5JYMA

Human p-cadherin ec12 with scfv tsp11 bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Cadherin-3
publication title Disruption of cell adhesion by an antibody targeting the cell-adhesive intermediate (X-dimer) of human P-cadherin
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5jymA01
4ZI8A 3LNHA 4ZMQA 2EE0A 2QVFB 2WCPA 3K6FA 4ZMLA 5JYMA 4AQ8C 4ZMNA 2X2UA 2OMZB 4AQAA 2OMVB 4ZTEA 4NUPA 2V37A 2WBXA 5CO1A 3K5RA 3Q2NA 2WD0A 1WUZA 4AK1A 4NUQA 1WYJA 2WHVA 1ZVNA 4NUMA 4ZMZA 4NQQA 4ZMOA 3K6IA 5DZVA 2O72A 3QRBA 3PPEA 4ZMYA 3LNEA 1NCHA 1O6SB 4AQEA 3LNDA 5JYLA 5CZRA 4XXWC 2YSTA 3UBFA 3LNIA 2OMXB 3MVSA 4AXWA 3K6DA 1NCGA 2QVIA 3Q2WA 5KJ4A 1Q1PA 2A4CA 3UBHA 3UBGA 3FF8A 4XXWA 1SUHA 3K5SA 1EDHA 2OMYB 4ZMPA 3Q2LA 2OMTB 1L3WA 3Q2VA 3FF7A 4APXB 1NCJA 2YQGA 2A4EA 2OMWB 4QD2E 3LNGA 1FF5A 1OP4A 1ZXKA 4ZMWA 1NCIA 4AQAB 4OY9A 4ZT1A 4AQEB 3LNFA 4APXA 4ZMVA 4AQ8A 4ZMXA 2OMUB 4AXWB 4ZMTA
chains in the Genus database with same CATH superfamily
3QSKB 1AD9B 4D0DA 5H4ZA 1KXQE 1T20B 2BDNL 3CSYB 2Q76B 5FYKL 2VO5A 1LDPL 1ORSA 3MV7A 3DVIA 4NSKA 3U6RB 1P4UA 1R47A 3GK8H 4HUXA 3QUMB 5JZ7D 5F89B 1FVDA 12E8H 3I6SA 3X13A 5HGBB 3KLAB 4BH8A 4S1QH 5T1LD 3L3IA 3QA3B 3PL6B 3JXAA 5IFAH 4TSCL 1G9EA 1G94A 3VQ2C 1SFHA 3ZHNA 5AOJA 5EBMA 5I0WA 3CDZA 2X28A 3T1WA 2VABA 3V5DA 4M4RA 4L4VE 2X2JA 1M6OA 3FCSA 4KOCA 1G7JA 2D9CA 3FB8B 3JWOL 4P2YA 1QMUA 2AEPL 3MRBB 4BHUI 2K45A 1NCBL 3TESA 4OB5H 4ISVB 1NAMH 1NSNH 1YNKH 2XSKA 3MGAA 2BC4B 4KJQC 4U7SA 2PWHA 5D55A 4FQXB 5C2UB 5LAXA 4PI2A 1J8RA 4OCXH 1KCVH 4NKIL 3LNEA 5CD3B 4KAQH 2CK0L 4PBWD 5HD8D 3MNZA 2H0PA 4AC4A 4NQEA 2OZ4L 3I3BA 3ESPA 4YDKH 1BFTA 3L4XA 2IQ9H 1XF4A 1I8UA 4YDZA 4YLQT 5F1OB 1SBBA 2CHNA 3FUIA 4HETA 3OG6B 3IRZA 5FW8A 4U1SB 3DHUA 2YD2A 2DI8A 4Y9FA 5GRZA 4FQLL 3LZFH 3D12B 4P57B 3PFQA 4X9BA 1JPEA 4LRIA 5HDOA 1LEKA 4F8OA 1T5XA 5K39B 3IXAB 3UZQB 5IVZA 3IDJB 4WW1B 4NC1C 1ED3B 3VYPA 4Q9CA 3FFCA 3CH8A 4JPQA 5CBAA 3ULSA 3K7UA 2AF2A 1T66D 2FEEI 4U6VH 3RUGA 3IDIA 1YNTB 4LF3B 4L8BB 4NM4L 3RIAK 4UQCA 3H0TA 2Y1VA 2QADD 2OW6A 2F08A 3RWDA 1SUJA 1E27A 2YKLL 4HLZH 5EOQH 3H9SA 4JY5L 2BVEA 1CXLA 1BWWA 2WBWB 3ABGA 3KPRD 5E1HB 3E9TA 2F2HA 2FEEL 3O0RL 1EBAA 1SJEA 4MS6A 1LO3H 1PYWB 4PGCB 5EA0H 5T1JA 4OLYL 4BRJA 5T1MA 5B1JA 1BD2B 2AEQL 2NTSP 2CBPA 5IEHA 5EC2A 3FONA 4LBAA 1DSFH 1HOCB 1ONQA 1HIML 3D0LB 3K2MC 5FCUL 3T0EE 1YEIH 2WXFA 4UM8A 2KQNA 2LW3A 2XBTA 4OF0A 1A7OH 3HE7B 3NSFA 4L4TA 5I0XA 1NEZG 4Z7NE 2NXYC 4Q97A 1CDGA 2G60L 4LLYA 3ARDC 3VH8A 4LRNL 3OV6A 3SDAA 1CD1B 3W9EA 5SWZD 1CK0L 3VX1A 3L2MA 1G1YA 1TFHA 2IFFH 4FQ2L 4LSUH 3FT4B 3GSVB 5EUOA 4LLVB 3RGHA 3GPSA 3UTTA 1MFCL 1N0LA 5IK3B 3KHQA 4ODHH 1VEMA 1HE7A 1UT2A 4HJJL 2GBVA 3F6IA 1DFXA 4J3OC 3E1ZA 1JXJA 2DBLL 1ZY9A 3MV7D 3QORC 4TUJA 1ZT1B 1HQRA 2BOBA 1KIRB 4DFIA 3SBPA 3BVXA 4X83A 2WTRB 2A9ML 3O6KL 4KTGA 4ZXBA 4ZUVA 5TH2B 3MRNA 1ADQA 4BSJA 2B8OT 3H42H 5HHMD 3VFNB 4LT7A 1O6SB 3NK4A 1R24B 4Y89A 5LLIC 4HXAL 2PR4H 5D7LE 1RI8A 2D2CC 3KPSE 4QRQA 1JHTB 3TBYA 1M7XA 3ARED 4L3EB 4RMSA 3WL9A 5A1AA 5AVYB 5KVGH 5TPWH 4U7KA 1UYWH 3KLLA 4JDZB 3X3GH 4RBPK 2ZUYA 2WBJA 4WJ5B 5IB1A 3BVTA 3B56A 1WA0X 4PB9L 4LL9A 4N2HA 4QRUA 4M02A 1BZ7B 1TJMA 3L1GA 3IMWA 3JBG7 4FYQA 2YPVA 2J1YA 3JV6B 2R0KL 1MAML 1JPFA 4ZW5A 1QTYT 4G72B 4E9XA 3HZKA 2EVHA 1UWGH 1CLOL 1QBLH 4HK3J 4UV4L 4M1DH 1CZ8H 3GSOA 1CU4H 4EIBA 3ISRA 3NMEA 3BKML 4ADGA 1N7MH 3B9EA 4Q56A 3V9FA 5E00B 1F1AA 1DE4A 3L4VA 5IVXB 4X6DA 1M2OA 3T3MB 2PTVA 5E94A 3SDDB 3WE1A 4L1DA 4KKZA 5F6IB 1D6EA 4QRTA 4EBQH 4H8PA 1EGJH 2V0AA 1VA9A 5CLWA 1CL7H 3N91A 1DJWA 3C5JA 2J1XA 3TV3L 5C0CA 4WEMB 5CP7B 5H2BB 1RIHL 3O2WH 1NDMA 4GY4A 1P5VA 2PCPA 3G9VA 4CKVX 3CCHB 4RA0C 4O5LL 3ARPA 1JNHB 1W6LA 2WVVB 3L95B 3EJQA 1BVLB 1LQSR 2K6ZA 3B7YA 3ZGHA 4K5LA 3ISWA 4F37F 4OD2A 3SKNA 1HHHB 5MERB 4FG6C 2YRBA 4Z8FH 3TTYA 3SODB 4BWWA 2C9AA 2VO8A 5FGCE 4ES9A 3BIAX 4NQXB 2BP8A 3EYUH 3GZOA 4X7SH 3PHQB 2HAZA 1KXHA 3TO4A 2UWEE 1G1OA 3UDWC 4AYGA 1JYVA 3EO1B 2A5UA 2VM4A 3FU9A 3EBGA 5CLZA 4WENB 4N2BA 3B5HA 5DD3L 1CTMA 4XNMB 1WYJA 1UWFA 2DICA 3AM8C 1HFUA 4EQ2A 4W9FC 1ESOA 4OGQC 4J3UA 4JZOA 1KB5H 5FKAA 1J1XH 3NH7L 3ARGC 3CFCH 2CH8A 2H41A 1O5PA 2R1WA 4RA3A 5I6OA 3FL7A 4LOUC 1FIGH 2XYBA 1UJ3A 3IGAB 1PNCA 4JL2A 4KQ4L 4JGNA 5AEAA 5EOCL 4EN3A 3T0VA 1GKEA 2AEOA 4FJYA 5F1NA 2J20A 1OY3B 3KH4A 2HRPL 3R06B 3S88H 1A9EA 3FS9A 4DT2A 4XN1A 4B9GA 1R3IL 3SGEI 3W5NA 1GGTA 1I1FB 5CEYB 3KPNB 2P80D 4I0CC 2YGVA 3QI9A 1ZDSA 1Q9OA 3LZPA 3BWAB 2YPKB 2VXQH 5F7FA 3U46B 3VXUE 3K0WA 3EFFA 4NZUL 4OM1H 1AZUA 1L0QA 4ZXBD 3V0EA 4LL4A 2JKIS 3B7RL 2MSPA 1S9XA 1NBZA 1O5DT 4CBPA 4QLWA 3CFJA 1RUQL 1J12A 3Q6FB 1AI1L 2GIYA 4KXZH 4PJGA 2V7NA 3U0TA 3L7EA 1KOAA 3HPJB 1TZAA 1OIOA 4FNLH 4Z77B 1KIQB 5E8PB 2NXZB 2Z35B 3CDGA 3QFDB 1QWNA 5BRZE 1B2WH 3HA0A 3APCA 1XSJA 1YPZA 3Q8AA 5CEXB 3UJTH 3R8QA 2LU4A 2E9IA 5D6DC 5EZOL 1DQLH 2ZWSA 1OAKH 4QRPA 2WCGA 2Z7WA 2WBJD 4UZUA 1JBJA 1QLFA 4FTVE 4JRXD 4PJCA 5J12C 5DK2B 4L0ZA 1E9OA 5E6IC 4FA8A 4JR9L 1A7PH 3E6FB 3D18A 1PX4A 3LN9A 4XP6L 1CFMA 3V5KB 4Y2OA 3D09A 4HBCL 3O3EA 5IR1A 2VDQB 3LRLA 2ID5A 3CSPA 1J1PL 3IM1A 4QF1A 1Y1DA 2LHAA 4K7PX 2DH2A 2QKIC 4I77H 4A2HA 3MN8A 3VD4A 2ZUQB 4OBRA 2CHDA 1ZT4A 4UQAA 1A4AA 2P9RA 3D3VD 3EYFA 3WUWA 3UBXB 5JTWA 3LKRA 4M8UA 1NFDF 3N9GL 3CVCA 5E7BA 4HMDA 1SYVB 1F2XK 5ACZB 1ZGLB 4IU2B 3WTXA 1I1RA 2R4SH 1NFKA 1IFHL 3F04A 3TIDB 5H35A 3QUZB 3P77A 5JXAL 3PWPB 3MRJA 4E41A 4DEUA 4ODVH 5DHVB 1XBRA 3DROA 5A3IC 3QDGB 2Y36H 4N3UA 3EFDH 4UF7C 4I9WD 5AVTB 5HGDA 5DJ2B 1CDIA 5IFHH 3SE9H 2NZIA 2RA1A 3FU7A 4FFZL 4UT7H 3WMQA 2QZQA 3RNQB 1PZCA 1TZ8A 2GQHA 3KXFD 4JQVC 1IEAB 3B2XA 4IRZH 1GZPA 5EN3A 3U9UA 2WYHA 2DM7A 3SE8H 1U8IB 2E7HA 4LFHG 4HX1B 1R3KA 4X4YB 3FQ4A 4CU7A 4MMZB 3ZKSD 4F1SA 1NCTA 5DUBB 1PCSA 4G1EA 3R0MA 4R7VA 1QA9A 2P43B 5JHAA 3CNKA 4LEOA 2F18A 1W8EA 4IRJA 4LP8A 1RMFH 4V2CB 3PWVA 3S37H 4P23D 1I7ZB 1NCDH 4X9YA 1LEGB 2BS71 2YWYA 4IGBB 4LLDA 5GGSA 3U83A 2UUDH 1QR4A 2CBTA 1EEQA 2VUYA 4HK3N 3IDXL 3SPVA 4Y88A 1BBJB 4MB4A 2QEJA 3REVB 3T3PB 4AIXA 5ETUA 1EDHA 1YQ2A 3QPXL 4FLHA 2BVYA 3VYNA 3QO1B 5LBSA 2BFGA 4GW5B 4AM0B 2KPNA 4F7MA 2VL5A 3RURA 1ZE3H 1OHQA 4D0BA 3FT2A 1LDSA 3UCRA 3VO0A 5I5MA 4FHBD 1WZKA 3GSRA 2YGNA 4X6CB 1KCRL 2FUTA 1G6RL 5ITFB 5LWYL 4XP4H 3UXFA 4A7GF 1JYWA 5HVWA 3PGFH 4K5PA 1DBBH 3EHBC 2D7PA 2ZKXA 3A6BL 4HSQA 1K3IA 3GFUA 1WBXA 4DN3H 1EJ6A 3H7BA 1MFEL 2DQGL 2DY2A 3D0VA 1IBHA 4N87A 1P4LA 2YBRB 5CGYC 3GKZA 2OX5B 4WNSA 1RZJC 1IE4A 3ZR5A 1HCYA 2Q8AH 4H1LH 2OMUB 2CLZA 4RNRA 1BQSA 4Z0XA 4NGHL 3UZEC 2BNQE 4RVBA 5J6HA 3PCYA 4N8VA 1H3TA 3ET9F 4G43B 1E4WH 2XNAA 1XZ0B 4JKWA 2LFEA 4P2OD 1G0YR 2VLME 3ZE0F 3GUTA 5I6NA 2P5ED 4R97B 1QYGL 4MD5B 1G7IB 2DPKA 5B39G 4B41A 5ECJE 3UEQA 1CG9B 4F9LC 2BIOA 2YAFA 4AQAA 5D8JH 2BS9A 1JPTH 1U92A 2FGWH 3OX8A 3WIHL 4YHLL 3ETBJ 2ADJA 4RAVA 1ZWIA 5T3ZD 3TFBA 2UZYA 3O11B 3C5ZA 1HHKA 1MIML 2A0LD 2BZ7A 3LRGA 4KTEL 4OLXL 4EVNB 2C9XA 2E5EA 2FIKA 1WDAA 2J72A 3MV9B 4ZBJA 3ZUNC 3ATBA 5B4MC 4X5XB 3D5OF 5JHLL 1KG0B 3M17A 1XR9A 3FRPA 1NAKL 5B38G 1E6JL 1FL3B 4X42A 3C09B 3V4VL 1ZGLP 4Y2DA 2VXVH 5DZVA 3GEFA 2Y0SA 2EDTA 4K9EH 3KL3A 3IJ8A 3TO2A 2FJHA 2VN6A 1J8HE 1N70A 4TQEL 3STLA 3UIYA 1S3RA 4JDVA 3S6CA 1QRNE 3SE3C 3F65A 3TBVA 3ZY7A 2DMHA 3RLSA 1TG8A 3NZHL 4O2FA 5K9OB 1TCRB 4UOW1 4Q6KA 3FBQA 4X4XB 5IW3A 5BQ7A 1UEMA 1NGWA 4HKJB 4IM8A 3MOAH 3NTCH 2GSMB 3WJMA 3BFWA 4GRWB 5FFLA 5FO9B 1DQQB 3F7QA 5JIQA 1NCAH 3J7HA 2ZOTA 4FG4A 1T7ZA 2BSED 2YJQA 5IMKA 2OFQA 3EJRA 4ZFOB 4WGVB 4XI5D 3T0WA 4G6KH 4JAMA 4OCSL 2YAMA 2F5BH 5DYOA 1EHLL 1KELH 3P40A 3L3HB 4EUPB 3FUEA 3ZK0A 5MENE 4HSCX 5D1XA 4YGVB 3QG7H 3KLHD 1A4KA 1U8QB 2NXYB 5EF3A 4LEXL 3FH5A 4RFOL 3SYPA 2QMKA 3ARDB 3FRUA 1H6FA 1BVZA 1E4HA 1HT6A 3G5VB 3LXCA 3H9YA 3ROLA 3RX7A 3WE6B 3IFLL 5C2BL 1D5ZB 2XKNB 5E2TL 2O6DA 3WS6C 1CLYH 3DX8B 4LEBA 3KYMB 4EPSA 4I4WA 4L8SC 2F8XC 3JV5A 5BXFB 4B7LA 2MPVA 4HJTA 5J56B 2XKUA 5C08E 4K3GA 1PZAA 1VGKA 4UIMA 2WN2A 4KRMB 4MB3A 5D70H 4WCYL 1O7DC 2COVD 4XAWL 5I0ZA 2LQRA 4NAMA 4TUUA 3HAEB 5I1JH 1DBAH 1OO2A 5E9DD 5KOVC 5GISH 4N2OA 3T4AA 3DO7B 3QRGH 3N40P 5GXBB 3FSWA 2EACA 5CSZA 4PJ7A 4GBXC 2GSIA 4HWEH 3TF4A 1UCBL 2V17H 1AO7D 3EGXB 4NQVA 3V0GA 4F8QA 3DRTB 3LAFA 5DRNA 2IEPA 1KWKA 1S78D 2XRAL 4HIEB 2ESVB 1J48A 1XSKA 5F7HA 3V5HA 1I1CA 1OAJA 4WI2A 3WFEL 3EUDA 2WXKA 3NFPA 1G7HA 1WAAA 3TIEB 1XCQB 5C09A 3NIDB 2IDSA 4GOSA 4EI6A 2IMNA 4WFHD 2Z8WC 1OLZA 3KPOB 1I9RH 1SQMA 1QSEB 4CDGC 3WTYA 1F4HA 3LEYH 1H0DA 4M6OL 4XO9A 1T21A 3ESUF 1MCJA 4GUCA 4OI8A 5D1ZD 2WUCL 5T5NG 4FXKA 5IESL 3S8WA 1SLWA 1KLFB 1PY4A 4A38A 5C9KA 4J3TA 1NPNA 5CGMA 2FATL 2MKLC 1GGUA 3P73A 2VLJB 1UOWA 4AMKH 3KL0A 1CBJA 5MEOA 4WFED 4WV1B 5D72L 1CICA 3Q13A 4F7EA 4JFOA 1IC7H 3ASOB 2F58L 4UT9L 3FTSA 4L37A 4Y1SA 2J8UB 1SN5A 2R1YA 2UZIL 3IETA 4S1RL 3PQYD 2XZCL 1N68A 2EJ1A 3QHFH 5HPMB 4FQHB 3TLRA 4J3BA 1NMCB 3VFVA 2EXWC 1CF8H 3BH9B 4BGLA 4BYHA 1XGRA 3QIBC 1FNHA 5F7MC 1MFDH 3NVQA 4OFDA 4AI7A 2O6FA 2NSQA 3EADA 4K55A 2RJMA 4LDEB 4PCYA 4UOJA 1Z9LA 4GQZA 1OV8A 25C8H 5MEQB 3CVBA 2JVUA 1F3JA 4FFYA 1GYUA 2Q8BL 2WAHA 3VFSB 3ZDZF 4CADA 1QASA 2Y5EA 3QPQC 4PJXB 4IRSC 2BSTB 3ZYJA 2H32B 3S35X 2AXFA 1RJLA 2D7TH 3W2DH 3RKDC 3W0WD 3BGAA 4B53A 5AZ2L 2VDKH 3EYOB 2J6EL 1VDGA 4XOCA 4MMXC 1T2JA 3C6SB 2WQWA 3KDMA 2JKRM 5SX4I 1PLGH 2IGLA 4NO3B 4HV8A 2GT9A 1MUJB 4LHQB 3S5LA 2FQFA 3HKFA 2DKUA 4KJWC 2ZKWA 2GK0B 2IXQA 2UYLB 6FABH 4XNQB 5CJQH 1YVLA 2Y07H 2A6IB 3VQLA 4P2RA 4KO5A 5E2UL 5ICXA 4Q14A 4ZS7H 5KWYC 4HGMA 4FQQA 4AJYV 1UFUA 3TH3T 1JWUB 4D3CL 3K8MA 5L7XH 4HT1H 2R0WL 4N2LA 2G0KA 1X7QA 3RTQC 4UU9B 3T8XA 1I3GL 1QLEH 2ZYRA 4YPJA 3OR6A 3K5RA 1RIUH 1GMIA 1K5NB 1N64L 2YZ8A 1NIBA 3KBHE 1DHKA 3OAUH 4AK1A 3QH3A 2G5RA 4N2KA 4PJ9C 4Y5VB 1GIGL 3QWNA 1RJYA 1XGYH 2QSCL 4KGJA 4PJFA 4M9OA 4MRBA 1VFAA 4U3SB 5F44A 3N04A 4KJPC 2VZTA 5HJ3A 3NZ8B 5A2JH 1V05A 4JY6A 4NQDA 1UT9A 3GTNA 1GGCH 2JI2A 2VMDA 1DVQA 1MF2H 4Q4IA 3T0EC 3FQXB 3SDXB 1U9KA 1L9MA 2C9SA 4QPEA 4IS6A 5CR1A 2RB8A 5F3BA 4WHYH 5J12B 3O6LL 2VB5A 1IT9L 1AGCB 4HIXH 1WHOA 3ECUA 3K91A 5E6IB 1VGEL 1F86A 1OE2A 4MS8C 2COQA 4J27A 1NFDE 2N3JA 4JLRA 2CO7A 4NQCD 4G80B 4P4KB 1ZVSA 2JCCA 5D7IB 3TH2T 3C6LD 1NL0H 4HAKA 4JG0H 5EU3A 5I73C 1T2QL 5AB2A 5D1QA 2P8MA 3KYAA 3QQNA 1LLAA 1ZEAH 4U6YB 4ZMPA 1NCNA 1R3LB 2QKIB 2X3CA 5G4NA 3GHBH 3MZTA 3TWCL 1VJSA 4X8JA 2PW1B 1JE6A 4L5FH 3OPZL 1RERA 1AGEB 4QXVA 3RWEA 2VDQL 4UNVA 2YEZA 5I30H 2JCWA 3RWIA 3UC0L 1BQHG 2B7DT 2ZOLA 4RWYH 3O41B 2Y1YA 5KJ7E 4QXWA 2EADA 2K4AA 1Q94A 4HIJB 3JTSA 4XO4A 3VI3B 4WSGA 4IKNA 1YG9A 1YYML 2XWXA 4B97A 5SWSA 1ASOA 2OMTA 4M6MH 1F90L 1LP9B 4KXBA 4JPVH 1ZHKA 5GRUH 2R7EB 3VE0A 4QNPE 1SFDA 1A14L 4P4RA 4ETYA 3ZE2F 4XB7A 4TQHA 5JA8B 1T80A 3CH1B 2WQVA 2JF1A 4LVNC 2YK1H 2NY4D 4I0KA 4D94A 1SN0A 1ID2A 3ECBB 4UBDD 1RZQA 5E2WH 3VQMA 3VSVA 3WFZA 4B9YA 4S1SH 4ZX5A 2QDWA 2HT2C 2OZ4A 4BHUA 4RMRA 4YSEA 5BJTA 1JZIA 4MXWL 2Z31D 3WELA 1VESA 2L04A 4I0PA 3TJPA 1OGAA 3C08L 3GUFA 3V0HA 3O6FA 4IOIA 5F0PB 3CIAA 4RISH 3IRPX 1YUKB 4ABUA 4DPCX 4DZ8B 1U8LA 3MRQB 3OZ9H 1CXEA 3AGWA 1X5GA 3VMPA 2G9HA 3KEHA 3QG6A 5C0BD 1DJXA 2DMGA 2L7QA 3L5IA 3L7FB 4P46C 4QTIL 4R7LA 2OP4H 2VXSH 4E42B 3CN2A 3TA3C 3U4BH 4Z76B 2EILB 4JPIA 1JNNH 3O3DB 4KFZC 1QFUL 5LBGA 4N1EA 1ET8A 1BSIA 3CFNA 3SCMD 3VXPA 1WD8A 4PJ5B 1SJHA 5GRVL 1IQDA 4LCWA 2YO3A 2BVQA 2PO6A 4U1KB 4ETQB 1A1MA 1Z3GL 1NFIA 3LS5L 4NPYA 3JZ7A 1P7KA 4BBWA 2WNGA 5FR3A 4KXAA 4QUOA 1IAOA 4JY4B 4FXGA 4XMPL 2MJWA 2W60A 4G9FB 4HJEA 4NX0A 5IY5B 1EZUA 2KT6A 3FT9A 4PRPB 4HUVA 3EHBB 2WB1A 2GBUA 4YE4L 4KV5F 1UZ8A 3MO1B 4W9HC 4YHNA 4YPGA 1LWHA 3HS9A 1REIA 3U1SL 2XICA 3V4UL 3LXUX 3MA7B 1YEGH 3BHBB 4UIKH 3BP6A 5IG7A 1C5DB 4JO2H 2EYRA 2X4NB 3AGVA 4AENA 1JDAA 3QIWA 4ZFGL 2ZSVB 1NMBL 1DLHB 1FVEB 3UYOD 1RZFH 1MSPA 1J9SA 4PJBA 1MJ7L 4FI7A 4DTGL 2ED8A 4I18A 5BNXD 2M83A 2EXYC 4YN3A 3DURB 4Y9EA 4DF9A 1MG2C 1SJXA 2X1QA 4L5FE 2MTPA 2NYZA 4R9HA 2X4TB 2TSBA 3PREA 1FRGH 2R56H 4XBMA 5KAQF 4ZMWA 3G9AB 4IMKA 1GGYA 4MJ6B 1KFGA 2AV1A 1A6TA 2G2RB 2DIBA 1IBGH 3DV6B 3VM5A 2HLAA 1D6VL 3NDYE 5FO8A 4N0YL 4YWGL 3NIGB 1YQVH 4AEFA 1L0XA 2XZQH 3TYGH 5GS0H 3TVMC 4XMLH 4N0UE 2ZWNA 1MCKA 1JF1B 4G5AA 4KPHL 4O4YL 4F7KA 3P4OA 5DFAA 5EU6D 4XCYA 4CNIB 3WYRA 3KGRA 7CGTA 3F64A 1SF3A 3R0NA 3WY2A 2R1XB 5E8OB 2I27N 3U9PL 1D5IH 3BFOA 1OARH 5IB4B 2O5XH 3DMMA 4JFSA 4K2UH 1QZ1A 1YEKH 2G75A 4KVNH 2P48B 1FWXA 4ZFZA 4ZSOE 3UAJD 1UEYA 4LASL 2Q2EB 3OXSA 4OM0H 4YDJB 5CS7A 2BSBA 2Y24A 4YUEH 3HFMH 3U30C 4FI6A 3X1FA 2E6QA 3S8FB 3HLAB 4G7YH 4OJAA 5DO2D 2DTSA 1B0RA 1MFMA 3UAEA 4DKAA 3GJEB 5ADOH 1A7NH 3HTLX 3HZVB 1S3KH 4GEJA 5HGHB 4GMSL 4ODTH 3S9DB 5CCJA 3TYFA 3RP1A 3NJHA 5IBUB 2D0GA 2FL5B 4GIOA 3X3FH 1UURA 5HGAA 5DS8A 1F3DJ 1BOGB 5AYTA 3HE6D 3N1FC 1BVKA 3APMA 4Q0XH 3GSWB 4HUNB 5A7EA 4OJDH 1RP9A 3EJJX 4XMVA 4I3SL 4QYAA 4J8RA 4NZJA 2NCMA 2G5UA 1MI5B 3GJFB 3B6SA 1KBPA 1WK0A 2C9PA 4LLUA 4GG6B 1DSYA 1HWWA 4ZUWB 4U2YA 4NNPL 4LHJB 2XWJA 2VT0A 1NC2D 2ED9A 2Z64C 3BVNB 2CLRB 1HKFA 2IDQA 2WPGA 4LVEA 4XC3H 3HRZA 3QNXB 2A4CA 1P7QA 5ACLA 1NANI 4QHKJ 1UH2A 4JKPL 1I9IH 1YEDB 2XA8H 4HZAA 4WUUA 1CPUA 1EAOA 2FX7L 2X4PB 3QQXA 1HHGB 4PJIF 5DFVC 4FQCL 5FA3B 3QYCA 5FGBA 2XG5B 1UM4H 4R0LC 4YDMA 1L5GB 2H26A 1KBGH 4GBXB 3ZQWA 4BSVB 1PG7W 1T7VA 3DYOA 5E8DL 5JOFB 5I8KH 2A9NH 4ZX6A 1BYOA 4FNRA 4YL9A 4CL7A 2A38A 4U3HA 5HYJA 4YBHA 1ZLVK 1I3VA 4Y4FB 4FX5A 1K72A 1BJMA 4HYTB 3BT0A 4FNTA 4IIQC 4A68A 1EK3A 1WO2A 2EEFA 4G8EA 4S10A 2NY6D 2FCBA 3HC3H 1HH9A 1N5AA 1TTRA 4RMQA 5G4MA 2I60L 1DQML 4YXKL 1N3NB 2ZKYA 3BLPX 4X5LA 2GSGB 2JJUA 5TQ2H 3FQNA 3GYRA 1P6AB 5I2IA 2CPCA 2KL6A 3DSFL 3OKEB 4KX7A 1NBQA 3QFGA 1UQSB 3B9KA 5T3ZH 4K0OA 3L3OC 3RVVD 1J8KA 5KYUA 4GH7B 4R5XA 5IMOA 1DO6A 5I82A 3AQZA 3RVTC 3QUYC 3EIFA 2ZZUT 3ZPDA 4L8DA 4FC3E 4P06A 4LAQH 3PGDB 1S4IA 1J9CT 2FSEA 2Y72A 3G5YB 3HW7A 2R29L 2W0LA 1AXSA 1JFQL 1XIWA 2WB7A 2NX5E 3UPRB 4AG4L 1QEWA 2DZEA 3GI8H 2FHBA 2CMRL 2VM3A 1DBJL 2XZZA 3U7YH 4PB0H 1RZGA 3F84A 4AX3A 5KW9L 2CIIB 3QIBB 4QTHA 3MSPA 4XWOD 2EE9A 3SO5A 4L4VB 1GGBH 4ORGA 5I1KH 3RB5A 5F6HJ 4PBDA 1W0WA 3FN9A 3PWUA 2MWCA 3VXSA 4IK6A 1OSPH 1K2DA 1D9KC 4OFYD 3HS8A 1EA9C 3IXTA 3PHOB 5DJXB 3LNDA 3P69A 2EDOA 2NQCA 1KSRA 3D39A 1E4KA 4LDCA 5IHUH 3JTBA 3LNIA 3MXWL 4IRSB 4X0KA 2EZ0C 2DQTH 4CC4A 5DHYB 4WEBH 4OIFA 3GDCA 4PJAE 3IJHA 3V6FA 5KG9A 5KJ4A 4AIZB 2E7LC 1ZVYA 2Q20A 2CCVA 3MV8E 4MMXB 5DWUH 4K3JL 5F1IA 1HI6B 3VXMA 1RUAH 3BLKA 3CZNA 4NS0A 4EI5A 2AQTA 2W5PA 4FLSA 4BINA 5BS0E 1A0QL 3GMOB 4JDEB 1ZGLM 4KMTH 2YUZA 1FGNL 1CYWA 2DM4A 1KTCA 3X1GA 1NCJA 2XETA 5E8EB 1I1AC 3BSGA 3D05A 3O6MH 3O2DL 2I24N 4JM2A 4RMWA 4W4OA 5BOPA 4MA8H 1EANA 3BISA 2VISA 3CLEL 4XP9H 5BCAA 1FV1B 3KM2A 4WO4C 2MOQA 4EDWH 5HHOA 5TF1H 3RVXC 5ESAB 5HGGS 5CP3A 2F8OA 4JQXA 1WFNA 3RTQB 4F5CE 2A6KA 2UXFA 1OTTD 2QFPA 2XQBL 3Q8FA 4XHJD 1S9YB 3US9A 1T4KB 1OSYA 1IJ9A 4PJ9B 4MD4B 1E6OH 1NEZB 4R3SB 2WZ0A 1MRCL 2H2SD 1ETA1 4NNYB 4FFZA 1X3DA 3WGUB 1L6XA 4U1LB 2Y7MA 2WCSA 4TVPL 2B1OA 2P5EE 2P5WE 5DC9B 4N2FA 3KPTA 2AJXH 4GMTH 2Z92A 2HFGH 3T0EB 1D2OA 3TOPA 2YD7A 1HYSD 3AC0A 4PJEA 4TSAL 4IHBA 1AE6L 4KY1L 2X2UA 5DRWA 1SF5A 3MGOA 4Z7NB 4KNTA 4BZ2L 5K5YA 2BPBA 3HHMA 4O2CA 4K7PH 1FHNA 1MFAL 4ELDA 1C12A 1X5YA 3FFDB 3N44B 4HBQA 1PEWA 1LJMA 1ZE3C 3C5SB 3FAXA 4F37K 4ANWA 5DVMA 5AZEH 4K5MA 1DQJA 2F53E 3GMRB 2ZPKH 2ZWZA 1SXAA 3LZRA 3CFBB 4N0RA 3A4DA 4WIQA 4XNYH 1S7WA 2WQRA 4XMKL 1KFAL 3J8F7 3R4DA 2VLKE 1XVSA 3D69B 5DDHA 3W9DA 4ODUB 2I7SA 3MCKB 3GEWB 1G7LA 4JO5A 3FW6A 3OB0H 2C1PB 4H26A 3ZE2E 1JTTA 5DJDA 3L4TA 2LR4A 4BGDA 1MCIA 3TL5A 1XIWD 1JGUL 4P05A 1HHJB 2DH3A 1G6RA 4NN6C 5CCKL 1H6TA 5FWQA 1MKFA 1E43A 2APWA 3KVPA 4CW1A 4YEEA 1R9FA 5D4JA 4WKZA 4FRWA 4UILH 3ZOAA 1E3XA 1U3ZA 2Q76A 3QAQA 4HK0A 2CNYA 2ITFA 1L9SA 3L9BA 3ARBD 3U6RA 5D7LB 3MBEA 3NAAL 4G71B 3KPSB 4YDIH 5ADPH 1IGMH 2ZXCA 2IGTA 1D5BA 5FFOA 1UB5B 4LHUA 4YHYC 1EHXA 5HGBA 4LVNB 4F7TB 5D6CB 4DVBA 2W1NA 1GYWA 3K2IA 5KS9E 3LH2H 1KC5L 4EDXB 1F4YH 4J3XA 4R4NC 4OJEH 2P8PA 2RALA 3ILQC 4FNQA 4K23H 1X5LA 2VSDA 1WISA 3FB8A 1F00I 4H7VA 2NR6C 4TN9A 5B1KA 2HH0L 1UWEL 2JJVA 3DYPA 4PV8A 2XPZA 3WIHA 3BZFA 4HKBA 3E9UA 1JI2A 1G5GA 4J4PA 3AS2A 4KI5E 3IAPA 5KSBF 3IKKA 1SZNA 4K9EC 5T5FH 3U4AA 4XO8A 1MFBL 2VW7A 3FSVA 2UVFA 5AAWC 4HCRL 4GAFB 1XO8A 2FEJA 3BN9C 5F88B 2ZD0A 3BAYA 5JHLA 3PNWB 3TA3B 4DERA 3REWA 43CAB 3HJ0A 2CDFA 5HHPA 5CAYB 1AO7E 4U1SA 4ZI8A 5JIKA 2FWLB 2DKMA 1M3JA 1MXGA 3CXFA 5EO1A 4UTBL 2I7OA 3AVEA 3DXAD 1BVNT 1FNSH 2VDMB 1CIUA 5K39A 5ID0B 3K4AA 3UZQA 3IDJA 1NDGB 3F7VA 4KKLC 1OZTG 4J1UB 5DK3A 1U6AH 2AGJL 1MPAL 2GJ6A 4PRHA 4NJAH 4NFBA 3RWCA 4XPTL 3V52H 3N42B 3QR2A 2F8VA 1FP5A 5FGCB 4PS4L 3ZQXA 5F96H 5I8EA 3OKOA 4KKAC 1U8NB 4MVBD 1T5KA 1AG6A 3CX5K 3NFSL 2UWEB 4JKMA 3SKMA 1P6WA 4OLVL 2HLFD 5I5RA 3IF1A 3SJVD 3VWJA 3BPLB 4A2MA 1TT6A 1S8DB 2LT9A 2DWDA 4A37A 4PJHA 4H2CA 1U8PA 1YRKA 3WDHA 1JFHA 4PGZA 1EZVY 1HOCA 3D0LA 4ZX4A 1RZJL 4YBQD 4QHLA 2KZWA 3D9AL 4D9RE 2IH9A 1UB6B 2X53A 3N3EA 5JW3H 3HMXH 2WQAA 3HE7A 2W9LA 5D4IA 2IPTH 5DQJA 3PABB 1QAWA 1R0AL 3Q44A 5DR5L 1QFWL 2JB5L 3CK0H 3ZRSA 3L9EA 1PLAA 1YEJL 3VDCA 1CD1A 4UQBA 4J3WA 2D3JA 4OCRL 4WWPA 1GXEA 3VXUB 4GKSA 3ULAB 4DZBA 5BW7C 3TVMB 3V9CA 4G8IB 3FT4A 3GSVA 4FG0A 4MAUL 4ZDHA 1BAGA 1FORH 4DP6X 3C60C 2CGRH 3WIIH 4WK0B 3MCYA 5GGRY 1DFBL 1OAQH 3QZNA 5DLLA 2J8HA 3OGCA 4HG4K 3POHA 2X09A 1E7UA 4W9DC 1KIRA 1L7IL 3G6JA 1CDBA 2Z91B 3QWOB 5BRZB 1HHIA 1KULA 3S2AA 3U30B 2PR9A 4LSQL 3PL6D 1SXNA 3VFNA 2I69A 1A6WL 4PM1A 1HDMB 4FTVB 2R2EA 5CEZD 2Z4QB 4TLUA 5JUEH 3AXHA 5I18H 1Q0YL 3K8LA 2FRGP 4FD0A 3DA0A 1S5HB 1JHTA 2F19L 4L3EA 4ZO6A 1S46A 1HX0A 3FQUB 4PJDF 1QI4A 4M61A 1L7TL 3BI9X 3ML8A 2GITA 1E8XA 4JDZA 3HI1A 4FQXD 4JHWH 4M5SA 5DJAA 4WJ5A 4N6QA 5KUKA 3P4MB 4G1MA 1ETZB 4PJIE 4W9EC 3UTZA 4S1DC 3MODH 3MMEB 4R96A 3RY6C 1WUNT 1NCOA 4UT9A 1HSBA 1S7VA 3K72B 4N6RA 1W72H 4G5ZH 3WTVA 3NJLA 4NKOB 3O9WD 4H13C 1G4MA 4NUQA 1ZA6A 3GNML 2AZUA 3KEDA 1NEUA 3N85L 4ELME 1BBDH 1KJ2L 1KJVA 3M1CA 4NUMA 2YC1A 3OQ3B 3B2UC 3AQXA 4QGTA 4R0LB 1I85C 5TDOB 1RFDL 1ND0B 3CFUA 3WHXB 3IMBA 2WO2B 1GCYA 4AY0A 3BSZL 1E5UI 1KB5B 3L1OH 5F9WC 4OF3A 4GAYB 4LU5L 1T89C 3WLBB 1WH0A 5I1LA 1NIFA 1EHKB 1BYNA 5FYLD 4MZ3A 2XVGA 3MBWA 1YMMB 5IUSA 2JH2A 3KPQB 4IIQB 4QXGH 3FYEB 2WQXA 3TN0D 1GS7A 1MAJA 2H6PB 5ANMA 2ZNWA 2WVVA 4KHTH 2J6EA 4JREC 4XVJL 3CLFL 2AAAA 5GIRA 1BD2D 3WLWC 3DVFA 3GIVB 5MERA 2RBLA 4JG9A 4QRSA 2W81C 2F74B 1F02I 3S5YA 3EGDA 1NLDH 1BXVA 3DGGB 4Z7WF 3EAKA 1MJ8H 3V0FA 2D4DA 5JR1H 1QBMH 2WLLB 3PHQA 2Y2TA 4Q2ZB 4Z7UF 1YC7A 3T1FA 1NGQH 3EO1A 4LAJH 3HE7D 3UPCA 5IEKB 2HVKB 5IJCC 2W0FB 4AH2A 3EOAB 3L3OB 4P9HC 1FYTA 4U1MA 4MBRA 1FPTL 4CRPA 4F3FB 2ITCA 3QUYB 1T83C 4YFLI 5ANHA 2MQGA 3ETBF 2WOBA 4QT5A 3ZXAC 2HG0A 3IGAA 3CX2A 3TURA 1L9TA 3BDXA 4P5TA 5FHAH 3ABZA 3IFOA 1BAFL 3WY4A 3R06A 4LCIH 5GJTH 4XOAA 4QXUL 4C4UA 4DAGL 1DYZA 5ABAA 5J4MA 4APXA 4ZMVA 4UB0L 4DQOL 1I1FA 3WFBH 5L4FA 1P1VA 3KPNA 2ZOUA 3M46A 3BWAA 1XCWA 1PJWA 4DN4L 3KLDA 2XBDA 4AYEC 3U46A 3S35H 4NO5B 4ZO8A 5IHZB 5MEPB 4HHWA 1KJMB 3A4FA 2AMUA 3N1QC 4HFWB 1D9KB 1L6PA 2OAAA 2JE8A 4POZD 2BNQB 5IW1B 1OPOA 1UACH 1UXMA 3TJHD 1L0PA 1RK7A 4GI9A 1M7UA 4XTRC 1WS8A 1PX8A 3UGUA 5JHDA 1FGVL 3MXVH 4Z7VF 3HPJA 5CU5A 5C0BE 4LPYA 4HS3A 4UTCA 3EBAA 3GMPB 4LEEA 4OCYH 4A2GA 2PP7A 1OAUH 4QRRA 2EC8A 2ZG2A 4HPOH 4L3ED 2VQ4A 1U58B 2WIIB 3FCGA 4ZUUB 5B38B 2BW4A 5CEXA 3D2UB 4EIUA 5FDWA 5A6LA 2FX9H 2UX6A 2WYIA 2HT4D 1WZLA 3KPLA 2PN5A 2X05A 1VPOH 3THML 4DGYH 3AU1A 2B1HH 3QNYA 3EGSA 4JCLA 2HP4A 1M7DB 5I76A 5IM7A 3MFFB 4AC2A 4WU5B 1YEHH 4UQIM 4ERSL 1HVXA 3D85A 2QQKH 5AYUH 1PSKL 2LLLA 2CDGB 2NPLX 3AUVA 1I1AB 3TNMB 3QCTH 4BV1A 4RIRB 3BP4A 4HC1L 5IROD 3HG1E 2NW3A 4NJ9L 1UA3A 3UACA 3VB9A 2HFEB 5HHVL 1QO3A 1ZHBB 1XFPA 4JFTA 1AD0B 1I7UA 1J8HB 1MCBA 2BCKA 4UMSA 3DTUB 1QRNB 3KZ8A 2N7SA 3VG9C 5KBDA 2NW2A 3D51A 1HKLH 3SDDD 2PCFA 1QVOB 3V7AG 4AL8L 2Y22A 3Q06A 1R75A 4NUJB 2YLHA 5KVDL 3TIDA 1UVQB 1QPKA 1U8KA 1NUFA 3V10A 5DHVA 5B8CA 4W4NA 4TLSA 4QGYA 1H5BC 1HC1A 1RK1A 3I6LE 3X1EA 1NGPH 4UMGA 1DEEA 3P3RA 4ZPVA 2Z0UA 4KH2A 1BYPA 3A0OA 5LGHL 5GGRB 1PZ3A 5MENB 4ZS6D 4OGXH 5B1BB 3RPKA 4YQXH 5IB5B 4ZAKC 1TDQA 1JZ5A 1FBIL 1X5XA 2VCOA 1IEAA 1J11A 5KSBE 3P4LA 1OSZA 1U3HC 3FUDA 3LJ3A 3NCJL 4W6WB 3NZUA 2B9AA 1PKQE 2WTPA 2ATPA 1E30A 4XE0A 3TNNB 1AR1C 4UQDA 3O45A 5E1QA 2VAJA 1OAXL 5AW4B 1G43A 5J3HD 3EYVA 4RLDA 1W0YT 2ENYA 2ZX8A 4C55A 5ISZE 2XUWA 1I3UA 5C08B 5AYQA 3KS0J 4GRLA 3PHAA 3GK8L 1LEGA 2BIMA 4KKPA 4HKXA 3IJSB 4Z7AA 5C71A 4N8PA 5DVNA 2R2CA 4YH6A 4DGWC 4EOWH 12E8L 2Y5TA 4P5KB 1XGQA 4PLKD 2CO6A 3ARWA 4MJIE 4NN6B 4S1QL 5CWSB 4MAZA 4L29A 3EFOA 5IFAL 2YQBA 5KN5A 4JFHE 2AXGB 3QO1A 2CM5A 4NDMB 3Q01A 1MFVA 4AK2A 4AM0A 2FYYB 5IOPA 4ZX3A 1CXFA 1MIEH 1HXKA 4YO0B 4OB5L 3M1OA 1NAML 1NSNL 1YNKL 2FJUB 1G5AA 3I50H 4HQQH 4X6CA 4YHYB 5IWLC 2C26A 1GJWA 4PGDA 2V9QA 4WTWA 4QY8B 4OCXL 1KCVL 1QUNA 5E6RB 4KAQL 5D2LA 5EIVA 1IBFA 1YLBB 2HA1A 2ILLA 4MQXD 4WK2B 5KBMA 2FEDC 5JORB 4KY2A 1JDDA 4YDKL 2NXZD 1NINA 2YBRA 2OI9C 2IQ9L 1BGXH 3EUUA 1W16A 4XBEH 5GS0C 3VG0L 1A4JB 2BWQA 1LD9B 1E9QB 1E5BA 5IQMA 2HT3D 3HRPA 3L9YA 1DJHA 2Z8RA 1F13A 4PP2B 1AQDA 4RX4A 5H37G 1BXAA 1KTDB 3ABMB 5I66B 3K0YA 3KM1A 3LZFL 2BWDA 1ORQA 3CBKB 3MLWH 3ZU8A 4ZUSA 1WGOA 4YK4C 2Z3FA 3QULA 4BKLB 2VQUA 3ELQA 4DP4X 3SIKA 3WKYA 5GZND 4M00A 2CKBH 4JKNA 1AC6A 4MCMA 5DCCA 4PRNB 5E1AB 4O02H 2DQEH 3TGXA 3CHPA 3GRWA 1CBVH 2Y6SC 4U6VL 1ZOXA 4AGLA 1DN0B 3CV5A 3O11A 3Q3GB 3KG5A 2YD5A 5AOLA 2ZUWA 1I8IB 1S7TA 1HNFA 2OMNA 3KAAA 4WNJA 5EOQL 5F9AC 3GSNH 2OMWB 2QPUA 3OZKA 1WCBA 6TAAA 4J39A 1PTZA 2C9UA 5GSRB 1ZVHA 1KG0A 1FZOA 2HX9A 1KBWA 1LO3L 1BP3B 5EA0L 2E4TA 1FL3A 3RJDA 3ZZLA 1Z5HA 1PU0A 1XTLA 4C56E 4HJGB 4JJ5B 1YNTF 3QUZD 3PWPD 2WJ7A 3ARUA 1DSFL 1Z7JA 5CZVH 3QDGD 3K71B 1F6LL 2H1XA 4U6XB 4O2EB 3GO1H 4H8WH 2GIMA 2DEWX 4QKXB 3KBEA 1A7OL 1QACA 3V7MA 1AAJA 4X4XA 1IM9A 3W38A 4LNVA 4LIQH 5HYSB 2YAPA 3NP3A 3U36B 4MCZA 5FO9A 1DQQA 3QJFA 5FX3A 3QQ4A 2IFFL 4LSUL 5JXED 2ZG1A 2RGSA 4W68A 1TYEB 3P30H 4E0RA 2W80C 4EUPA 1S7SB 1DDHB 4EEEA 2Z6FA 2E0PA 4BZYA 4ODHL 3QNFA 1YCSA 2OXHB 3MI6A 4OZFH 2RQ8A 1WFUA 4WW2F 3ARDA 4N2DA 1BZOA 4MJJA 4N5EC 2NYKA 4IGBD 1T6WA 4KBPA 4JDTH 2ED7A 3WE6A 4JN1H 5KEZA 4TNVF 2X4QA 2XKNA 3PIQB 4RCAA 3KNBA 3H42L 3BYYA 1A6PA 3O4LA 4F80A 3SOTA 3C60B 5BXFA 3CC5B 1EAPA 5B3JF 3UO1H 2Q7YA 4Y19D 4YSRA 4S0TD 1HQ4B 4B5ZA 4GAJH 3QORA 3IN0A 2PR4L 3WG7B 3RQ3A 1UWXH 3DVGA 3IMRA 5I23A 1KPVB 3HBQA 4PJDE 3PE9A 5KVGL 3QUXA 5TPWL 4M3HA 3MRIB 1UYWL 2QTEA 3X3GL 3Q9PA 3I9GH 2Y3NA 1XGPB 2VLRA 3U48A 1NLBH 2BY1A 3DRTA 3MRPA 3DIDA 3ZYZA 2J6WA 2DJ4A 3K81A 4GSRA 3EH1A 1I3RB 2ESVA 4R4BB 2WSDA 5HHXH 2FWOB 4NZRH 2NLJB 1NFDB 4U1HB 2Z93A 5I8CA 4KJQD 2CK2A 4HZ1A 2XQYA 4ZNEA 1XGTB 1UWGL 1Y18A 4L3CB 3CBJB 4H1LG 1QBLL 5A16B 4P3CH 1RZKH 3T09A 4L9LC 5ID1A 3KPOA 4GQQA 2D7NA 4M1DL 5C0JA 1CZ8L 1CU4L 1QSEA 1N7ML 1CL7I 1S7UB 2CR0A 4CGTA 1A6AA 2VQTA 5BPPA 5GS1C 5I16B 3KPRB 4UWQB 5E9AA 5ICUA 3V0VB 2R29A 4WI5A 1EX0A 1DVSA 2EECA 3J07A 5DRXB 2O1AA 4EBQL 2IMMA 3DDGA 1EGJL 5HHNA 1OB1B 2ZUVA 1CL7L 2MOVA 4FXTA 1L9RA 2E8YA 4WZ9A 3RGVA 1SXSA 2KZBA 3MV9D 2VLJA 3ZTDC 3UZVB 1UA6H 1Z5YD 4Z7QF 1CLZH 2ZSWB 4AXWB 4MKMA 1K85A 2IDCA 3DI2B 2FH8A 3T3MF 4LESA 4Z3EA 4LIQE 2MQ3A 2CUHA 3BEVB 2NYYD 5F9WB 2JTYA 1M05B 2BSCA 5CHNB 1KNOA 2YXWA 3B4NA 5F9OH 3WNNA 2Y25A 2ZG3A 4GG8A 4NBZB 4ODSH 4Z7UE 4F8LA 2DJUA 3EYUL 32C2A 4X7SL 1DO5A 1A2YB 3E38A 4G6FB 1QI3A 5EO0A 1E5ZA 1IIKA 4MNGA 3OLEA 4JREB 5MEQA 3MAWA 2CAKA 3ZYOA 5DTFA 1F56A 3CFCL 1BV8A 1FIGL 2APXA 1NFAA 1RIVH 2H32A 4LKXB 3EOBA 2WQUA 2P3YA 2XPGB 4PUBH 1K5WA 1KPUB 3S88L 3O2DA 5HHMB 3QWQB 5B21A 3EYOA 1OSEA 2NXYD 4XN2A 3UYRH 1M9WA 3WI9A 2EDQA 3C6SA 1KN2H 5SWQB 2W9DH 3ARDD 1DVYA 2CRZA 1GSKA 2OMXB 3ARGA 3P54A 3QJQB 4KXZI 5KUMA 3VXQB 2VXQL 5EBLB 4OM1L 1CYXA 2GK0A 1PZUB 1QHQA 3AAZB 1RD6A 1CGUA 3WGVB 4OCWH 2CDEA 2UYLA 5C7XH 4NBXB 1U41A 3T65A 4OF7A 1TF4A 1A6VH 3HUJA 3K80A 1W0VA 1GKOA 4J3OD 3BMWA 3QDAA 1KJ3H 2Q10A 3SEPA 1QTSA 2DW5A 4N9GA 4FNLL 5DGQA 3FOMB 3HKZA 4JEGB 2FTAA 3QUMH 1C5CH 5GZOD 2BINA 3BP5B 3STBA 1B2WL 1KLGB 4LOVA 3FU0A 5D1ZC 1K5NA 2L0DA 3G04A 1DQLL 1I7TA 3C2SA 4LGPB 4NO2B 4UM9A 2R23B 3S36X 4BZ2A 5J06A 3R1GH 1E5YA 1Q9LB 1LE5B 3GI9H 3Q5YA 5I1GH 5CEZH 4NI3A 2XY2A 1PZ5A 2WKOF 4KDWA 1A7PL 1TSHA 5AW0B 2ESVD 3MU3A 4JZJA 2GIXA 3ME0B 3MUGA 3WNKA 4ZQTA 2X1WL 2JKWA 3P3YA 1ES0B 3APFA 2WW8A 3QFJE 1H8LA 3FQXA 3SDXA 3S48A 5D6DA 1MWAB 4GXUM 2FZ3A 5AVVB 3A24A 5FW7A 3EDFA 1YUHB 4I77L 1TVHB 1JZHA 4S0SD 5E6IA 4A2LA 1HU8A 1FH5H 3B43A 4EMZA 4IHOB 2EEXA 2JFCA 1DBMH 3L45A 4FJ6A 4LLAA 4N0UB 4MXVE 5D7IA 2X88A 3IDUA 3NN8B 3Q1SH 1RZ7L 2R4SL 3LSOB 4PG2A 3CUPB 2OYMA 3BD4A 1AHWC 4U6YA 2VLJD 2P24A 2QKIA 4ODVL 1V3MA 3JWDC 5I6XB 3OG4B 2Y36L 3B5TA 5A2LH 3EFDL 2J55A 2BHUA 3VG9B 4ZSOB 3WS3A 1UASA 4JM4H 2NY2C 5IFHL 3SE9L 3DVNB 4KROC 4PBVC 4XNDA 1D5RA 5C8JB 3LQZB 4UT7L 3V0IA 5J1AA 3O41A 5DS2A 3HPLB 3FT0A 1G87A 1PFOA 4YFDB 3VI3A 1BEXA 2C3XA 4IRZL 2C7UB 5FYLH 3TCLB 1JZJA 1H5BB 3SE8L 4HMEA 4GKZB 1KB3A 1DZBA 1YY8B 1CQYA 4XCNB 1G84A 4M93C 1B3JA 3MLYH 4XE5B 3RWJB 1WAPA 4K7FB 5ERWA 1JK9A 3KVDD 4ZAKB 5L8KB 1RMFL 5GRXG 3S37L 2BO0A 1NCDL 3NCWA 1K8DB 2EEBA 4PGEB 1U3HB 2WXMA 1TXKA 3K6DA 3W39A 4HCRA 3GMLB 3LH9A 2YMTA 4KNUA 2DYPA 3BYTA 1AR1B 1MLBB 2F6AA 3G08A 3M45A 4QI3A 3BUQA 2BNRE 3ALXA 1T1WB 3VFTA 1F6FB 4MX7A 3FTGA 3CSTA 2WLIB 4DZ8A 1BFOA 2X4SB 2DLIA 4LOUD 4NP9A 1CI5A 2F8IA 2VE6B 2NUPA 4UTBA 3FOLA 4FG2A 1S9WA 5DUPH 5TFSH 4NFCA 4Q6IC 4BQ9A 2MPAH 2QR0B 2VKWA 4PWGA 4XP4L 5J1SC 2Y1AA 4FLQA 3FTWA 3T6WA 4Z76A 2BRRH 3CD4A 2GUYA 4FYTA 1HJBC 4NKDA 5IQOA 1AGFB 2HVJA 4U1IB 4DN3L 3GT6A 3Q8EA 2F5AH 4FCHA 4FMKA 4ETQA 3CHSA 5F7BA 3FO1B 1RSYA 2K6YA 5F7NC 1GHFH 3TH4T 1BZ9B 3P9MA 2Q8AL 4UNUA 4DW2L 2FECI 1U8MB 4G9FA 2QQNH 3TWYA 1BDYA 5AQ0A 4PRPA 2DD8H 3QIUC 3RJOA 4OZHA 1T0MB 4QKTA 3ZDYE 4UAHA 4NQEE 5JOPE 5F7UA 2FECL 4LMQE 3RWHB 3MA7A 5D8JL 1JPTL 2FGWL 4HWZA 1KCLA 4HF5H 3VCLA 3UZEA 2OCJA 4F7CB 4FS0A 2IBGA 4HJ0C 1B4TA 1WBZB 2YD1A 3GXNA 5IHLB 4YSSA 2ENJA 5EOTB 4JO3L 4YK4B 3BAWA 5E6ID 2VDLB 2DMCA 2MMXA 3GLZA 5C0RH 2A83B 1IM3A 3SGKC 2C8NA 2OSLA 4F9LA 4P4KD 4DK3A 3T8MA 3RKPA 3A4EA 2TRYA 1NOLA 2IPUG 3FFCE 2NX5B 2RACA 2VXVL 4YDLC 5FKPB 3II3A 4IU3A 4KQ0A 1KGXA 1E28A 3RUGE 1NCUA 4QCIA 5HYQA 2HVBA 4POUB 3F85A 5C6PB 1MCLA 3DV6A 4B6ZA 2WXHA 4ADIA 1CFQB 4TVSa 4NPJA 1MY7A 3H9SE 2TAAA 1JXDA 2LLGA 2Z31C 2X3BA 1JF1A 4JHBA 1BM3H 3MOAL 3BJ91 3NTCL 4PTTA 3ZMNA 3SQBA 4P0DA 4ABVA 2R1XA 4P5SA 4MDJA 1NCAL 5E5MB 3U6XS 4V11A 2GTZB 1VHPA 2QFRA 5DK0A 5A3ID 1Q9KA 3FC8A 1J5OH 4YL4A 3SE3A 1DTUA 1ZLWH 1ZPLA 4GP4B 2F5BL 4RZCA 1KELL 1SLXA 3RVUC 4PJAB 3KL5A 3HB3C 2X4UB 3QG7L 4HJIA 1ZHNB 4L4TE 2JB6A 4NENA 1YMHA 3N50A 3MV8B 4HZLA 1J0HA 3HLAA 5FF6A 2N1TE 4W81A 5A6MA 3BO8A 1TCMA 2EEDA 4YNYB 1XD0A 4U1JB 4XGZB 3JWNE 1X7SA 3HZVA 5BS0B 2PP8A 1CLVA 1RZIA 4FHKA 1CLYL 4PGJA 2ADGA 2XXFA 2FL5A 4FMFA 3ILPB 4PREA 2JLPA 1DLFH 1SOXA 3GRBA 1B0WA 3IDGB 2QLVB 1JP5A 3GBLA 2A9BA 4J6RH 5F9DC 5D70L 5TGBB 5LGJB 4OZIF 4ENZA 1KJ2A 1R5WB 4AJWA 3VH8G 5C9JB 2WIMA 1MI5A 2IIJA 3JWNG 3GJFA 3PDOB 5I1JL 4GG6A 1ILSA 1RHFA 5GISL 1S9VB 2GYSA 2JXMB 4P2AA 3QRGL 2HWZH 4NBYB 3OM3B 4L8SA 3DC0A 4YXLH 3RDTD 2CLRA 2Z7YA 4HWEL 1FC1A 2EDWA 2V17L 3BSZA 4XPHH 3QNXA 3GGWB 1J5DA 2JELH 1SMOA 4J3OF 2HX7A 2APSA 3CFDA 4PJ5D 3QEHB 4X7TA 1I4FB 3GMNB 1UXSB 1E42A 1WZ1L 2P5WB 2P5EB 4NI6A 4QXTB 3SBWA 1HXMA 1R19A 2ZOKA 1ADWA 1MQ8A 4LLWA 2XG5A 5DFWH 4KMLB 4G9FD 4X8CA 2HPTA 2XN2A 3VFRB 4BFJA 3OAZK 4GBXA 2WGXA 4AYSA 3EHBD 1I9RL 2EC9U 1X9QA 4L1SA 4LLQA 5I1AA 5JOFA 3T2NH 3LEYL 4XPBH 1LK3H 1OM3H 1JGIA 4CMHC 1XZWA 3I75B 4XAKD 1MHCB 2H3NB 2AERT 2Z1PA 3DETD 1DVFC 2KS0A 1T2XA 5KYYA 2F53B 5I6PA 1Z9NA 1XMEB 5DI8B 4IBSA 2A6JA 4ONHA 1Q72H 3OAYK 4L9LB 3SE6A 3DX6B 3NACH 4Z7QE 4LCUA 2K7QA 1H15B 3OKYA 4YZFF 1SRDA 1F3DH 1IC7L 1KCUH 3CSFA 4P49A 3SHSA 2GSGA 3VI4F 5GS1B 5GGVH 3EJPA 3UAJC 4TRPH 3ZE2B 5LBVA 2ZWLT 5G4OA 3OKEA 1FZMB 4GUPB 4BEIA 3QHFL 1AS8A 1G9NH 1UQSA 2NNXA 4IOSA 5LCVH 2PYEE 1JHKH 5DQDH 1CF8L 3MRRA 4LCCA 3GS7A 5DD6B 3RI5K 5B4MD 1H3WM 2HTKD 3MLTB 4RDQF 4S2SA 5C0CE 5JMRA 1LGVA 2OMYB 1MFDL 2X4RB 4FZ8H 4LNRB 1EXHA 2EIDA 1OWWA 1J05A 1MJUH 4G8FB 3WDJA 4GP5B 3G5YA 3KYOA 5K1VA 3KE0A 2J8UF 1B88A 25C8L 1SHMA 3BPNC 2OXGB 3HE6C 3QC6X 4UZGA 4AEIH 1UZ6F 4ANUA 5KS9B 1MW2A 1SBSH 1KV3A 3ARFA 2N59A 1ZA3A 2CNZA 3QIBA 2BIPA 4MBOA 4L4VA 1ZXKA 4L2YA 1CT8B 3CZUB 2Z7UA 2D7TL 4Y5YC 3W2DL 4AW7A 5IQ7H 3PS6A 2AVGA 4AKOA 5B3NA 2VDKL 1CDJA 5T1KB 5JMOC 1BX2B 3PHOA 3L81A 4X0NA 1PLGL 3VGDA 3ALPA 5DJ8B 4RSVA 4N5UA 1CGSH 2G2NA 4PY7A 3L48A 2W07B 1PF3A 1UXWB 2ALAA 3OB8A 3JVGC 4NNXB 4P3DA 3UTPD 4AMWA 1KTKE 4PV9B 1YEEH 4CN4A 2B9BA 6FABL 1UM5H 4HHAA 3WFHA 3NSJA 2CJ3A 3TV8A 5HHQB 4M4PA 4HC1A 4ZS7L 4ZUTB 2Y06H 2NNFA 4MMXA 5L7XL 1AO7B 3P3UA 2BFVH 4HT1L 5DD1H 4EZJA 1HI6A 5SX5H 3U0PA 3QPKA 4Y1AE 1QSZA 3QUHA 4C47A 2W65B 4AOFA 5ICYA 1QLEL 1MI5D 1XWVA 2E9GA 3GHEH 4X7FC 3GMOA 1RIUL 4YR6A 2OULB 1RZPA 5CF3A 4C4BA 4TULH 3OAUL 5C92A 5BMFH 3F62A 5HP5A 4MAYA 1XGYL 5K93A 2EIMB 1D5MB 4WWID 4JFEA 5ESAA 3RTQA 2GJPA 2X7LA 1MHHB 3T0DA 1HH6B 4HEPA 1DQVA 1HEHC 5C07A 2BVPA 1GGCL 3IT8D 1MF2L 4NPKA 3BMVA 1T4KA 3T77B 2LTQB 1YPZE 4PJ9A 4MD4A 5EIIB 2PXYB 4F57H 1ECYA 4GBXD 4K3EH 1LO5B 4QRPE 1AFVH 3VFWB 5L2JB 4HIXL 3AS3A 4HH9A 2VMFA 4PJCE 3QW9A 5F7EH 3V6OC 2VAAA 2WXNA 5DZJA 1H3PH 5DVKA 2A74C 3ZKXC 5IJKA 5DEJA 4Y4FD 3SDYH 2HKHH 1NL0L 4HEMA 3OZLA 4RGOH 3LIZA 4JG0L 2Q5BA 2ZF8A 1JAEA 2L3BA 5AKTA 2FWSA 3VXRA 2XFGB 1ZEAL 4ZW8A 3Q6GH 1Z2KA 1T5WA 2FJGB 2MQ0A 2XX1A 3GHBL 1OP5H 3ES6A 3BP7A 5IFJB 3TPUB 2BSRA 4WI8A 2AJYH 4HCIA 2DWEB 3FFDA 4WO0A 3TBWA 2YN3A 1CR9H 4L5FL 5KYWB 4U0QB 4Y9BA 3LRSB 5A7BA 5D71H 3WKQA 3VWKD 3BZEA 5I30L 5ENWB 4AVHA 3ESVF 4IOSD 4RWYL 3CFBA 1E67A 3V2AR 3D6GA 3H9HB 3S3DB 1AHWB 1SEQH 3DLQR 2VZUA 2YKKA 1MEXH 5F7LB 2E6PA 3MV11 3ZSTA 3TP4A 5IMLA 4H44C 2F7QA 3HG5A 4JPVL 5GRUL 1MH5A 2NDFA 3CTTA 4LCYB 1LQBC 2NY2B 4NCDA 3K8KA 4TL4A 1NAMA 1B0GB 1NJ9B 1I53A 4KROB 4Y4KA 3WUWG 4ADJA 4KNQA 4AQ8A 4TUOB 2A6DB 2YK1L 4I2XA 4NRZA 3Q48A 3WEBA 1ZRUA 5E2WL 2P46B 4FZEH 1RUPH 4S1SL 1AP2A 3NFNB 4L4VD 4XBGB 2M8XA 4OT1H 1JF5A 1GS6X 4GPVA 1CXHA 5E8NB 3VYOA 3PGCA 4M93B 1LP9F 2W95A 3TONA 1UB5A 2QQLH 1VACB 2OMZB 4X99A 4NUPA 3PY9A 4RISL 4DUXA 1UWXK 3K4ZA 9CGTA 4FULA 4C4KO 5E9NA 5C0NC 1N10A 4I7ZC 2NUTA 4DETA 2X0VA 3LB6C 3OZ9L 4XCEB 5IQ9A 3WNLA 3CX5J 1BQUA 2WKGA 4IRSD 4PJIB 1OTTC 4XH2B 1WTGT 1HEZB 1SHXA 2OP4L 3NJMA 2MHAB 3RKDD 1ZHLB 3R8BB 2O5ZH 3U4BL 3QDJD 2ZCKH 1JNNL 4ONFH 4MFHA 1FFOA 2DYRB 5LO7A 3V6ZA 1A7RH 2F54A 2QBWA 4Y19E 4V1DD 4IIZA 3ULUE 4HKZB 4ELMB 1M71A 3DTDA 4M8QB 3CFEB 4KJWD 4PEEA 3S4SA 1DUZA 4N20A 5EDSA 2QVTA 4P46A 5I0YA 4JE0A 1T6VN 2W0PA 3SD5A 4Q6IB 4ACTA 2XN1A 4PRAB 5F88A 3UTQA 3TEZA 5CD5C 1CDHA 2X3AA 4HWUA 4XXWC 4ANXA 4WRLA 1H8OA 5DJZB 43CAA 3RAJH 2WWOA 4J3OH 4OLWH 5BZZA 3BH8A 4EZKA 2F15A 1IGCH 2FBJH 3A47A 4LL1A 3RTQD 2LE9A 4KJYA 1NC4B 4R5TA 5FYJE 3BGMA 1K6QH 2JLLA 3OBAA 3QCVH 3R18A 5CCGE 2ZCHH 3HNVH 1YEGL 1FG2B 5J9PA 4UIKL 3HAEH 3L8QA 1NCCL 3OPUA 4JO2L 4P3WA 2H5UA 3HG3A 4WK4B 4PJ9D 2BSSA 1A6ZB 1NDGA 3F01A 1RZ8A 1LK2A 4H88H 4BQ6A 1RZFL 2D2OA 4HG4J 3QIUB 4FABH 2IWGA 1IBBA 2HB0A 5JIPA 1HXYA 2X9ZA 3INUH 5ESQA 3WU1A 2RTTA 4MQ7A 5I1CH 2Y7LA 1Y6MR 4WDIB 4NO0B 3T0ED 1U8NA 2VRQA 3Q7JA 1TNNA 2EYTB 3MLVH 4JFFE 2ZYSA 5KYNA 2R56L 4ODBD 2UWEA 3UCQA 1LEIB 3DV4B 3X1NA 2DIJA 1SMAA 2C4FU 1L9PA 4FAAB 2PPAA 4RMBA 1S8DA 1XF3B 2LAAA 4DP8X 4HDIB 4N8VG 1IBGL 2YEQA 4B9PA 3CPUA 5CMAB 4PJBF 2YMXL 1T1YA 1R33A 4OGAC 4BZ1H 2DLFH 1YQVL 1Y6NR 5PAZA 2XZQL 1IMHC 3TYGL 3CJJA 1OF2B 4XMLL 4NXKA 5CBEB 3UPAA 5JQ6H 1UB6A 1USZA 3QCUL 3WNOA 4YDLB 1J9RA 1BXUA 2RMNA 3ZL4H 1D5IL 2ZAIA 1OARL 2O5XL 4F7PA 1WRFA 4HD5A 4K2UL 1KPRB 1EMTH 3FU3A 1NH6A 1YEKL 4KVNL 5AUMA 4KK8C 1WD9A 1X9RA 3QEQE 4M7JH 4OM0L 2Z31B 4ZTEA 4P04A 4G8IA 2B20A 3TVMA 1A6UH 2FJFA 1ACYL 5FO7A 5JPMA 3RIKA 1VEOA 4YUEL 3HFML 3FRPG 4G7YL 1RZKC 4MJ2A 2FO4B 2FX8L 3EDJA 1JGEB 4C4KT 4MSWA 5ADOL 3ZKNC 1S3KL 2ENQA 4O51B 4V33A 3PNRB 5FB8B 2IWFA 1ZIBA 5C0BB 1XH3A 4ODTL 5CU9A 3QHTC 5D7LD 3KPSD 2P8LB 2RD0A 4Z78A 4Q9QH 1VZGA 2EIEA 2C4XA 3HB3B 3IVKB 5C86A 3X3FL 1XH0A 1QX1A 3OF6D 5AVQB 4PBXA 5KSAC 3TF7C 1P53A 2BNUA 1ETB1 3LY6A 3OQRA 4G2AA 5D1XE 3BQVA 4U1GC 5E5UB 4Q0XL 5J13B 4JG1H 4OZIE 4GW1A 3EBHA 1M1XA 3CFTA 3WJJA 2CBQA 2HT2D 3EOTH 2J25A 3FQ1A 3RDJA 2DQJH 2YSTA 4DUVA 5I1DB 3CVHH 5E2JA 1S5HA 1FYHB 3CFMA 2CPUA 3FQUA 2JK5B 3PWLA 4XC3L 3HG1B 1V55B 1EGJA 2XA8L 3I3EA 3P4MA 1T7XA 1BIIA 4KO7A 4CMMA 1FE8H 3JSSA 3KWUA 1UM4L 3MMEA 3SYCA 3U1QA 3SN6N 3WEXB 3OHXC 2N56A 2DI9A 5AENA 1Y07A 1U2YA 4OBSA 2IH1B 3O8XC 1KBGL 3TA3D 5I0DA 2GAZB 2DQDH 1EEZB 2YSSB 5LNDA 4PJ7E 2C9QA 1CE1H 3QXDB 2H47C 2A9NL 3N1MC 4I9XA 1VFUA 1U36A 2E8ZA 3L13A 2WINA 3TPKA 3OMAB 4Y7OC 2IPUK 5KVFH 4BKTC 4JGMA 5TF0A 1E0OB 3HC3L 5TDOA 3KGUA 1PAZA 1WAAE 2HJKA 2CGZA 3RY5A 3G6AB 5C09E 3WHXA 4R7NA 1J0YA 3HCVA 4LLMB 1KB5A 2BM3A 5BZWA 4FFWC 1LE9A 2IAMB 1EZVX 3VI4E 1E4XH 5BZDA 2FR4B 3QVAA 5TQ2L 5FECB 1C08B 1J10A 4CMHB 1YMMA 3TBSB 3KPQA 1PKQB 2VDRB 1DVFB 3K46A 3GMQB 1RP8A 4XN8A 5T3ZL 2Q86B 1A1NB 2HJFB 3MREA 4B60A 1AG0A 2ZAHA 5ISZB 1WZMA 4QYOA 1BZEA 4JFXA 4YLCA 4KDTC 5L9DH 4CC0A 4JFPB 2EXYD 3M1BA 2BY3A 4HSAC 2VXQA 4LAQL 2XLLA 4TNWF 3DGGA 1PGRB 1G7QB 2CRMA 3CDCA 4YS4A 1HSAB 1C5BH 1UZ6E 5AWNH 5IEKA 4MJIB 1FVCB 2HVKA 3GI8L 1JTOA 4HIHB 5DJ0A 2D03H 3TCXA 5AD0A 3AZUA 3U7YL 8FABB 1RU9H 4PB0L 1GR7A 4AYFA 1T0NB 1OAZH 1SY6H 3E6HB 5D93B 5FM5M 4YSAA 1O0VA 2NZ9D 1R5IB 1GGBL 2BDNH 3MYJB 3BIBX 4ZMOA 5FYKH 4PMFA 1ZSDB 5I1KL 1N8ZA 3VXUD 2ICWI 2WNXA 4HJUA 3TVMD 1OQXA 4DESA 2V6HA 4PGBB 4F1ZA 4HS8H 1OSPL 5KSBB 3HE6B 3EJSA 5KTEH 2QL1A 2JIXB 3EJTA 1QPPA 4FQXC 5IHUL 4A55A 4Q58C 5DHXB 5GRJH 4AM0Q 5F8RC 4MA7H 2VJXA 2XN9A 2EDXA 3OKLA 3K6OA 2R15A 2DQTL 1URIA 1CFSA 3MA9H 3PWNB 4W9CC 4WEBL 1AKJB 4Y5YB 5C0AA 5BRZD 3IK2A 4FP8L 4D8PB 1P5UA 1GZQB 1PNDA 3QRFM 4JKKA 2AEPH 3P3SA 4YAQB 5DWUL 3NSYA 3O9WC 5AL0A 1CXKA 1SM3H 1RUAL 2A9AA 2DMBA 4NQSA 4FTVD 1LYQA 1SUHA 4O9HL 4XO5A 2AQ1A 5I24A 4XNBA 1JXKA 2XDHA 2FLRT 1HZKA 3Q2LA 2VDOH 1P1ZB 1ZCRA 3G5ZB 1JD7A 4KMTL 4O58H 3ATFA 3GMPA 3IKCB 3VACA 1V3JA 5J6GB 1YNLH 1CFTA 4M3KB 2AQ3A 3O6ML 4N1CA 2XYCA 3II1A 1EHAA 3T04D 4P2RE 3D2UA 3FB6B 4MA8L 3TXAA 4DGVH 1EEUA 2IADA 4XP9L 5CIPH 5EZJA 3VFOB 4LBEA 3VD3A 4E5XG 3AY4C 2PW2A 5F7DB 3S5LG 1T1XB 3MLXH 1N2RB 2DMKA 1OM9A 2Q3AA 4Y4HA 15C8H 3ZIYA 2CDGA 1E6OL 3TN0C 1I1AA 2VIRB 4P59H 1PDKB 3HVNA 4ZFQA 3FO0H 3S36H 5AW5B 4WO4A 2HG5B 1DBKL 4PMEA 4C56B 2IWKA 2HFEA 3Q2CA 5F21B 3RZCA 3PJSA 4PJFE 5B1JC 3KBPA 4DW2H 3D33A 3QZWA 4RETB 4IRZA 4TM9A 1HYRC 2AJXL 4GMTL 1J0JA 1QRNA 2HFGL 2R2HA 2VMCA 4NQDE 4MJ4A 5ESVB 2HPOA 4LFHD 2EKJA 4GYBA 3VRIA 5JHMA 1JI1A 5D1ZI 4QOKA 7FABH 2WXIA 5IIEB 4BD4A 3S0PA 5DSCB 4WW2C 2OMVB 3OKMB 4K7PL 2XIBA 3P4NB 4MKTA 2AJZB 5E4EC 2OPCA 5E99H 4I1NB 2A74B 3AG4B 1TZIB 3JWNC 2WO3B 4AVJA 5HSFA 5AZEL 4X7CC 4IMLB 2ZPKL 2JCCE 2WHVA 1G7MB 3BZ4B 3LPPA 3LIUA 1FSKC 4XNYL 1XB8A 4A6YH 1CFVL 1RLWA 4E9RA 3C6EA 3ZT5A 4K71C 3FDWA 4MA1C 4Q7DA 5IB5A 5D1QE 3QYNA 1JVOA 2C3HA 3NYKA 1H8NA 4KWUA 3OJMB 1N59B 1Z9SA 4X5RA 5DQ9B 5DXWA 3U4EA 1T22A 3MJ7A 5FYKE 3UC2A 1UG9A 3QEUB 4K94C 4R4FH 4X6BA 4BA0A 1QBBA 5JNYB 3N44F 4ESKA 2QDVA 3PXHA 3JV4A 4UILL 3RVTD 3QUYD 2ZNXA 3HI6H 2L8AA 4D7BA 2ZXAA 1AGBA 1S7RB 3IJSA 2JJSC 4JFZH 4YDIL 1IGML 5SWSE 3L4ZA 2VRKA 4NM8H 4ANVA 5ADPL 1RULL 2XTJE 3C9NB 4PJDB 3MX0A 4P5KA 5EV7A 3BOVA 4H1LA 3QWRA 2VERA 4FCAA 3OXRA 3BXNB 1UD5A 2HT4C 3DOHA 1YN7B 3LH2L 4DCQA 4N85A 3SY0B 5CSGA 3QUKB 1ANUA 3V4PB 1F3RB 4FF9A 4HLJA 4K23L 3OJVC 2FYYA 3SYQA 5FYJU 2OJZH 2XT1B 5I1EL 2GJZB 1D9KD 2WLKA 1OGAE 4JRYD 5IROC 2BNQD 2Q1EA 3UP1A 2NT0A 3AQYA 1N8OE 4OVVA 5T5FL 1FFPB 1JWSB 3MLUH 4GFXA 4TQ8A 4NHCH 2VLMD 3QDMD 2XJLA 2EZ0D 3GPEA 3GSNB 3C8KB 4PLJC 4F9PA 4OLEA 1EH9A 3HN5A 4ZJ9A 3X11B 2NR6A 5CFHA 4N2IA 3ZTJH 2KBGA 1A4JA 3D2UD 3LKNB 2F7OA 2UX7A 2EDNA 2KDYA 3ERXA 4OD1H 4W9LC 1GGIH 3LRHA 1A1OB 1HINH 3NJJA 4Z5RB 1XF2A 4B95C 4LCWE 2GKIA 2B14A 5AAWA 5K9QI 1NIAA 1FNSL 1G7PA 5JIDA 3DSNA 1EO8H 1I1AD 1R17A 2ORBH 5FFGA 4X5WB 3KS0H 1U6AL 3EG9A 1WFIA 2FNWA 3GLEA 4E9VA 1IC4H 4ACPA 1OW0C 1P69B 2CBOA 4NJAL 5FM4A 5C6TH 4KZDH 3V52L 3HC0B 4Q9RH 1UOLA 1IBYA 1J8HD 4DO5A 5HI4C 4AGNA 2EH7H 4XX1E 5F96L 1QRND 4Z7UB 2R9HC 2XZAH 1AQHA 2ODIA 3QEGH 4WWKB 4XZUA 2VR5A 1XEDA 2ZXWB 1X5ZA 1RIHH 5GSRA 2MRYA 3BZDA 4HIIB 1A64A 4UQ9A 4XHQA 3TO4C 1HAWA 1LO2L 4BDVA 5D7JA 1EFXD 3D4GA 4OZFB 4Y5XA 4XXDB 1IGTB 4PJBE 4HOZA 3AADB 1PD0A 3KJ6H 3N42F 2OJEA 3A3YB 1AVAA 1A9BB 1CD8A 1PLBA 1NCHA 3L3GB 5CINH 5AAMA 4XX1G 1BZDA 1UJ3C 4PLKC 2PYFB 5D96C 4HU8A 5JW3L 43C9B 4G11A 3HMXL 2E7DA 4EN3C 4DNLA 4JPWH 5MEND 2IPTL 4N28A 1T04B 4W9JC 4UCFA 3CK0L 4LVHC 5HYSA 1TZHB 1KCSH 4K8RC 2YFNA 3B8SA 3U36A 3K2UH 1Q1PA 2NCEA 4NYLA 3PV6B 5FV1L 3UOAB 2AJ3B 3LZOA 2H6UA 4F8TA 3QI9C 1OP3K 1IKFH 2D31A 3DJZA 2XWDA 4CVXB 1A3ZA 4OLZH 5DJ6B 4YDVB 1EIBA 1R3JB 1DL7H 1TTBA 1DDHA 1FORL 2QSTA 1I9JH 5T1LA 3U1PA 2DQCL 3WIIL 2CGRL 2OXHA 3H3PH 5C08D 1OAQL 1TVBB 5K59E 2YQGA 3GC3A 3PP4H 3DX1A 3E8UH 3KCPA 4PR5B 2NXZC 1MCCA 1T6BX 2HT3C 2HCZX 1E9PB 3SBRA 2QV2A 3RX5A 3C60A 3FT1A 3KR3H 3CC5A 4L1BA 3MRKA 1A3QA 1RUQH 2YGOA 4FADA 1XHHA 2NDGA 5JUEL 5GZNC 4ZMXA 2PPCA 1D5XB 1ZLUH 1LNUB 2GCYA 2GFBB 1KPVA 2OL3B 1IQWH 5KSAB 3QFJB 1I8LC 4BFIB 3MRIA 2EYSA 4U1GB 1T03H 3WD5H 3TEXA 4JHWL 5K9JH 1P4IH 1I7RA 5EZOH 1TO4A 2V7HA 4R4ND 3NGBC 3OKDB 1TEGA 3NA9H 2YD0A 4LARH 2CALA 3CPLB 3ILQD 4HWBH 3MODL 1JN6A 4I3GA 3ZX1A 1I3RA 4OUUB 2R0LH 1RLBA 4R8WH 5C6WH 1C7SA 2FWOA 2NR6D 1NFDA 4IKJA 2UZXB 2DBJA 2XFXA 3SGDI 1W72L 3BC9A 4G5ZL 3IFPA 4XP6H 2WXPA 4FXLA 2JKXA 4R2GB 2BW5A 1TTFA 3VQ1C 4GIAA 5C0FB 4JG5A 1IC0A 3QHZH 4OZGE 1JUFA 3QUZC 3QQ3B 2MCAA 1INEH 4C58B 3NCBB 5EH1A 1WP6A 3BN9D 1UZGA 3RY6A 3D50A 1U8JB 1Z6JT 3OHXB 4JHVA 4TMPA 4PJ8B 3KPRA 3KHOA 3O8XB 5TE6H 4I48B 3V0VA 2QSQA 4Z95H 1JDCA 1H9VA 4XMUA 3DTXB 5PCYA 1MLCA 2P45B 3DK2A 3L1OL 2D8KA 3TT1H 1RQ5A 3LD8B 3LKQA 3NEEA 3P9WB 1OB1A 3MNMA 5J6SA 1IGFH 1ZV5A 2HYMA 3FB5B 3FO2B 4WNQB 1IFHH 5LXGH 1O9VA 4XVUD 1IB5A 3IDNB 4GQ9H 5HYJE 1HTYA 2ZSWA 3MVSA 4AXWA 4QXGL 1F4XH 3SKJH 2BMKA 1V27A 4KKLD 3BE1H 3OJDB 4W1TA 5JLZB 3T0XA 2H9GB 3CVIH 3GS4A 3QJTB 3F00A 4KHTL 4M43H 2R51A 4XRCA 1JNJA 1E2ZA 3A4AA 1OCOB 2ENSA 2HJLB 1F5WA 2PTUA 1JHLH 2O6EA 3P3TA 4GQPH 4IRJC 3ILDA 4IGBC 5SWZA 1NLDL 1FLRH 2P52A 2PABA 1MJ8L 3QK0A 3GSQA 4KKAD 5JR1L 1QBML 1KYUA 1TU2B 3BZ5A 1L3WA 4J3VA 3QJXA 1NGQL 4NC0B 3IJ7A 1HL4A 5I1HH 3R7RA 2BNRB 2OR8A 2QV4A 1ET5A 3GXDA 3SKOB 4XBPA 1BMZA 2BVOA 4D0DB 4ENEC 3ULUC 2H45A 4N90E 5AAPA 1JZ4A 1OE3A 1ORSB 4NSKB 4AT6A 4HUXB 2OMBA 1SDDB 1UHVA 2CO3A 1PBYA 1FVDB 5FHAL 5TQ0H 1WJ3A 1M7IA 2NQ3A 5C0EA 1J8SA 4LCIL 5GJTL 1KTLA 5CJ8A 2M1KA 3CVDA 5INDA 1TQTA 1SLVA 1KGCE 3TJEH 3L3IB 3WFBL 4C8XA 1XAKA 5EBMB 3CDZB 4AYBA 2DQUH 3G3LA 3S35L 4M4RB 5DA0B 3CSBA 1M6OB 3FCSB 3LDBC 3AREA 4DP1X 4Z7OF 4WI6A 4G9DA 4IBWA 2X6AA 1ZK9A 2HRLA 3VXSE 2E3VA 3ZGIA 2ZUSA 3K6SB 3C60D 4EIGB 1UACL 4YJZL 4B9JA 1ZXQA 4XMZA 4ALAC 3D39E 5LAXB 2OSWA 3MXVL 1IARB 4N26A 2X44D 3ZDYB 1BW8A 4JL1A 3MNZB 4R97C 4NQEB 1OAUL 2WGNB 4HPOL 3N1PC 1KLGA 3N2JA 4NCC2 3QDJE 1ZSHA 3VAEA 1R5VA 1XF4B 4BFOA 5I1IH 4F92B 2FX9L 1JV5A 1CDYA 1F8TH 3CZJA 3O9WB 4FJZA 1VPOL 4V1DE 1D7DA 2B1HL 1Q9LA 1R34A 3VXME 1LE5A 5FK9A 3UX9B 1PKOA 3C5ZC 1HILA 3NCYS 2KDGA 2VWEE 1YEHL 2CR6A 1LEKB 2ZKHH 2QQKL 5AYUL 5IV2A 4JVPA 1BLNB 1FIEA 3QCTL 1YN6B 3R7QA 1MVYA 3F3HA 5IVZB 3EH5B 4X7EC 5TE4H 3FFCB 3C09C 5CBAB 2NYYC 3ULSB 4Y2DC 3RUGB 3IDIB 5HHOE 3NG5A 3H0TB 4S1DD 4YXHH 3ZKQD 1GYVA 1TPXC 1GAFH 1IL1A 3F12A 1E27B 3GBMH 4IHOA 5FYKU 3H9SB 4OH2A 3NRFA 3TN0B 1HKLL 5GGVY 2A4ZA 3ZZQA 3GWJA 3ARYA 3KCWA 1SJEB 3NN8A 3O81A 2Q2LA 2GUOB 2VDPB 2P26A 3V4VH 4U7MA 4JB9H 3H6AA 2X9XA 3LEXA 1TVDA 4IBUA 3N0AA 2D9QB 3B2UD 5EC2B 4ZW3A 2PF6A 5IEHB 3FONB 3P1VA 4WHCA 1NGPL 1ONQB 2VDMH 3ASNB 3MNVB 2HZHA 2O61A 2R59A 3BPCA 4UM8B 1MW1A 3LKOB 4PJEE 1XQ4A 1XCXA 3DVNA 3PP3K 1EFQA 4L4TB 4OGXL 4CDHA 4WW2B 4BQBA 3L6FB 5E4EB 3HPLA 5HY9A 1CB4A 4LLYB 3WSQL 3VH8B 1QD0A 2V9UA 3SDAB 2C7UA 3W9EB 2G4GA 3L3JB 1KYOK 2WY3B 4G6FD 1YY8A 3AB0C 4XCNA 2A73B 1TENA 5DC2A 1EHLH 1FSKB 2HFFB 1NOFA 4K7FA 1JNLH 1N0LB 3ABLB 4K71B 4MA1B 3WLWD 1A5FH 4M6NH 2PKDA 3QISA 1TTAA 2P80A 5FA4B 5DA4A 1M2VA 1Q9WB 1S7QA 3IRCA 4TUJB 4PGEA 1VF5C 1THAA 5GZOC 2BOBB 4JRFA 1W91A 3WBDA 1KGIA 3SPHA 4EOWL 3CN1A 1M57B 4KK6C 1OANA 2P5PA 2AABH 1ZDQA 5E2TH 3DX0A 4NRYA 4EIZC 1T1WA 1NUDA 4OCLC 2WLIA 5IB3A 1QUPA 5K9KB 3SPGA 4Z7IA 3GTTA 2VE6A 1MIEL 4QRQB 3TTSA 3VFGH 3SBQA 3TBYB 2CLVB 3I50L 1NGYB 3K1DA 3A23A 1VFBB 5BO0D 4RRPM 2H2PC 1I9EA 5DC4B 3L5WA 4JRXA 5IB1B 2AK1H 2ARWA 5JPNA 4KUZH 4QRUB 1TETH 1BGXL 3WO3B 4ZG1A 4XBEL 3OKKB 4HULB 2EDYA 4JPSA 2CRYA 5JQHC 2DDQH 1TZOA 5IWLA 5AVWB 5T5NF 1JPFB 3WFEH 2CR3A 4LHUG 3EKCA 3UJIH 3MLWL 4FXKC 4P5MA 4KC3B 4XTRD 4CVUA 5KANI 4Z7QB 4WV1C 3GSOB 3Q2WA 2CKBL 5G5DA 5D2LF 5K33A 1QHPA 1CICC 3D3VA 4O02L 4XNUH