2AEPL 2WM0A 3NQIA 4GH7B 1UA7A 4AG4L 1NKOA 3D69B 5DZLA 5KYXA 1TG8A 1AYRA 2WKOF 3QZWB 3I6SA 2EDEA 3LKSB 4AW4A 2VUYA 3Q2CA 3VB9A 1I8MA 1IC0A 3V9CA 3BOVA 3PGFH 4HYTB 1NCOA 3GJFH 3T8XB 4PJXB 3LNGA 2IV9A 5H37H 2Y1AA 2G75B 3OKOB 4WWID 3ZKXC 3AAZA 1GY1A 4X5XB 5BS0E 3MBEA 4M6NL 4G9FD 4OVVA 4DUWA 1HQRB 2WPGA 5TE4H 1KXQA 2IMMA 3D2TA 2GIMA 3SY0B 3AG4B 1OV8A 1KCVL 2P8MB 1MCBA 4ZAKD 5T3ZL 4F7TA 4YVNA 2X4RB 3EO0A 2WGXA 3OLGA 3Q6FA 1F90H 1XL4A 3IGFA 4YAQB 5F9WC 2K6WA 1S6NA 3PFQA 2V2TB 2VXTH 3NH7L 3NJIA 1QSZA 1QP1A 4TVSa 1N0LB 4FGMA 3BP4B 4AQ1C 3BPLB 4Z95L 1ECYA 2F5AH 1LNUA 2KS0A 2V5MA 3E38A 3FUFA 2GUOB 1IAOA 4OFVA 3T0DA 2BC4A 2IWKA 1IFHL 2EC9U 4F7EB 3CIAA 4BBWA 4NBXB 2D4DA 4AQ1A 4EXPX 4PJGE 1OSZA 5SWZA 3B8YA 3B9VA 2K3HA 2Y6TE 1BQSA 4M7LH 3SJVB 2KBGA 4FQCL 5E1QA 1PL3A 3P9MA 1BEYH 3KPSD 1EXHA 2ALAA 3U1SL 3GXNA 3PIQB 4Y5VC 5EO0A 3ZO9A 4UV7L 1HJCA 2IAMC 2NR6D 4PU2A 1BP3B 2OMTA 3HZVA 4UTBL 1KTLB 2ZX8A 3GQFA 3LS5L 4PRPA 3FO1B 4AKPA 5HYJA 4Y5VA 1YNKL 2BX5A 4Z3TA 1N18A 1T0NB 1JPEA 4DK6A 3P73B 3I6KB 3VE0B 1D7FA 4L4TE 4ZJ9A 2WHVA 3ZE0B 4G3YL 2R1WA 2V3EA 1N7MH 1XTLA 3FAXA 4F37F 5C0IA 4ADGA 1H15A 1U8CA 3EJRA 1ASOA 5KTEH 4X0KB 1KYAA 4Q9QH 1DLFH 2XY2A 2ED8A 5LJYH 5C0CD 2Q76B 2R0ZL 5EBWA 1HI6B 2VXQL 2I25N 3S98A 1KT2B 3C6LB 2NY5C 5EFIA 4FQHB 3EYSH 3RI5K 1S5IL 1MJUH 2IF7A 2GBTA 3OMIB 3ZHFA 5KYNA 1SYVB 4ODXA 1SN5A 3WEXB 3UYPA 5D1ZD 3MBXL 3NGBC 3CN3A 3Q9PA 1OB1B 1YG9A 2MCPL 2OXGB 3DX8B 3F05A 1YUKB 4HXAH 1HN1A 3LYRA 1E2VA 3HW7A 4XVUC 4XBPB 3HMXH 5BOZG 2ZICA 1RURL 1SMDA 2Z91A 2WWMD 2I60L 2OMVB 3BDBA 2FQFA 1JXKA 4J6RL 4P4KD 4OI7A 5DR5L 5IV2B 1MVUA 1FZKB 2IDCA 1TTFA 5ITBH 1SQ2N 4L3EE 3D51A 5JHAA 3OR6B 2C4FT 3M1CA 4LSRH 4AIEA 5F7MC 1VZGA 4PS8A 4TNEA 4XB3A 3SCMD 2Q3ZA 2MNWA 1S3RA 4CDGC 3QFDB 2HH0L 4HUKB 2C1OB 4U6YA 3O6MH 5DS1A 1ZTXE 3LN4B 3VI4F 4G11A 5E00A 1ASQA 2VDKH 3IPFA 3ZRCC 1NAKL 2CRYA 3ASNB 4JCMA 1PU0A 3PCYA 5H94B 3B3IB 3QDJA 3D5OF 1DQJB 1H5BB 1CE1L 2MIZA 4FHBD 4E0RA 1IVLA 4K07A 4PJ8C 2YBRA 3IDXH 1CR9L 2OQJB 2IPTL 3D2UD 1F4HA 2B8OT 1Z3GH 5A6MA 5LGHL 4KZDH 4MA7H 2Q6WB 4U0QB 5DUBA 3NIGB 1UCBH 2EXYD 4F8OA 1JZHA 3GGWA 5I66A 5F3HB 3S3BB 3U6RB 4JQIH 1ZLVK 1OSPL 3Q8BA 4I87A 2YAMA 1GXEA 3K0YA 4KI5D 2ZKMX 4BK4A 1TQTA 4R7NB 3W81A 5HY9B 4GRWB 2AK1H 3O2WL 5DQ9A 3V7AG 4NNPL 4XMVA 2BCMA 5DJAA 3QEGH 4AEHH 3NJFA 1F58H 3ZO0A 3FFCE 2G60L 5E9AA 4TUUA 3L3DB 3HBQA 4ODHL 3HC3L 1J48A 3QUMA 1PYWB 1QSFD 1I9IH 3O45A 4KC3B 3WJLC 1XF4A 3VH8B 1Q0XH 4XN7A 3Q5OA 3Q05A 2R4SL 5I6XC 3BH9B 3WDJA 5TFSH 2LABA 3GRWA 5ITFA 2R2BB 1UWFA 3JZYA 1AKJD 5E2VL 5KVGL 3FQTB 1FVEA 1ZHBB 2OX5A 4TTDC 3WJLA 1IFGA 3NFSH 3I75B 5DJ2B 3VXRB 1AGFB 1UTDA 3O6LL 1UOKA 2GKIA 4LLVA 3EOBB 1HHKA 3LQMA 4MAYD 3RWHB 4BSWA 5HYEA 3QWOA 4WI8A 2JI1A 3I74A 3GSUA 3WUZA 2Q7YB 3DROA 1AQDA 3P4NB 2IOOA 3CSFA 3TA3B 1TSRA 3ECWA 1XB3A 5GGSA 4HWBA 4XZUB 1A1MA 2VRAA 1JZ5A 3CV5A 4F1ZA 3T6QC 1TJHL 2H32A 1QVOA 3AZUA 2FZ3A 4JPVH 3RJOA 3B6SB 1MIML 4JO4L 5FO7B 3V7AE 3M8OH 1IV8A 3ARZA 4OCWH 1IC7H 3DOHA 4PJBB 4RISL 1FFQA 2QGBA 5DEFB 5C0AD 2DTMH 2F8IA 4CBZA 5HDRA 4ZD3H 5EBGA 1NGWA 2UVEA 4JFOB 3BIKA 5DQJA 4Z7QF 3BXNB 3FZUC 3SE3C 5E70A 4LL4A 2EKJA 2EDNA 3RTQC 2VKXA 3G6JE 1ZTXH 1UB5B 4X6CF 4RQQB 3B1TA 4KK9C 5CJBA 1R3LB 2HWZL 5F93C 1U8PA 5JQHC 3RTQA 4YBLB 1I8UA 4FXLA 4Q9RH 2E7HA 5PAZA 4PJIF 1CFVL 3FOMA 4AK2A 5GSRB 5CZRA 2JKJA 1ZD6A 2DPKA 3QG6A 3M7OA 3QEHB 3PV7A 4PYHA 4TNGA 5AKVA 3QDME 1RH8A 1S78D 3L1OL 3FL7A 3P1VA 2TRYA 2YMXH 4HX1B 2LQRA 3NN8B 4BWWA 4NJ9H 2GJZA 4RMTA 4G6ML 1X9RA 1PEZA 1AZNA 2EXSA 3ATFA 3FYIB 2WUCH 2JXMB 1EV2E 4P0DA 4X7EC 4YXHH 4JMNA 4UV4H 1U3HC 4K5NA 1ZLUK 1BVLB 1U2HA 2VSCA 4FZ8L 1U4EA 1JD7A 2GC4C 4APQB 3NQKA 4K9EH 4ZDHB 3QDGA 2LTQB 5IJVA 4X7SH 3Q43A 4Y5XC 4XX5A 4IRSD 2AK4B 3CX2A 3TIDA 1ZMYA 3FU6A 4L5FL 3OB0K 2D3NA 3BUTA 4Y1AA 2WLZA 1MCQA 3V9FA 4KXBA 3DXAE 2FL5A 3VXQA 4Y5XA 4RIRB 4TQIA 4BDVA 4AYDC 3U4EA 1KPUA 4BWUA 4OFKA 5HYQA 1R9FA 3NZSA 1BX2B 1HWWA 2I26N 3B43A 2OMXA 3LRLA 3NFPA 1DEEA 4E41D 1XR9B 4PJ5A 1KXQE 5GGVY 5K1JA 4HULB 4EPSA 2BNRB 1HCYA 1A1NA 2K6ZA 4OF7A 35C8H 1BGXL 4AZ8A 3MI6A 4ZPTA 3CSYA 4CRPA 4UQ3A 1TZAA 3CDCA 4HJIA 2PR4L 3LIZA 4U6HB 5DJ0B 1NCIA 3DX6A 4RGMB 2P5EB 3FC8A 4J4PC 3OM3B 4NZUL 4PWGA 3HC4L 3PQYB 5I0YA 1SRDA 2BFGA 2VN7A 3ILPB 4N9GB 3W2DH 1N8ZB 1O6VA 2NNFA 1SOSA 2F1AA 1EAPB 4I2XE 4XPHH 4J4PA 3IJ7A 1Q9OA 4BFFA 3OG4B 2OMYA 1ORQA 1NH6A 3HNSL 4LCIL 5DFVC 5KWYC 5CUSL 1NGPL 5J12C 1R17A 2M1KA 2W60B 2Y7SA 2XVKA 4L8CB 1OGSA 4N6RB 3RBSA 5D7JC 3EYQC 3UZEA 2Y6SD 3MRCA 4WNJA 3I50L 1F02I 4UBDC 5BRZB 3BPCA 2EIZB 1IGYA 2FQGA 3PDGA 4P2RB 4IRJB 5IROC 3NCYP 2AQ1A 3ZQWA 2OMUB 5D7JA 5JDSB 2I9TB 5D1XB 3FT9A 1LD9B 5IHUH 2X89A 5IROA 1JUFA 4YFLF 1GH7A 2EXWD 3L6FB 1VPOL 4WI3A 1QHPA 4EI5D 4NJAL 3M86A 4OU3A 1MH5B 1CD9B 3M46A 1GJIA 3V10A 1KCSL 2O5ZL 3I02B 2O6EA 4AVJA 4GINA 5I15H 4PMFA 3X14A 3TEWA 3DSFH 4ZFOB 5C0EB 2ATKB 1AR1B 4G6AD 1AZRA 3M1BB 2CHZA 3ABKB 1ZHLB 2APVA 1OE2A 3FB5B 1F8TL 3Q01A 4ZPVA 5IGXH 4WFGD 5L2KB 3ES6A 4JS7A 4ENEC 4W9ZA 2XU9A 3NRFA 4A37A 1H3TA 5GRJL 1VAHA 1J12A 3RLSA 1K2DB 1G84A 3RP1A 2XQBH 1P7QA 1MFNA 4F7PB 2Y36L 2EDLA 4K23L 3LQAH 3UYOD 5IIEB 3VX0A 4HJJL 1R5VB 5JHMA 3A67H 5E03A 3ZU8A 2NSMA 1CDYA 4WGKA 1U8JA 2PW1B 2VDPL 1CDJA 1TZIA 3UAAA 2ENYA 4G8EA 3KPRE 1WITA 3P0GB 5DD0L 3H6AA 4S2SB 5AVZB 4E68A 4IBVA 1RERA 2OYKA 4EN2A 5E94A 1WLHA 4AVHA 3GMQA 3HRZB 5FA3A 1XF3A 4DSYA 1ZA6B 4G43A 4H0HB 4RCAA 4Z7UE 5FCUH 4YFEA 3TO4B 3GXTA 4Z7VF 4OJCA 1NCDH 1DN2A 2JI3A 1RUPH 1A6WH 3QH3B 1XX9C 1YEHH 4RBPK 3BJLA 3FU7B 3AACA 1CLZH 1CQYA 3VGGA 2XDHA 4PRID 1RZIB 3BO8A 4PJHF 1N67A 3RU8L 4P3CH 2QADB 1LILA 1YYML 1YEJH 2BJML 1U91B 2VE6A 1XGRA 1L7IH 2VQ4A 4JCWA 4WWNA 2R8SH 1U33A 2V3DA 3O3AA 3QDJE 2EAEA 1PAMA 3L4UA 5ANMB 1QRNA 4KRMB 4E36A 1ITBB 1DLHB 1TTBA 2L0DA 2L7EA 4N1EA 2VUKA 4OCSL 2EQDA 4XP9H 3CFMA 3WFHA 2FT7A 4R97B 4XVSL 2Z31C 3U9PH 1IC5H 4Q6IB 3BUYA 5GS3A 2UY7B 3UMNA 4DO5A 1BQ5A 3NVQA 5KSAC 3KPOA 5I74B 2H47C 1F4WH 2DLGA 5F88A 1IAII 4WO4D 1PJWA 5JIDA 3ZMNA 4HUMB 2D31B 1A6VL 4KY2A 2AERT 2KPWA 3OJMB 3QSKB 5LLIC 3RX5A 4EF3A 1TTRA 1ZLDA 5KSAA 4AGNA 5DJXB 1HX0A 4OJDH 3MCLL 4M9OA 2XXGA 3ZKNC 1BFVH 1AACA 3MAWA 4FQXC 4L29A 5E6IB 1OANA 3DYOA 3B56A 1YPZF 2X2YA 2X38A 3HI6L 5DRNB 2MNJB 5HGHA 2BP0A 4Z7WB 1XH3B 2ZQKA 4OD2A 2X05A 2MMXA 3QZOA 1IBGL 4FQXA 4FG4A 1KY7A 2H1XA 4LBEB 3WNNA 4AJVA 5A2LH 4DPCX 2EDJA 3JWOL 5DMJB 1T7XA 2VXSH 3QJFA 3CK0L 3OQRA 4E9QA 1ETZB 1ANUA 2IO5A 4X9IA 3SBWA 1UACL 5SWSD 4IDJL 1PG7H 5A3ID 3BSHA 4UM9D 4M43L 2XFXA 4MNHA 2GY7B 1DE4A 4B6ZA 5ECJE 1PG7X 3ULSA 3W39B 4DP0X 2A9NL 4KK5C 4H5SB 3FSWA 1D5MB 1Q8MA 4R5VA 2NY5H 1CYWA 4GW4B 1DZ0A 1DBJL 2F7IA 3B2PA 1TFPA 3FHQA 3IFNL 3QI9D 1QUNB 2KLSA 3HBPA 4JBSA 2YA1A 4XNZC 5CLXA 2WP3O 4HSCX 3VFNB 4QF1A 3ULUC 3PPSA 1XGPB 1YMHB 3NP4A 1FORL 2Z7ZA 4L8BA 4QLWA 2EEFA 5JA8B 3V79C 3CSPA 1FVDA 1T1XA 3K4ZA 1L9PA 3WUWA 1FFOA 3MGTA 4OZ4A 1N5AB 4KY1L 1A4BA 4MJIA 4QXVA 4RMSA 3ABMB 2ICWI 3X11A 1OGAB 1Y7VA 1ZA3A 5IOPA 2F53D 3CAFA 1QBMH 5DHXB 3QQ3A 1X5YA 4Z77B 4L4JA 4U2ZA 1QLEB 3O11B 5AL0A 4FQIH 1DBKL 2AEOA 2CK2A 3BX7C 3OR7A 4TRPH 1PKOA 4WU7B 4Y5YA 2NUPB 2G9HB 4TSAL 1HIML 3VACA 1I8IA 4KHTH 1EXUA 2FBRA 4LLYB 4ONHA 1TKWA 1AGBA 1I7ZB 2EYSA 4YSEA 1HDMB 3K71B 2OJEA 1YECH 2LW3A 2Y07L 3PGCA 1NSNL 1V54B 2VDOB 1GZQA 1OAZL 3N2JA 5HVGB 3VTTA 1J18A 3CZGA 5CJQH 2FHCA 4NO0A 1U8NB 3B83A 1MWAH 1T21B 3TN0B 1COBA 5FM8A 4IOIA 4X6CB 4JLRB 1T22B 1YMMA 2EKSB 2J12B 4YPGB 3WJMA 2DDQL 3J7HA 1KYDA 4DPBX 4O5LH 4U33A 5I18H 1YRKA 4GPVA 3STLA 3GIVB 1VADB 4Y2OB 3QDGE 1VGKA 3DHMA 3RJDA 4KNQA 2H8PA 4LRNL 4NHUB 4Y4KD 4I1PA 1AGCB 1T20B 3C6EA 4HH8A 4R3SA 3RWFA 1ODAA 4HS6B 3V4PH 3WFZA 3QUMH 3BZEA 5E8OB 1UWEH 4TUKL 2QPEB 2L7JA 2VMFA 3KPQB 4MCYB 3EJPA 4YPJA 2Y5TB 1PZCA 3GXDA 4U1SA 3GMPB 2B1HH 3NSFA 1FI8C 1PPIA 2B3IA 1HYRC 2EE0A 4FD0A 5D4QA 3SO5A 3ESVF 3HI1B 1Q0EA 4D0CB 2HN7B 4PGZA 1PD0A 3ARSA 1E3FA 1NBVL 3AT8A 4XNYL 4AQ8C 3MDJA 4CMMA 2IDTA 4MAUH 2N0KA 2AXGB 2NY3B 2H6PB 2HX9A 4CSZA 1SY6A 5B38A 2OCFD 3CZJA 3GMMA 1CXKA 1BMGA 4IGBC 5A2BA 4GP4B 2IGLA 2RCSL 3QPXH 1TEGA 4M8QA 1PNDA 3HOGA 4AQ8A 3B2VH 4HWBH 5C2BH 2ZZUT 4PV9B 2YRLA 4XO3A 4JM4L 3APFA 1GGBL 2ICEC 4PWFA 4KVCH 4U3XA 4IGBA 2HKFH 4CGUB 1MLCA 1E27B 3U30C 3X12A 1DBBH 3T6ZA 2XBTA 3QIUB 4NQDB 1AE6H 2ICEA 3ARGB 3Q2LA 3LX9A 2GCYA 1AY1H 4D9LH 4DGVH 1WZLA 3MLUH 4HUWA 2V2WA 4DKEL 1MCKA 4N0YL 2IDQA 5ISZA 1P4UA 4MDIA 4QO1B 1NINA 5FYJH 1M1XA 4EZJA 1UADC 2YPVH 4NPKA 1LEIB 5C6PB 4M1GH 1ZT7A 4GKSB 2ZG2A 2GYSA 4O9HH 1W8EA 4RLDA 4XPAH 5D7SH 3SZKC 2ZSVB 3WE6A 1KIPA 2LVCA 1S7SA 5TDOB 4YN3A 4DP5X 3F5WB 4LT7A 4U6VL 3BCFA 1T0MB 4IBYA 5GQBA 4UQAA 3TZVC 3AUWB 5DK2A 5IBTH 4FHJA 4B50A 3U7YH 3K2MC 5E23A 2DB8A 1HHHB 2JCCE 2MQCA 1GGCH 4C56A 4K8RD 3F7RA 3O3EB 3TZVA 1MEXH 1PKQB 2FO8A 3NSXA 3KWWA 5E8NA 2BZDA 1GC1H 2NY0B 3BAWA 1MCIA 1RUKL 5CIPB 1NFIB 3FSVA 3GDCA 5I8OL 1UKSA 4QRRE 1K8DA 3LV3B 3HC0B 3II2A 2RFXB 4HFUH 4JG5A 4KKAD 1JBJA 2GFBB 3EYUH 5HJDA 2AJXH 2YR3A 2DIBA 2H1PH 4O2FA 3Q2NA 1XD1A 3K5SA 4Y9EA 4XWGL 3EKCA 1KYFA 1JNHA 2VMDA 4AYFB 1IGFL 2GI0A 4Y4FC 4EMZA 3EFOA 3DV4A 1I3GH 1SJXA 4L3CA 4WEEA 2YGOA 2YAHA 4OLZL 4Q6KA 3EXLA 1V3KA 3DIDA 1IGTA 5JHDA 3DRTA 5JPMB 4S1QL 3U82B 4YSOA 3ZHKA 5IEKB 2ADYA 1FIGL 2WVVB 3VXNA 4KJWC 4XHJC 5FECB 3MLZH 3ISYA 1JXDA 2F5BL 1HHJB 4AL8C 1H3UA 4HIIA 2O61A 3GS0A 3OAZH 4M6OL 5K9KA 4U3SA 3IMRA 2OI9C 2XNAB 3KM1A 1OF0A 1ZV9A 1KN4L 3BAXA 1RHHB 1MJJB 2ZXGA 3GZOA 3R19A 2L7UA 5E4AA 5MEOA 5EEUA 4Q7DA 3EUUA 4WI4A 3BP7A 3C9NA 5I8EB 3GMNA 5ID0B 5LAPA 4LHUB 4PP1D 1FBIL 1JN6A 2AV7B 4I13B 3V4UH 4PW4A 4OLVH 2NNXA 5D9SA 5DURD 5K9QI 4UAHA 3T0EA 1JSYA 2K3TA 1XF5B 4HFWB 4O02A 4YFLI 3UACA 1HKLL 2IOIA 3CVIL 2NCMA 3LKQA 4FXKB 3VD2A 1IT9L 4K3EH 3GSNB 1I1CA 4JDVA 2IBZY 1U8IA 5D7KE 1FL3B 2X1OA 3CHOA 1ZVHA 3R7RA 5J6GB 4P23B 2AMUA 3LRHA 3ABLB 1FPTH 5IW6A 5EEZA 4PJAB 3KGUA 1UHVA 2CIKB 2P5WA 4X50A 1URZA 3SE6A 3T4YA 3VXTB 4KRLB 4OLWH 2XOTA 3MCKB 3H6JA 4DEPC 3QO0B 3WUWG 3QUXB 3NRQA 1PZ5A 2Q3AA 5I1AB 3C6LD 1A6AB 4JKPH 4N8CL 5IFJA 4PY7A 4LESA 3AUVA 3BN9C 1NDTA 1MFDH 1MNUH 3MJ9L 1KBBA 4U2YA 5KSBE 1ZGLA 2ZTBA 2BP8A 1YEGH 3BKYH 3L95A 4F2MB 2I7SA 1G7JA 5EIVA 25C8H 4JRYA 5C07B 3CZLA 2ZJSL 1ZCRA 2AW2A 5F0JB 5DLLA 3A21A 4OZIB 4ZTOH 1S9XA 4HV8A 4L8DB 1S7TB 4A6YA 1G7LB 1SOQA 1PZBA 2GK0A 2CKNA 3IE9A 5AVRB 1QG3A 1TJGH 4MA8H 3N06B 4PG2C 3LB6D 4FFYA 1BOGA 1MFMA 4LSSH 1MJ7L 4IBUA 3NESA 1MCSA 4I9WD 3MLTB 1MW1A 1CXFA 2AGJL 4F3FB 2KH2B 4D0DA 1E67A 4PG2A 1DQMH 5E08H 4RMBA 1IUZA 1IGCH 1T6BX 3C12A 1LO0L 4PLJC 4FKEA 1AQHA 2VDRL 4OZHE 2CZNA 2HJFB 4OQTA 4JRXB 2BNQB 3VXSB 3FUHA 3KS0J 1NZRA 4HJGB 5T3XE 1FH5L 1E6OH 3T3MF 2EH8H 1QD0A 3AS0A 4C8XA 3HZYB 3HG2A 4U1LA 5HJ3A 2X6CA 1NMAH 4K15A 4MJIE 2VGLM 2J2ZB 3ZUCA 3LH2H 2B9AA 4MA1B 3O6KL 4PS4L 4NUJA 3U48A 2DQGL 2OULB 4G1EB 4HG4J 3GO1H 3G04A 4JANA 3HE6B 4ZS6C 3WJJC 2BSSB 1M6UA 2PPFA 1KGUA 1RULL 3GMLA 3PWVA 3QHZL 4A38A 3LVTA 1TTUA 1M71A 5ACZA 1HXYA 2FIRT 5FHAL 3VG9B 5HDWA 2WOYA 3WJJA 1AOZA 3GTNA 3K6OA 1HH6A 4P5MB 2HVKB 3UXFA 1Y0LB 1SEBB 2J8UA 4FQ1L 4BK5C 3ZZLA 5EOQL 2OR9L 4MXQC 3UTZB 4FQPA 2FJGB 3KPSA 1M9SA 3L9EA 2F7QA 4JM2C 3X3FL 3FQUB 3UEZA 1WAAA 2NR6A 2EDTA 4BK5A 2ARJQ 1WFOA 4PG9B 4WHTB 3DVNB 1VESA 1NCBL 2VR9A 5C0RH 2AVFA 3CHSA 4YDJB 5F1IA 2FB4L 3CMOH 1BZEA 3UZVB 1YMME 3ARYA 2FWUA 2H6UA 3LD8C 1PGRB 3UAFA 3B7RL 1MW3A 1TCMA 1MFVA 2X1QA 5FO2A 1LDPH 3POCA 3QPQC 3QS2A 2VDQH 4DQOL 4J6IA 3OMNB 4MMXB 4JPWH 3HS9A 1DQQA 1I1YB 1AIFA 2YXVA 4LNRA 4NWTH 3V0DA 3VXRD 4ZTPH 4WI6A 1AIZA 5C0CA 2LLGA 2X9YA 1ZEAL 1CDGA 4YSRA 1CPUA 2KDGA 5IFAL 4LCWD 1J1PL 1V8HA 5L6YH 4AQEA 4U1KB 5HYFA 4AMXA 2Z93A 3TA3D 2X9XA 4JAMA 1X9QA 4PBVC 4ABWA 1BAFH 1ICTA 1F3JA 4DP9X 1A0QL 4K7PY 2VJ0A 5A1AA 5F9OL 1IRAY 1IE5A 3BW9B 3KE0A 1I3UA 1NEZB 3AW5A 5IKCB 2Y7QA 4MKTA 3NCCB 1HHGA 2Y7OA 4FC3E 4JRFA 5HDBB 5DJDB 2AXFA 2QKIA 3FB8B 5IB2B 4J3OG 4P9HL 4AGQA 4P4KA 1W0WB 3SCMC 1NOAA 1R5IA 5GS1B 3N04A 4Y4HB 1N3NB 1V3LA 3MUHL 3ASWA 2XI9A 1U58B 4Z3EA 2C8NA 5GSVB 1ZK5A 2CLRA 1EJOL 3MUGA 4PJEF 5DA0B 2YHGA 3SCMA 1CO1A 2GAZB 1O7DC 1OD9A 2IMNA 1B2WL 4R90H 5LQBH 5KZCB 5FA4A 3TCXA 3U46A 5DUMH 1BJ8A 4XTRD 5ISZE 1RZKL 1OAUH 1WZMA 3QE5A 1IAMA 3N5AA 5FHBL 1NDMB 1YNTA 2EYTB 2O6FA 3UBXI 3NPSC 1C5DB 4G8IB 3U0TA 1E28B 2X2IA 1WEJL 4UIKL 2AJUL 1Q90A 3N0PB 4C55A 3C5ZB 2IDSA 4F1SA 2ZX7A 4XPTL 1JVOA 4WTQA 4D3CL 4U7SA 5AAMA 1CGSL 2EUZA 5A16B 5K39B 3CE1A 4YDVB 5I5IA 2NDFA 5MENE 4EUPB 1QACA 4HMCA 1UZ6F 1QI4A 4WY7L 4HH9A 3HUJF 4P3WA 4R4FH 3GKWL 2ORBL 4KAQH 1AD0A 2QELA 5ICYA 5CGTA 5EPMB 1C8PA 2XG4B 1RL1A 4FNPA 4APQD 5E9DB 3Q8CA 4FYRA 2F58H 5ALBH 5IF0A 1NEUA 1QSEA 3QUKA 2AK4D 1J9RA 3EUDA 1T1WA 5KBDA 2A4CA 3EOYG 1GA2A 1YYLH 1AKPA 2HKAA 3SQOL 1DBAH 3ELQA 3G5YA 2DRUA 3INUH 5CN3A 4JJ5B 3AMKA 2V33A 1QSFA 1JNNL 3IWVA 3QCTH 5DD6B 1CLOH 3D4CA 2BOCA 2G2PA 5FS5A 3VRJB 1ONQA 3SN6N 3MRQB 1IAIL 2V17L 4MAYC 4MCZA 3TT1H 3L3JB 1L6ZA 2VDMH 4XZ4A 1AKJA 1ETA1 1EHNA 4HWZB 3ZTNH 1HZHL 2DLFL 3K72A 5AALA 4NP4H 1NMBL 2QSCL 2BNRD 3CBKB 1BXXA 4ZOEA 5AW2B 1ORSB 4EBQH 4MAYA 5T1DH 1A7PH 1RP9A 2UY6B 1QPPA 1I8LC 2DQHH 2B2XH 4UB0L 5T1KB 2HP4A 4GMTL 4B0MM 1J5OH 2P5ED 4W9HC 2DBLL 5L9DH 1KFGA 3PQYD 1KLGA 1I8LA 2ISDA 3V5HB 1REIA 4XODA 4OIFA 1NCAH 1RJLB 5KN5A 2J6WA 1T7WA 5IB4B 4NCC1 3NCYS 2NUTB 4JE4B 1UWGH 3UPCA 3ARRA 2CJUL 3FH8A 1JPST 4LPWA 4XX1G 2Z64C 2EO1A 2F8VA 4Y2DC 5DJCA 3F58H 1QFWM 4QGTA 1UVQB 5AOIA 2IGFH 5TDPB 5BRZD 5C0AA 2WXOA 4P2RD 4XCEA 1JPGB 4IRJD 3OXRA 1G9NL 1JNJA 1KJMB 3B2MA 4Y2DA 4APXB 2XKNB 4L8SC 4M3JA 3L4XA 5D1XD 3N9GL 4Q9BA 4LP5A 1BQLH 5GJSL 2BP5M 1PJ9A 3MGOA 1MOEA 1T1YB 4NQVA 5AFAA 5KYYA 2WCPA 3DO7B 2E75C 1HL9A 1KPVA 4ERSL 1WCQA 1TNMA 5AVQB 1IBZA 2WC7A 32C2A 5JQ6H 1FV1B 3GSQA 1CE6A 4RFOH 2WMPB 1ZKAA 3QZNA 1KGXA 3EJJX 4GQPH 3HR5A 5EBLB 1WS7A 2P5WE 1R3KA 2XZQH 3IDYC 3OKNA 3NDYE 4XPFH 5I1LA 3K6SB 2WK2A 4KJQD 3APMA 4LF3A 4FAAB 1KSRA 2NYKA 3RPBA 2VDLL 1KLFB 3WFCL 5I73C 5K9OA 4XMUA 1WFIA 1ZV5A 2P43B 2UWEA 2A4ZA 5KJ4A 5L2KD 4LMQI 2IBGA 3X2QB 1D9KC 3MLRL 4ZO7A 2BS8A 4JY5L 2R0KL 3H8NA 3P0VH 1WICA 5D7IA 1RUAL 2C3WA 1Z9OA 1B88A 1LWRA 1J9TA 5HVWA 4LSUL 3IETB 4N90E 4YHOH 2B0SH 1D9KA 1IBBA 3QG7L 3S4SB 4IRSC 4P2YA 2QPSA 1LO3H 1SJEB 3OPZL 4OQ1A 5AVTB 1S7WA 2XKUA 1QPXA 1SLVA 4M1DL 4DP1X 3VW3L 4OCMC 5CBAB 1TNNA 4IRSA 1X7QB 1M6OA 5E4OA 3REVB 1PF3A 4JZOA 2TSBA 1TPXC 3G6DH 4D9RD 4LVHB 3DX9B 3NIDF 5E95B 4ANXA 1C5CH 3KGTA 4TSCL 4FA8A 2OW6A 2XWJA 3HNVH 4F20A 2YFNA 2WLMA 2VSKB 1S5HB 1F3DH 4DVBB 5HJBA 4Z18A 1RCYA 1FGNH 5DWUL 3T2NL 3TO4D 4DZ8A 4NKIL 5IB1A 4GY4A 3RWIA 3PJSA 2PCPA 4M56A 4DFIA 4R4NC 1HQ4B 4E41A 2A74B 1K4DB 3OKLB 2BDNH 3THMH 3MLXH 5CLWA 2CCWA 1XBDA 2MTPA 2QVMA 4EKXA 1OARH 6FABH 3MXVH 3OQ3B 2IQAA 4IW4C 4QXTB 4B27A 3DX2A 3KDMB 3GBDA 2AXWA 1DBMH 4F37K 4NNXA 4AL8H 4KQ0A 2BOBB 4M02A 2IPKA 1TZGH 3WENA 4GSDH 1AMXA 5AVXB 2BNUA 2E27L 4ELMA 1RI8A 5A6IA 1V7MH 3BVUA 5F71A 3UZQB 3QP3A 2E0PA 4UTCA 1DQLL 5JPNC 1CU4L 2J8UE 3NTCL 3T3MB 3BZ4A 4H0LC 3OAYK 1TFHA 3FB7B 4XGZA 5CZKA 4WFFD 4HUCA 3WYRA 3GC3A 4ZW6A 1G4MA 2H1LM 3U2IA 5I1CL 2ZCKL 3RL1A 1ZDQA 4HS3A 3UERA 5F97E 3VFTA 2EXWC 3VXPB 4GAJL 5E6ID 3OSVA 5TJWK 5DMGD 4RGOL 5DO2D 1BD2E 1YJDL 3CFJA 1X6NA 1F3DJ 4QMEA 2A3TA 4FF9A 4CMHC 2Q2EB 5J0BA 4KO5A 1XCTA 4EI5A 3X1EA 1Z9NA 1LEKA 2PTTA 3A6OA 2WUBH 4F2EA 1L9SA 4N9OB 1A1OA 4U1MA 4F7KA 4K3GA 1U8QA 1ASPA 2RALA 3S36L 4G6AC 3WMQA 1BAGA 2X12A 1KCRL 2OL3L 5FV1L 5GJTH 2A73B 4MJ5A 5IQ7H 4YQXL 4O2EB 4KHXL 3ZDYE 4LCVA 5C0CE 3MO1B 3O6FC 3S3PA 2H0FA 3PS6A 3MRJB 1LXMA 3QNXA 2EDOA 4PB0L 4V1DB 3MNDA 4ORZC 2FGZA 1JDAA 3W0WA 1MUJA 3O6FA 4PTUB 1BW8A 1TQCC 4RAUB 2EH7L 3WGVB 3QXAA 3MLPA 4JY6B 1OT4A 2EC8A 5EWIL 3NZ8A 3V4VA 5T3ZE 4G1MB 2X4OA 3RNQA 2P7TA 5K69A 1JHLH 1TZOA 1AXTL 1DVFC 3A24A 3BH8A 3JTBA 4ZFFB 5D2LA 2R2HB 4L18A 2I85A 2EO7A 4HF5H 1ZGLP 4JFEB 5D70L 3AG1B 1KEMH 4TVUA 5I1IH 5INCB 1LYQA 1OGAD 1X9UA 4XBGB 7FABH 3MR9A 4O4YH 5LBSL 1LK2A 2FSEA 2K8QA 4DESA 4JK0D 2Q8BL 3VQMA 1CYGA 4A2HA 5IUCA 4L3AA 3GSWB 1JVKA 1INEL 1RIHL 3FT3B 3JV4A 3ZTEA 5AB9A 1F56A 1M05A 3VFVB 1PDKB 3MRPA 3UO8B 4PRIA 5ESVB 5J9PB 4JG1L 4W9CC 1I7UB 5D5MB 1O7DE 3RUGF 1BVNT 2NY2C 1NL0H 3QNYA 4OAWB 1N4XL 4K3DL 3QO1A 4MJHA 2NW2A 5KAQF 3O3DB 2W65A 4ANKA 4M7KH 3D52A 3CVHA 3OLDA 2ZOOA 5FGBC 1BLIA 4WO4C 3TCTA 3UJJH 2PCXA 3TN0D 2CA4A 1MZZA 3B34A 4LGRB 1KJVB 3B9DA 4XVTL 2GJ6E 1M7UA 1NMCB 4JY4B 4HAKA 4Z7NE 5AUMA 5FGBA 4IKNA 2CKBA 3MROA 1TYEB 4WO4A 5T33H 3ZYIA 1U6AL 4FX5A 4XNMB 4PGEA 1W16A 4OV5B 1W72H 3B9KB 3IDGA 5DVPA 2JK5B 4XNBA 2VQUA 1QQDB 5IREA 1YY9D 1TU2A 3W9DA 3MRDB 5AB1A 3VG0H 4L4VB 5DQDL 1QSEE 5AB2A 3SDXA 1JRHI 4XXDA 2FO4B 2HVJB 1NBZA 1ADQA 4MBOA 5D7HA 4HXBL 4X7TB 5CILL 1DFXA 3TASA 3QORB 3K3QA 5CEYB 1U8LA 2JWYA 1RSYA 2QDVA 3LVEA 3EYVB 1KGWA 1QSFE 1ZS8A 5FYKD 2AEPH 2EE6A 5C08B 4NUQA 5C0RL 2VSMB 4MQTB 5EBMB 5C0GA 4AG4H 2PO6B 2XACC 1RV6X 4LOUD 5BVJA 3IDNB 2D8KA 4YHZL 4YH6A 1NEPA 5JORB 2FX9L 3IDJA 3VFSB 5SWSA 5HPMB 4P9MH 2JB6A 3OHXC 4UM9A 2AEWA 3L5IA 2Q1EA 5FW8A 5CBEB 4XMKL 5CZVL 1BHGA 3HG3A 3FB6A 1AO7B 3TYFB 2Z8WC 3QI9C 4P07A 4RETB 5ABAA 2ETWA 1UKTA 3OHXA 1HK6A 4M6NH 1D5XA 2ZXWB 4TLKA 2MQ3A 1LK3L 4L3FA 5IW1A 3QI9A 1KIRB 4ABVA 5T3ZH 2ZSWB 4OGQC 1OQOA 3ZDXF 4MZIA 4NEHB 1ODUA 3FT4B 3QIUD 1J87A 1RZQA 3ARGD 2ZAIA 2P8LB 3NH7H 3FYEB 4AMKL 4X5WB 1B0RA 5BW7C 3I9IA 3E9TA 4Z95H 1MFBL 4Y7OC 2BY1A 4HIHB 3PUCA 3R06A 4RMWA 4NRYA 4KDWA 1G7HA 3DUUB 5TK4A 3WNMA 5C0AE 4F15C 4M03A 3SPHA 3MJ8B 2RMNA 4ZW3A 3PABB 4UM8A 1KULA 3DTUB 3KD4A 1WC7B 3F65A 5KYWA 2ESVE 1YDPB 5KBLA 4PV8A 2OZ4A 1IB5A 1RIVH 1L0PA 2V5YA 2J44A 1J5DA 1R3JA 3M07A 3RPIA 3U1SH 1SNRA 1U3JA 3DNKA 5EU3A 4UOQA 4GSXA 1TQUA 3RWCB 5F0MB 4I1RA 1PTZA 5DYOB 3VI3B 1FLRH 1YNKH 3SQBA 4B5EA 4WK0B 3EJUA 3HI5L 4KH2A 5H8DA 2NY0D 3L08A 1MDTA 3BWAB 3A5VA 3ULVL 3G6AB 2EC9T 4G3YH 4QHNA 2W07A 4NYLB 1VACB 3F3HA 1Q9WB 1QWHA 1HHIA 3CN0A 3HZKA 5D7IE 1CFNB 5HSFA 4NFBA 3GRGA 4WEBH 2VQ1A 4YEFA 2WLJA 1TF4A 4Y4KC 3WS3B 3DKHA 4MQ7B 3RZCC 2R0ZH 3CFUA 3MRGA 1YA5A 4POZC 4E9XA 1S5IH 2HFFA 3AY4C 4KTEH 4Y4KA 3ARUA 1LO2L 3UTTE 1AMYA 3P4OB 3FRPG 4XNQB 1AGEA 5F7LB 1CLCA 1A25A 2MCPH 3AY4A 5DVOA 5BV7B 2IALA 5IVXF 3TWCL 2FEDC 1DSWA 1GYUA 2YPLB 4U6XA 4GXVL 1J86A 2WP3T 1FZMA 1GTFA 2VJ8A 5KVEL 3ROOA 1G6RL 1RURH 4E41E 1Q94A 3F6LA 1N59A 1AZBA 2I60H 4O58L 5DR5H 5C0FB 4CL7A 3BCDA 1GL4B 1B4LA 3IMUA 2VIRA 2X0WA 1ZIBA 5E8PB 3OXSA 4GOSA 3QNZA 2HH0H 3D85B 3NIDB 1LM8V 1RK0B 2VO5A 1KGIA 3UIYA 1NAKH 3D0VA 4OGYH 1E9OA 4H7VA 5EC1A 3OZ9L 3KL0A 2JLLA 1KNOB 1ND0A 2KHAA 3BAIA 1T4KB 2NNAA 1KJ2B 1FHGA 2P44B 1J8HE 4H88L 5KVFE 4P23D 1ZLUH 1WK0A 4Z6AT 2G4GA 1J1XL 2IPTH 2VAJA 3JWNG 5LGHH 4YIQB 3PNWA 4ABUA 4KNUA 5F7WC 2A77H 4X9HA 4JB9H 3MRHB 1T1ZA 5J13B 5IQ9A 1WZ1H 1P69B 3GB7B 2X0VA 2ZONA 1FFPB 3QUXD 4HBCL 2UV3A 1KPRB 3OB0H 5HHOB 2DD8L 5BZWB 2ATPA 3QJXA 4M48L 1RVFH 2F1EA 3NA9L 4K8RC 1S7XB 3O2WH 2VUOA 4GW1B 4TV3A 1SVBA 2DI7A 4NNPH 1V10A 3DTDA 1MRDL 1YEEH 5C07D 3MRRB 2AS5M 1F3RB 4KKAC 3PHAA 5I26A 3LKRA 3VXME 3CDGB 5D71L 5GPRA 4YGAB 5DRZB 3SODB 2UVFA 1G9HA 2FR4A 3D69A 3OPUA 2XQ0A 2QKSA 3QZWA 3AQZA 4NN5C 1AAJA 2R4SH 4JPIB 3VRIA 4LSPL 4YFDB 1GS7A 3ZKQD 3LKSA 4DTGL 4M61B 1DSFL 2VH5H 5E2VH 5KVGH 1RSFA 3QZPA 3EGDB 1PY0A 5IBUB 3W82A 4PYGA 3W0WE 4FA6A 3TS8A 3T8XA 4PJXA 1EHKB 3N1GC 4BZ1L 2ZUVA 4AGPA 2G75A 1U3YA 1A7OL 3OKOA 4X5XA 4JRXD 2BNQD 1HQRA 3GK8L 3HPJB 4N8VB 4MS8D 3U4AA 5L88L 1BZ7B 1O5DT 3QC5X 3SY0A 1FNGB 3MA9L 5D2LE 2P8MA 1DCEA 5J11C 1EO8L 1ACCA 3QRGL 2X4RA 1RUMH 4F2FA 4YAQA 1EEYB 2BHZA 3C2AL 2V2TA 1CL7L 3RYMA 1WPCA 2B4CL 1TJHH 4UT6L 3WDHA 3DI3B 1T4WA 4ZO9A 1N0LA 3BP4A 1GTNA 3BKJL 3KYKL 3HE6D 4NUMA 1MIMH 4J3WA 1WHPA 4MD5B 5FB8B 5I17B 3S5LB 2GUOA 3L7EB 3T0AA 1I3VA 4RISH 3OGOE 4MQXC 4F7EA 4FP8L 4DKFH 4AK1A 3A4FA 4PM1A 5L8JB 4WUKL 4DNLA 3SJVA 2KUTA 2Q3XA 2W0LA 4DETA 4B96A 4GO8A 3O8XC 2R2EB 4FI6A 2WZAA 1IBYA 4HC1L 4YX2H 1SN2A 3PIQA 3SGKC 2Y3AA 1XIWB 4DVRL 1D5IH 4Y9FA 4IRZL 3QFJD 1P6FA 1VFMA 1ZGLM 1KTLA 4ZMPA 1KY6A 4FI8A 3HHSB 1T04B 5MEPB 3TBTB 3MOAL 4IMLB 3FO1A 4XMLL 3SGKA 3NJHA 4YHLL 3ZDZF 1IC4L 1CFVH 1MXDA 4DHLA 1L9NA 5KVFH 1T0NA 4AWJC 3I6KA 3RVVD 3BWUF 4KROB 3WFBL 3BPOB 3VE0A 5BVPL 1SDAB 2WVTA 1EBAA 2VN3A 3L1OH 3RUGB 4G6MH 1INDL 4JFUA 2JTDA 3ZPDA 1A6PA 2NTFB 2ENJA 3C6LC 3CHRA 3IN0A 1F11B 4X0KA 1P4LB 4Y7MA 5AG9A 1A4AA 1YNLH 3FUIA 2Q76A 5HVHB 1HI6A 1KFAH 2C9UA 1KT2A 3C6LA 3OV6A 2DM4A 4FQHA 3O4LB 1Z5LB 4GQRA 4KXAA 3D9AL 1SYVA 3WEXA 2C26A 2HTKC 1P0SE 4L5FH 4E9RA 1NJ9B 4ACTA 3EDEA 5I1HL 5DEZA 1OB1A 2YD6A 4PVLA 2OXGA 5SX4I 3DX8A 3LB6C 5J1AB 4DN4L 4K94L 3W3BA 3US1A 1S2EA 1KMGA 1USQA 4RBPH 3TURA 3KM2A 3QYNA 4XBPA 3FFDB 2OMVA 3HZ3A 1UYWL 1CC3A 3ZTCC 1BREA 5DTFB 3N43F 4Y4HD 3IJYB 1FZKA 3HR6A 1K5NB 3I9PA 4JFDB 3SPIA 3KWXA 3OR6A 4NO2B 2DWEB 4XT1C 4ZQKB 5I2IB 3BUIA 5AW4B 3WTYA 1BGXH 2ODHA 3QFDA 4DP4X 4HPYL 4OZGB 5HHME 2C1OA 3RY4A 2C3XA 5KZCD 2E46A 5A43C 3LN4A 2VXTL 2EDWA 2EZ0D 1H5BC 4M5ZL 4NZUH 3RFZB 3HC4H 4ZUWB 1T6WA 3AQYA 1QEWB 4NI6A 2DH3A 1ROWA 3AU1B 4L9LB 4HEPA 5M94B 5H94A 3B3IA 3WI9A 3ARTA 4X4YB 3IJSB 1DQJA 1H5BA 2FLMA 4TNWK 4BFJA 3C5ZD 1NFDE 4U3HA 2J5WA 5JHLA 5CUSH 1TQWA 5AZEL 1FWXA 3FUJA 5IHBA 4QIRA 4XVJL 4MLSA 2OQJA 3BGFB 3HJEA 2BWQA 4M7LL 3I50H 4R5TA 2W9DH 2Q6WA 1JPFB 3SYAA 3EO9L 3B2UD 1BEYL 1H6EA 5F3HA 2JQAA 2VYRE 3U6RA 1E8YA 4YXKH 3ILQD 3I3BA 1NANI 5DHDA 1EDQA 4R7NA 5E9DD 3FO0L 5HY9A 3SKUD 1VPOH 1V3MA 1SLXA 3FO2B 4NJAH 4V33A 1IJ9A 4FLHA 4G42B 3MACH 3RWEB 4OF3A 2VR6A 4HIQA 5I9QB 3MRNB 2KZKA 1OB0A 2SEBB 2WXGA 5CJOL 2DBJA 2HX8A 4G80B 1KCSH 4QRFA 3JUZA 2E47A 3L3DA 5CGMA 3RVUD 1MY7A 3CXDL 1UZGA 3WHE0 1PYWA 3VWKB 2F15A 1YC7A 4KI1A 3LEYL 4HAGA 3VH8A 3LPWA 4Y1TA 1QEXA 1S7QB 1F8TH 5ES4B 1F6FB 3AQXA 3BH9A 2CH8A 3CTTA 2R2BA 4URTB 2E3VA 3FQTA 1ZHBA 3CFEB 1KCBA 1UA3A 1MAKA 3I75A 5DJ2A 3EYSL 5GGTA 1AGFA 2X2HA 3VXRA 1KTBA 4FFZL 2Y36H 3RWHA 4WUUB 3ILEA 3NFNB 4K23H 4OCYH 3DO4A 5D4JA 5FKPB 5CS7A 4HJJH 1CBVH 3E80A 2Q7YA 2GSIB 5CZXD 2YRPA 4LVEA 2ZOWA 2AJVL 2EINB 3P4NA 5T1KD 4HPOH 4BZ2L 5L0QC 1CGTA 2VDPH 1RZPA 3AJ7A 1GW0A 3TA3A 1NAMB 3SGEH 3V52H 1ZT1B 2DMHA 4HXAL 3QJZA 2FEEI 4XZUA 4IIZA 1AP2B 4R84A 4KTDL 1OL0A 1OOWA 3B6SA 5FO7A 5D7EA 1YCSA 2B59B 4TSBL 1BJMA 4MDRA 4PJBA 5DEFA 3QEQE 4LSRL 1MFAH 3IDUA 4JFOA 4NPYB 3BXNA 2YJLA 3KL3A 4JX0A 5IVXB 5JZ7D 4DGWC 2V2XB 1KCUL 3SGDI 1YYMH 2BJMH 3GJFK 3TPUB 4BUHA 1QFWI 5JXAL 5KS9B 5EOTB 1UB5A 2F6AA 4RQQA 4KKPA 4CVWA 2CJTA 4FCHA 1R3LA 2DW5A 3HKZA 3IJEB 3QQXA 4OZFH 3ESUF 5LBGA 4P46B 4KNTA 1RHFA 4JDZB 2AV1B 3WN5B 3MV11 1FCCA 1OGPA 2WVSA 2F2HA 4G8AC 4OCSH 1E50A 1JE6A 3RVWD 3MLYH 1CVRA 2FLRT 2B39A 5GSRA 1Y18B 4CA4A 3W37A 4J3OF 3PU7A 3QEHA 4KZDL 4OF0A 3FRUB 5CCHE 1CIDA 4HX1A 3NN8A 2NY4B 5F6HI 5AAWA 1EXGA 2E9GA 2ZCLH 1EGJL 5LXGL 2JXMA 3MCLH 1J0JA 3RA7L 3OWRA 1F86A 2ERJB 4APQC 2IJ0C 2LTQC 1CD8A 3VSQA 3WNKA 1BVLA 3HI6H 4XO9A 3Q2WA 3BAYA 4GQ9L 5DZPA 3LZRA 1IBGH 4APQA 4PJDB 4ZDHA 2HRHA 4AEHL 5E0QA 1AHWB 3KWVA 4W1TA 2AK4A 4EIUA 3JWOH 4FABH 5HBBA 1XGYH 1U0QA 4W6XB 3A6CL 2X09A 3FUNA 3H4HA 3U0WH 1HSAB 3UADA 4A7TA 1Q0XL 4I0PB 4RIRA 1UACH 2AJZB 3L2MA 4M43H 1AHKA 3CMGA 2GK2A 4N1HB 1BX2A 1RJZB 4OH2A 5CGBA 4NBZB 3NK3A 1QYGH 3BGMB 4N3UA 4PUBL 3APNA 1CLYL 1CGXA 2A9NH 1MFCL 1XR9A 3IBOA 3D06A 4YHPB 1MRCL 2FECI 3SDAC 4IJTA 3BIAX 5B1CA 1I75A 2BNRA 1UUSA 5C70A 5LGKA 4ADJA 4NKDB 1RZ7H 2WKOA 4OW6A 1XR8B 3DJSA 1E8WA 1UOLA 1FORH 1JRHL 4U6HA 5DJ0A 2FVNA 4PY8J 2HLEB 5E6ZA 2P5EA 3F6JA 4XPBL 4OKDA 1RZKC 3PQYA 1XGUB 2A6JB 2EDYA 2VR5A 1H6FA 3FT1A 1WZKA 4JPVL 3ZKMD 3FQWB 2O5YL 3ILPA 4N0RA 4N9GA 1N8ZA 1RIUH 1EAPA 1GCYA 2C3GA 4ZMAT 5DK0B 4HD9A 3U4KA 4CBPA 4UT9L 4IRJC 3SJVE 4G7QB 4L8CA 2W60A 4DP2X 1W8OA 4N6RA 3UROR 4FHKA 5D1XC 5BRZA 1DBKH 2EIZA 4P2RA 4TLSA 3SHSA 1I85C 4IRJA 1ZTXL 1HL8A 2TRHA 5TE6H 4TSAH 2OMUA 4H25A 1HIMH 4AUYA 4I18B 2CRZA 3ALXA 5JDSA 2I9TA 3V4LA 5D1XA 1TTCA 1LD9A 1ILUA 3N44F 3FONB 1JDCA 1I85A 4TS6A 2Y07H 3L6FA 4PRBB 5A7EA 4Q9RL 2CE6A 1NSNH 2VM3A 1OAZH 4F7CB 3UOAB 3PWPA 3MV8B 4KJQC 4DW2L 2VLRD 1AR1C 1U8HB 3CD4A 4HLZH 4UOW0 1HWHB 5C0ND 2AQTA 1SUJA 3I02A 5EZOH 4LSDA 5JW4M 1XXFC 4H0GA 1O7VA 4NJ9L 3O0RH 5C0EA 2ATKA 4TPRH 2R39A 4KDTC 3FQRB 4NC1C 2VC2L 5F3BB 1R5WB 1ZHLA 1CFQB 2DDQH 3EZ8A 3FB5A 2UUDK 3B5TA 4YXHL 5L2KA 1G6VK 1IARB 3HN8A 5ABDE 4HEPG 4Z7OE 3MBWB 2BY0A 3HJ0A 3ZDZB 4Y19B 2WYZA 2DZEA 3LDBB 4V1DD 1K2DA 4LE8A 1E5AA 1KXVC 1Q0YH