5KS9A

Bel502-dq8-glia-alpha1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ks9A01
3HN3A 1CFSA 1UCTA 2Q8BL 2A6KA 2EEBA 3LHPH 1NEZB 2AK4B 1HSAA 1AD0A 4OQTA 1G0DA 3WKML 4ODSH 4YXLL 3TNNB 1DBJH 2P8PA 2AJ3A 4KVCH 5E00B 3AC0A 5T3ZL 4JY4B 5C0DA 5EWIL 5I1EL 4BQ6A 1FSKB 1GHFL 1NGZB 3QDGE 1XCTA 3IKCA 4N8VG 4HFWA 3HAEA 5C0BA 5GHWL 4XVUC 1CXKA 5DD1H 3DBXB 3G6JE 4G8EA 1HWHB 3VFGH 3BKML 2AEQL 3V9FA 1CLYL 4AIXA 2F15A 4LKCA 5L2KB 3PXHA 2UUDH 5ESAB 1UXSB 3MODH 4UV4L 3ULVF 4EN3B 4P5TC 3S4SG 1UXWA 2CKBH 2ZJSH 4PRPD 1JHTB 2AQ2A 1NFDB 3MLWL 2VSDA 5BJTA 1RK0A 1J1XH 2MPAH 4MCYB 5EOCJ 1FIEA 4RMRA 4YK4B 3LPGA 3RTQA 2XTJE 2E5EA 1MFAL 5EUOE 5E1AB 1M7XA 5F7NC 3S88H 3GGWA 4Q6YA 4EDWH 3GKWL 4ERSH 2G5RA 1NCNA 4P2RB 3MJGX 1XGPA 5BO1H 2OJZL 3HUJB 1T7VA 3I84A 1KC5L 1KNOB 4JY5H 4FG6C 1JGVL 3D3VB 2BVQA 3QWOA 5TQ2L 3RX8A 3TZVC 1U8OB 5E99H 5ISZD 2R0KH 3Q5OA 1H3PH 1KTKE 5C0CB 4HS8H 4U2YA 1D9KA 3O9WC 1L7IH 4RAVB 4P3DB 5FO9B 1QFOA 3DROA 3L6FB 1S3KH 4P99A 2EYRA 2EXYC 4M6ML 4DEPB 1J0HA 1W72A 5JPMA 4LMQI 4TSAH 5JHDE 3NCJL 4QRUA 4YLQT 3O3DA 3QI9B 1I1AD 3ARGD 5AAMA 3FT2A 2CGRL 4OLWL 1P9MC 5GGUA 1A7PH 2WM0A 3BO8A 1VFBB 4YHZH 4CVUA 1KXTB 4XZUA 4PRBB 5FYKD 4N1CA 3HI6H 1JPGB 2HJLA 2Z91B 4MA7H 4QRRD 4Z7QF 4XPFL 5L8LB 1OHQA 3VXMA 3O6FA 5D1XB 3BZDA 4P2QB 1RURL 5I1DB 3CPLA 5EUKB 1R5VB 3INUL 4NO0D 4YX2L 5DSCB 1JRHI 5ADOH 1DANU 3FN0L 4YFDB 3FO9A 3IDNB 3TBSB 4OM0L 2WUCH 5IKCB 2G2RA 4X6CA 2OTUA 2XPGB 4FOMA 3BDXA 1C5DA 4OAWB 1XH3A 1GOHA 3IFOA 1JYNA 3KLDA 4EBQH 1ONQA 3ZT7A 5F1IA 4GO6B 5C0GB 4ODTL 2PXYC 2HLFC 3BZEB 2A9MH 5IFAL 4PREB 5JQ6H 3QIBA 4NBXB 4HK3N 4JQIH 1XGYL 1I3UA 4U1HA 5CBEA 4D9QE 1T0MA 3PGCA 1N6QL 1LK2A 2BSED 2ADFL 4P48A 1HOCB 5GGVL 3D25B 5I8KL 1KTDB 1HE7A 4ZPTA 3HC4H 3QWRD 3OAUL 1RUKH 5EG6C 1A3RL 4XC3L 3QZWG 1NLDH 4N68A 4C58B 1HCVA 4KJWC 2ITCA 4DVBA 3NFPB 4KKLD 4WFFD 4KY1L 4IOIA 2N7BA 1VFAB 5C07B 3ZDZE 1HILA 4R26H 3QQ4B 4HPOL 4PS4H 3F6IA 4M9PA 1FL3B 4KMTL 1IGJB 3BP5A 4LSSL 4XBPB 4JFXA 4AIZB 4ZDHA 1KCRH 4I77L 4EQ2A 1KB9K 4RFEA 3MYJB 5FDYA 3HCVA 1FZJB 5FGCE 3D39D 2ED9A 4P23A 5DC9B 2HYMA 1TZGL 1XZ0B 3I6KB 1IAIM 2JB6B 1MHHA 1PVHA 4Z7UF 2WWKT 3L5WA 4ZO9A 1DQQA 5DJ8B 1TXKA 2DMKA 4GKSB 4WO4A 3S34L 2M8XA 4N8VA 5J57B 1IQDA 4DTGH 1QSVA 3RVWC 1X5XA 5T1KB 5DT1L 5GSVA 5EIIB 3GSVB 1JF6A 4LSRL 4JZOB 1FQ9C 3BT2H 2JJUA 3Q1SL 4R7NB 5AD0A 2DLTA 1KYOJ 1YEDA 2WQRA 4R8WH 5I76A 2IBZX 3HI5H 2NNAA 4O2FA 3S4SA 4WTZA 5GS0H 1KLGB 4Y1AB 5EN2A 2GSGA 4CU8A 1T21B 4RMWA 2BXYA 3D9AH 4G7YL 5C09E 5KSAA 1G7LA 4PJBF 4IEFB 4R7DB 5CSZB 1IC5H 3RTQC 4JLRA 1INDL 2GJZA 1SY6L 1BIIB 4CVXA 1AHWA 4MNQB 1BEYL 3D69A 3CX5K 4LKXA 4NWTL 3WE6A 1RIUH 1ZT7A 3RAJL 1P4LB 1NBZA 1EH9A 4ZXBA 4I3GA 2VN7A 3NVQA 5DVKA 1IKFH 1TJIH 5IESH 3CDFA 1IZKA 2AK4E 3FT4B 3PQYB 4HPYL 5CGMA 2PTTA 4BQ9A 2X4QA 5DJXA 1K3ZA 2OI9B 2XN9B 4XP9H 4PGDB 5CP7A 2OSLB 4DN4L 1VEOA 1JTPA 2GJ6D 5I1CL 4JO2H 1ZLUH 5E8OB 2IBGA 1BFVH 4MHHI 1D9KC 1XIWD 4H8WC 1MAML 5T33L 5L6YL 5H35A 4KTEL 2B39A 1JPFA 2CIKB 3QXVA 2GK0B 5FKPA 5I2IA 4Y16A 5M7QA 5L2KE 2D7TH 1T22B 4UINH 25C8L 4WFHD 3KPQA 4HK0B 3L3HA 1FVDA 3PL6A 4PJDE 3TYFB 1VACB 2BY1A 5HI3D 5T3ZE 3BZ4B 3ULUL 5EO0A 5D7LA 4PB0H 4ZYKA 2F74A 5EBLA 1NFDE 5JXEA 4FA8A 1Z9MA 4MDIB 3QAZB 2FX8H 4JDTL 3B6SA 5LAXA 4MAYC 1KLUB 4OZIF 5EORL 3SO5A 4OF6A 2Y36L 5L9DH 2I5YL 4LLDB 1P4BH 3GHBH 4OZFH 1DDHA 3CZFA 4P2RE 3SCMB 2H32B 4OUUB 5HGGS 2DBLL 3HUJE 3G5YB 2QQLH 2X4NA 2IANA 1YC7A 5A2FA 2AJXL 3U9PL 5F1SA 4NQCA 3D3VE 3HI1A 5JIPA 5F9AC 4CVZA 1MRCL 3QYCA 3VWKD 4JE4B 1P7QD 3LS4L 2DAVA 4G9FB 4AEFA 1KIRB 3QIBC 2I9LB 2P49B 5IBTH 4XRCB 3ARWA 1AC0A 3D2UB 4PLJC 4PJGB 4OLEA 1T4KA 4PP1C 4GMSH 1RZJH 4NYLA 1I3GL 2R0LL 4E41D 4KJQC 1KG0A 3MYZA 4M8VA 4YUEH 4EI5A 5C0AB 2NXYD 3DMMA 4XVSH 3MJ8A 2FJFA 3QUMH 2JIXB 2ARJB 4GAYB 2G60L 2P4AB 4FZEL 1I1CA 1EEZA 2FH6A 4W6XB 3EDFA 1INEH 1URLA 1EDQA 2FD6L 1FNSH 2YR3A 5FUCC 1HZHH 2H3NB 3V4PH 3CSYB 1A7OL 4MCZA 1RU9L 5IW6B 1I4FA 5FYKH 4XPAL 1WBYA 5D7JB 3HMWH 1T5WB 3B2VL 4P23C 3KXFD 4ZS7L 2R2BB 4IMLA 4QTHA 3K7UA 2R2EB 4PJ9B 2ZKHH 4KUZH 3I9GH 3K4AA 1INQA 1S7TB 2PW1A 2EDNA 3KHQA 4WO4C 4FQCH 4U1KA 1CVRA 2VE6A 4ZFOL 1ED3B 1KJVA 4KUCF 1C7TA 1G7JA 1L9MA 2DQDH 1C8PA 4P5TD 4TYUA 4IRJA 2AJZB 3LIZH 1JGUH 4FRWA 5IP4A 3AAZB 1IAOB 4KJPC 1JYWA 1KN4H 4UOJA 3WBDA 1B4JL 3JWDL 3T0EA 1U92A 2ZWLT 3LPWA 4HIIA 5I1HL 2XKNB 1EEUA 4JY6A 3TO2B 3ARED 4YHKL 1WQVT 4JN2B 1REIA 1WWAX 1EEQA 4HMEA 4JFHE 1EEYA 5DF0A 4XNXL 4O58L 5AUMB 1BM3H 5KSAC 1EVTC 2EIDA 3CH1B 4LCYA 4ZFOB 4BZ2L 5HYQB 3U0WH 3F7VB 1YN6A 2GIYA 3VCLB 4ODHL 3QXAA 9CGTA 4AEIL 3DECA 3LCYA 5LCVH 4FTVD 4APQD 4CMMB 4MJID 4R97C 4Z7WB 3AVEA 1ZOXA 1ZGLA 2NY0D 1AHWC 1OD7A 4R4BA 2BNUB 4FG6D 4F9LA 5C07E 3G5ZB 5FECA 1NMAH 3TZVD 1R5IA 3IDIB 4RMVA 4Y88A 3L9RA 3PG2A 4KRPB 5L0QB 5MEOB 5EU4A 4ZXBC 3OGOE 5DJDA 3O2WL 2Q76B 2MCG1 3CVHA 1ADQA 5JPNB 1AGDB 5TDOA 4HSQA 4UDTB 4YDVA 3RDTB 1A7QL 1A6AB 1Z3GH 3BKJH 1EZVX 3GMPA 3ALXA 5H8DA 3VFVA 1FFOB 1SMAA 2DLEA 2EXYD 4R2GB 2XNAA 5F21B 2J8UF 3MFGB 1DBAL 4OKVA 5MI0B 4F8QA 2DWEB 3L5XH 1KB9J 4ZSOE 3EYVA 1MFCH 2ICES 2J4WH 3HRZB 1YMMB 2LU7A 2ICCA 4AL8H 1P5VA 4N0CC 2HKFH 1PQZA 5IMOA 5C6WH 3RFZC 2XWBA 3ULVL 2DM2A 4U2ZA 1U58A 4Y16C 1CBVH 4L4VD 1QSEA 4JM4L 1K8DB 1YUHA 4WUUA 1LE5A 3CMOH 1I3RB 3KAAA 3PL6C 5C2BH 1I9IH 4DFHA 1S7XB 5ESQB 3CDYA 1MI5A 1A9BA 1U8IB 3BDYH 3GI9L 4I0PB 4XTRC 4Y1AE 3U1SH 5LG1A 4HGKC 1OAYL 2FHFA 1A22B 3AUVA 1JPTL 1NCWH 5JXEC 1UB5A 4JFPA 5EOQL 2VR5A 1GZPA 1YN7B 4ODVH 3OHXA 3BQUB 3C87A 1XF5B 4AM0A 3OG4B 2Z31A 2VZOA 3OR7B 4N9GA 5E7FA 2BDNH 3HR5B 5CILL 2P1YA 2VAAB 4MNQE 3HE7B 1MY7A 3MUJA 4OLZL 4FQIH 5I1JH 5D1QA 5JOFA 1MHCA 1F6AA 2SEBB 2DM7A 2EYSA 2QQKL 2V7NA 2PXYD 3T3ME 1A6WL 2HLFD 1LDPL 4I0KA 1NCBH 3QUKA 5DURB 4GXVL 1X5KA 3MUY1 4OZ4A 5I1KH 1I75A 1ND0B 1Z9OA 4MMXC 1HQRA 3PQYE 4B7IA 2C3HA 4X0KB 5CJ8A 3CX5J 3QDJE 1MF2L 1QYGL 1F4HA 2CLVB 3QFJD 4NQVA 2ZCKH 3BOVA 4F7MA 4UUJA 2NX5D 1YNKL 3RX5A 4KZEL 1BVKA 3HB3C 1EIBA 5BRZD 1X9QA 1JWSA 4KJWD 4OI8A 1AP2B 3CVIH 4PJEB 5E9DA 5J56B 1V7NH 3KYKL 3C6LB 3M8OL 3TO4B 4GLRI 3DX9A 3TJEL 3WFHB 2DYPB 3KPOB 4Q7DA 1MFBH 3P0YL 1JRHH 4PRIA 4EI5C 3DMMC 4W6WB 1JGLL 1GGIH 2VLKB 4YDIL 5A16A 5SWZB 1JNHB 1A7BA 3CFDB 3U4BH 2CO7B 1SBBA 1N5AA 1UWXH 4LSTH 4HJGB 5DRZB 4PGBB 1G6RH 2H6PA 4HUUA 3K1KC 3GM8A 2I25N 4H26A 1S8DB 1EFXA 4BYHA 1CXHA 4LRIA 1FVCA 4HC1L 1Q9OA 4K7PH 2CK0H 4MA3A 5C0BD 3RVWD 4BA8A 1RPQA 4FHBD 4HF5L 5F97E 5K9OA 1F58L 1D5BA 3FHAA 2QV2A 4BH8A 1P4IH 2E6JA 5DMKA 2WWMC 3ULUE 5F9WB 4ONFH 1ZA3A 4KVCL 4IRJC 4WHTA 1LNUB 2HFEA 4JFDB 1E4KA 5D2NB 1WFNA 1FE8H 3C8HA 5DXWA 1NMCB 4YNYB 4QHLA 2WIIB 4G9FE 3T0EC 2XY2A 3MV01 3TP4A 5F71A 2G5BA 3CCHA 1PKQA 2OZ4A 3T4AA 1YEGH 4WWKA 2XG5A 1U6AH 3RTQD 1JV5A 3VFGL 4G42A 1TJHH 4PJGE 4H0IA 5IT2H 4Q2ZB 4ONOA 5JW5A 4L3EE 4ZUWB 1FZOA 3Q6GH 1DEDA 1K2DA 3MODL 1AGBA 4FQJL 3FN9A 4EXPX 1ZLSH 1XR8B 1D5MB 5C0AE 5L2JA 3RWEA 4JFEB 2CKBL 2V17H 2ZJSL 4G8IA 3S5LA 4XVTL 3FMGH 4RNRB 1RJZA 4QWWC 4F9LC 3BSZL 4X6FA 3GB7A 3LB6D 5FUZL 1PEZA 3ZYZA 1WWBX 2MPAL 4OZGF 2YZ1A 2W9DH 3FJTA 2FR4A 2EDJA 2YBRB 4MJ6B 1D9KD 3OKDA 3IDJB 4XBGB 3S88L 4EDWL 3BH9B 1E4XI 1TIUA 4ERSL 1DUYA 4Z0XA 3KPMA 1KN2H 5BO1L 5C86A 2IPUG 3S35H 4MVBC 4Z95L 3C5JA 5GGRA 2CKBB 2RFXB 3CDGB 4NQUA 3NCFB 2NY3C 3DVIA 5HJ3A 4ZOBA 2D9CA 3JZ7A 5EZIH 5E99L 1H3PL 1MH5B 2H2SC 2QADB 4X8JB 3VMPA 2VLRB 2VITB 1U8KA 2HT2D 3S96A 1L7IL 5ID1B 2IMNA 4Z7UB 3E6FA 3TFKC 4Y8AA 3CD4A 1I85A 1UADC 3WXVL 3ZTJG 5F9JB 4D9RE 2PR4H 5DK0A 4MAYD 3SDDB 4WFGD 2Z35A 5B39B 2DLGA 4TSAL 4F57H 3SDCB 3DX8B 1FORH 4P59H 4NQEE 1YEHH 1AGFB 1A7PL 1NMBL 4YHZL 4KJYB 4BFBD 1F11B 5C1MB 3FB8B 3MA9H 4FQXB 5DMJB 2GITB 4Z7WE 4NQSA 4MA7L 4MXWH 5D1QC 4WNQA 5D7KD 5EU6D 4H5SA 4D8PB 3FFDB 3RJQB 5IHUL 4S0SD 3QIBD 5ADOL 1G7IB 5D2LA 5D5MA 2WUCL 2HT4C 4PLJD 2R1WA 1V5JA 4PP1D 3DOSA 2BOBB 4JRYD 4KKNA 1NH6A 4G6FB 1NL0H 4KJQD 5IUSA 1LQSR 3RPIB 4EBQL 4L29A 3IFNH 2W92A 3MLXH 1EGJA 3QFDB 4HBCH 1H5BB 1YMME 2IQAB 3HLAB 3LQZB 2A9ML 1MQKH 1G7QA 1N26A 2GTWA 5TQ0H 3VXTB 3QQ9D 2DM4A 5JQ6L 4WEUD 3HPJA 4JQIL 5ITBH 3IVKB 2ED8A 1LK3H 1T2QH 1RQ5A 4GW5A 3ARUA 4KRLB 3T0VA 5HGBA 3GSNA 3OAZH 3HC4L 4HIEA 1RUKL 2EIZA 5GRWA 2QR0B 3QULA 4IRSD 1NLDL 1A14H 5DK3A 3FCTA 4EI6A 1MUJA 1UKQA 4U0RC 5IROA 1A3LH 4LHUB 3ULVE 5C0EA 5JTWA 1ZVHA 4R26L 4PS4L 1AXSB 2XZZA 2ZSWB 5E8EB 1ZKAA 4KJPD 1KV3A 1YQ2A 5LGJB 2AS5M 3NFNA 5JOPD 5LBSH 5E94A 3KPSD 5SWSB 1GAFH 1UVQB 3OQ3B 4J3UA 2J6EH 2OQJB 2CKNA 4N1HB 3FOLA 4M48L 1E4KC 1U8MB 4YE4L 3ESVF 4GW1B 5KSAD 3TN0B 4ZPVB 4DTGL 2LABA 1Q9LB 2IH3B 1SM3H 4WWKC 3HZYB 2YC1B 1L0XA 3TWCH 3KVQA 4X4XB 3BT2L 5HVGB 1TJGH 2BJMH 5FV2A 3S97C 4QKXB 4XP6H 2VZ3A 3OWEA 5A1AA 4R8WL 3AB0C 1T20B 3VFMB 4ZXBD 2IADA 2VLKE 3NCEB 2F53B 4U7SA 5SWZE 3D9AL 4WCYH 4OLXH 3ARPA 4JPVL 5IB4A 5FCUH 5CSBA 3SDAB 5IK3A 3L95A 2W65A 4U1NA 3W0WB 3BPLC 1TTGA 3QDAA 3STZB 1MHPH 1A64A 1IC5L 3QXTA 3QIWB 5HDBF 4Z77A 5CGTA 2FATH 4OQTH 3PWPE 3STLA 4K3GA 1EAPB 1RIUL 2Z8SA 3JTSB 3L3IB 4N0CD 3IAQA 2HFFB 4WI6A 3RQ3A 1S9XA 2VWEC 3JUYA 2VUYA 4PJ5A 4BH7A 4Z7QE 1IKFL 1TJIL 5IESL 4Y16D 1ZLVK 1BVLA 7FABL 1CS6A 3VXSE 4JJ5B 5MENA 3PL6D 1IMHC 1HIMH 4PJFA 4XP9L 4I3SH 2HN7B 2O61B 2LU3A 3MROB 3BIBX 1BBJB 4LF3A 2H8PA 4JO2L 4XTRD 1BFVL 1MRFL 1QP1A 5D2NE 1CDHA 3BUYA 2OR9H 2JELH 4M4PA 3LKQA 2YZ8A 1RJCA 1CN4A 2MTPA 3NN8B 1U8QB 4WDIB 4CW1B 2ICWA 5TPWH 1DLHA 5CEZH 2LAAA 1JZ6A 2EKJA 2XA3A 1KENH 1X5YA 4XNMA 2D7TL 4UINL 1RFDH 3T1WA 1Z9LA 3X3FH 4YXKH 4YIQB 4OV6F 1JZ3A 1U8JB 1LO5A 4Y4FB 5C9JA 1AQDB 2B4CC 4CAGA 4WIQA 5ANMA 4IDLA 4GBXC 2PKDA 2C4XA 2FEEI 2ZOKA 2UY7A 4L9LB 4XXDA 3CMGA 1WTLA 2JKXA 4XNQA 2FX8L 3IB4A 2FNBA 3X12A 4GG8B 4EUPG 1DBMH 5CJQH 4NKOB 5L9DL 5SV4A 3V5KB 1BQLH 1P4BL 5KVEH 3HB3D 2WLYA 2QQLL 3PWLB 2E8ZA 4H8WH 1J1OH 2PYFA 2C1PB 3E8UH 3VU2A 2P7TB 3ZDXF 4POYA 1C1EH 1K4DA 5TF0A 3UBXB 1QVOA 1W72H 1I1YB 2WQ8A 1LO0H 4PRPB 3EOBA 4I18A 4N90D 1QO3A 4YGVB 1FL5A 4Z7UE 2RGSA 2AABL 4M62L 3CC5A 2RHEA 1F3JB 1S7SA 2X4OA 1OGTB 4GMSL 1RZJL 2G9HA 4AENB 4OCLC 3LD8C 5FHAH 3JV5A 4KQ4H 3AM8A 2C3WA 3EYOA 4U1MB 4YUEL 4NJAH 3U6RA 1P84J 3KWWB 4M00A 4QYOA 4W4NA 4LGPB 4XVSL 4O51B 4F80A 5IROC 1QFUL 2E9IA 3QUML 4HLJA 2WWMD 4EVNA 3T0DA 1WIPA 3QQ3B 4IBLT 4QOKE 1INEL 2APTA 4LP5A 4KZDH 1FNSL 3V4PL 1HZHL 4PGEB 5D96B 1FNEA 5ISZB 5CEXB 4IRJD 4FABH 4A2MA 5T5NF 5FYKL 5E8PA 1NKRA 3E3QC 3T0ED 4PJBE 3HMWL 5ACZA 3OX8B 7CGTA 5GS1A 2GQHA 3WFCH 1BFTA 3I50H 3FAXA 3KS0H 8FABA 4GLRH 4UMGA 1QSFE 1SHMA 5DYOB 4CGTA 3QEQD 2ZKHL 3SDYH 4TPRH 4KUZL 3LN5B 3QUMB 5F7WC 4JO1H 3LPFA 5HYJA 4G43B 2I60H 2R0ZL 4FQCL 1TQCB 5DJ6B 4DGIH 1JHLH 1HEZA 1I1AB 3ARGB 4MJ4A 2DQDL 1RULH 3LIZL 5JIIA 1WZMA 3NPSC 1N2RB 3BWAB 1DL7H 1KT2B 2CQVA 4QWWD 3AS3A 3C09C 3DHJA 5E24E 2H9GA 4RWYL 4QRRB 4FQ2H 4NNPH 2X2YA 4QGYA 4NNXA 1AIFB 1JN6A 4WU7B 4X4MA 5HPOA 3MLTA 4M1CC 3BH8A 4CKVX 3WHXB 5LGHH 3NAAH 4NO0B 1ZLWH 4LVNC 1BM3L 4JFQB 5F6IB 1MIEH 1OD9A 2H45A 4KROC 5C6PB 1KIPB 3BD3A 3MRLA 4MVBD 5LCVL 3GJFB 3VFNA 1T7WA 4MNHB 4N8PA 5KSBA 4NT6A 2NY3D 5IHZA 3JTTA 1D6VH 1W0WB 3LSOB 4UDUB 2FEDC 2H2SD 1NGWB 4HXBH 3EYFA 3TF7C 3MBEB 3GUTA 3CIQA 1TQBC 4O02H 5F89A 2BNRD 1R3HA 4YQXH 3BKJL 1Z3GL 2JCCA 4WUUD 4OZIE 1AJ7H 4X4YB 2Y5EA 5HHQB 5SWSE 2A9NH 3GM0A 5IFHH 1G7PA 1ZA6A 3MRIA 4LVOB 4LPTA 4OF5A 4ZOAA 3UX9B 1WZKA 3VD7A 4E9LA 1DP0A 5HYEA 1MFCL 1UFUA 2J4WL 4DUXA 3E2HC 3BYYA 4HIXH 3UJTH 4AL8L 4OTXL 2HKFL 3RWHA 1QNZL 1E27A 2V7HA 3CLFH 2DTMH 1CBVL 3X11A 4GOSA 3T77B 5ICZA 3CMOL 5ENWB 3VRJB 5C2BL 1E4XH 1I9IL 1UWGH 1IL1A 4NBYB 5TGBA 3Q6FB 3FRPG 3U1SL 3V6OE 5I15H 3TJHC 2F53E 1ORSA 1VESA 2EDOA 1J0KA 1NCWL 3WSQH 2IF7A 3D39B 4O4YH 4Y89A 1X5IA 1FRGH 5DD6B 3V0AC 5I73B 2HT4D 2Q6WA 4JANB 3W9DA 3W0WE 2EDFA 2GTZA 1A7NH 3CFEB 1R0AH 5FYJD 3PP3H 3DI3B 5JHLL 4X6EB 3U7YL 5FDWA 4JQXC 1F4AA 4OCXH 3V5DA 5I1JL 5F70A 2EDXA 1T0NA 1MLCB 1C16B 1NC2A 5FM5O 1D6EA 1NCBL 5E9DD 3IETB 4UU9A 3U2SB 4OZGB 4L5FH 3ES6B 4ODWB 3MUGB 4OCMC 4X6CF 2F8XC 3I6GB 3FQXB 2C3XA 3UTSA 4DUVA 1RK1B 1VFMA 4S0TD 4Y8DC 4GQPH 2AXFB 1DN2A 2XWJA 2DM3A 2WAHA 5DQJA 4S11A 4ZODA 2MSPA 3X3GL 3BGMA 2NY5H 4IIQA 3EFFA 4XPGH 4NKQB 4GG6B 1EFXD 3MGOA 3DIFB 1V7NL 3EOAB 4P57B 1TITA 3ARFC 4DGYL 5J06A 2PETA 4Z78A 3AM8C 5L7XL 1JRHL 4Y4FD 1U42A 4NKDB 3HG1E 3O45A 4GJTB 1ZHBA 3R06A 1UCBH 2IJ0C 3V7MA 1QA9A 5HD8C 4LSTL 3CFIC 2E7LA 4MXQC 5HI5C 2ZCHH 1N8ZB 1SEQL 4OFKA 4WHYH 1YA5A 5EBMB 1A4KB 4RFNB 4QRSB 2EC9T 3FTGA 1XIWB 1FFNA 4K7PL 5DK2B 1P6FA 5GS1C 1I1RA 2IG2H 4YHYC 4YHLL 3MGTB 1X3DA 5IVOA 3MCKB 3L3JB 4RCAA 3EZ8A 3VH8G 43C9B 4ONFL 1A4JB 5KVGH 2PYEA 5GGTA 1I8KB 5GRVK 1YMHB 4LPVA 4E42B 1FE8L 3LV3B 4K8RC 1FN4B 4PRPE 4DKEH 4Z6AT 1WSST 1IGTB 2J8UE 1EFQA 1YEGL 3VGBA 3QDMB 3LRSA 5FO8A 1U6AL 1TJHL 1CLOL 5IT2L 1WISA 2X1XR 4PV9A 1CDCA 3IXTA 1FL6B 3BAEL 4GRLA 1CE6B 2VMFA 3QNZB 3Q6GL 2CD0A 1NDGB 4NQDA 1A8JH 3P4NB 5D6DA 1CGVA 3LKNB 1TZIB 1ZLSL 4GS7C 2V17L 2Z93A 3FMGL 4NKMB 3BXNB 1WGOA 5H2BA 3V6ZA 5JOEA 5F88B 2OP4L 3NA4A 2CLRA 2W0FA 2W9DL 3SQOH 2P45B 1XEDA 1P2CA 5DS8A 2X4UA 3VWKB 4Y7MA 1P7QB 4HAFA 5KVMC 1BOGB 3WIFB 1T7YA 1U36A 2W0KA 3OKKB 1TVHA 1KN2L 2Y4SA 3S35L 5IHBA 3TNMB 3KPRA 5E4EC 3ZYOA 4YO0A 1KPUA 1TCMA 2KZWA 5HHOA 3KGRA 4E41B 2APFA 3A6OA 3JVGA 3VD3A 5FB8B 2ADJB 4LLQB 5EZIL 2NY6C 4U33A 1IGYB 2NXYB 5GS3A 3RL1B 4LLWA 3U0PB 2JJWA 4RGMC 1BGXL 5FYKE 1R5WB 3A6BH 3UYOD 4JO4H 5FF6B 4GBXD 3C6SB 4RX4D 1X5HA 4IMKC 4LLVA 3FQNA 1FC1A 2FJGB 5CJBA 4PV8B 4YPJA 4OFDA 2V5MA 2PR4L 1KPRB 2HWZL 3FRPA 4QHNB 3LMJL 3GO1H 3U0TA 4F57L 3SHSA 4NUJB 3BDBA 3L7EA 1FORL 2ICWI 4S10A 3B5GA 1JFQL 2VDNH 4HW6A 4P59L 1MNUH 1J12A 1RZ8A 3KXFB 4X99B 1YEHL 2L7JA 1BQHG 4BQCA 2EKSB 2VL5B 3WO4C 4UILH 5KSUA 2FCBA 3CVHH 1ADQH 1M7DB 3MA9L 4K3JL 4GAFB 3GEWB 4MXWL 3DYOA 4FP8L 3QJHB 1PEWA 1W8NA 3L3OA 1F4YH 5F3HA 3O6LH 4HUVB 4MDJA 2EIEA 5DA4A 4O5LL 1P7KB 2X89A 3Q2CA 1TZHA 5EZOH 3VXQB 2EC8A 1I7ZA 4LSQH 4M7ZC 4XXCA 4HKXB 5E6ID 1WT5C 1O5DT 5I19H 3RVUC 4OQ1A 3VGAC 4OBRA 3AREB 4Z9KB 5KN5A 4E0RB 1NL0L 5J4MA 3O4LA 5EB9A 1TNNA 3WNPA 3IFNL 1KJ2A 3MLXL 3LQAC 4HBCL 2YD4A 3G08A 3VE0B 4YHIB 1FZKB 4IIQC 1I7TA 4OGZA 4FTVB 4APQB 1MFEH 4FFYH 1MQKL 4MJIB 4WFFE 4PY7B 1S7VA 2NY0B 5ITBL 3TZVB 3C9NB 1LK3L 1T2QL 3WIIH 3EIFA 4LAQH 2W91A 2R9HC 4S2SB 1MCKA 3RKDC 4ONHA 4N0FA 3NABL 4UV7H 1R6VA 4MB3A 2ESVD 3LEXA 3S36X 3OG6B 5ETUB 3SJVA 2AW2A 2E7LC 5F1NB 3D39E 1D7FA 1ZT1A 1II4E 3KLSA 1A14L 1Q94B 1MHEB 1A3LL 1IAKA 4N5EC 4X5XB 2N7AA 3SKNB 3STBA 4WI9A 4DKDC 3TCLB 2DOCA 4BM7A 4PLNC 4XH2B 2FZ3A 4HIHB 2C3VB 1FJ1A 4P4KA 4DCQA 3GJEA 4YHPB 1KTLB 3V95A 2HG5A 1L9NA 4POZC 3TPUA 4OZGE 3I3EA 4JDVA 4L4VB 3VFTA 2DKMA 3QPXL 1X7QA 1GAFL 4F15C 2J6EL 4M1CD 3H7BB 3NIFF 2F5AH 3FFCD 4HH9B 3X13B 1UJ3A 1T1ZB 1RD6A 3DXAD 2AGJH 3BP6B 3DX7B 4YPGB 2FDBP 3IGAA 1A5FH 4FFWD 4KROD 3OXSB 5E8DH 4TN9A 4PRNB 1PAMA 1SM3L 4OIBA 2YPKA 5IVZA 4F2MB 3TWCL 3IAGC 4YBQC 5DO2D 2FO4B 5HPMA 5GIRB 4GRLC 1TJGL 3VFPB 2BJML 3G6AA 4HWZB 1FFRA 3HZMA 4XP6L 1J0ZA 2Y06H 1T1YB 5D6DC 4MQSB 2FEDD 2KBGA 4A6YA 1KACB 5JIHA 5BQ7A 4CN6A 2WMPA 4PJ5D 1TVBA 4WCYL 1HNGA 4OLXL 5FYLD 1B4RA 2PCPA 2HT3C 2ATKB 4YC2C 5FCUL 5HYSG 3LH2H 3VRIA 4F7PA 1SJEB 3EJYC 1H8OA 5MEND 1MJ8H 4GMTL 4HLZH 1CDYA 1F5WA 1CFQA 5HGDB 3QFJB 2GJ6E 3TIDA 5JZ7C 3L7FB 1SYVA 4J3VA 2YD1A 4YAQA 4OQTL 3O8XA 1FLTX 3ZTNL 3DVNA 2NX5B 2CSPA 5BV7H 3TBVA 5HHXH 1FVEB 2J88H 2GT9B 4J4PD 2NTFA 5JDSB 5BRZB 4K94C 4LCCB 2BC4A 4U1LA 4PJ7A 3JVGC 3UROR 3WNLA 1S9VB 3NCYP 2OZ4H 1HIML 5SWQA 4WFHE 4I3SL 1M6OB 1CFSB 1VEPA 2A6KB 4JVWA 1ZHLA 3TJHD 4I48A 4JHZA 2OR9L 2JELL 4X9GA 5F6HJ 1HSAB 1AD0B 2XQYG 3L5JA 5KOVC 3MXVH 2AJ3B 3ZT5A 5TPWL 4N1EA 4OZHA 1A47A 5C0DB 1EHLH 3OB8A 3WUWG 4JDZA 1J05A 1GGCH 4JFFA 1KENL 5IOPA 1CICA 3IKCB 3BVNA 3ZZ1A 3HAEB 4L4TA 5C0BB 3X3FL 4YXKL 5I16A 4JFYA 2XTJD 2M26A 2QTEA 1N0LA 2UZYB 3ZKXB 2HMID 1A7RH 2FX7H 3BPNB 4FFZH 2I27N 2R1YB 4HS3A 2C4FU 3SKUD 2X7LA 2BOCA 2BVUA 5K9QI 3PABA 3BN9C 2BK8A 3MO1B 3RL2B 1CD1A 4OLYH 2KQNA 3GSXB 4L9DA 2XWTA 1UXWB 2DQJH 4KDTA 3MPCA 5GGVY 1DBML 2ITDA 3TV3L 5CJQL 1KIQA 1X44A 4U1IA 4XXCC 5KVEL 3TYGH 3H3KA 5BJTB 4HUNB 5HXMA 4ONGH 3ILPA 3UTTA 4Z8FH 4H8WL 5IR1A 2XIDA 2P24A 3ARFD 3GGWB 3MV8A 4NZDA 3CAFA 1GC1C 3DO7A 4H1LG 4JPKH 5B38G 3GZKA 5B8CA 5JHDD 1W72L 3VFOB 4UI2A 1LO0L 1G9NH 1OL0A 1PD6A 2JF1A 2BVQB 5HI5D 3SGJA 1HKLH 2B4CH 1RZIB 1N59A 1DQLL 4NO5B 1D9KB 3J7HA 2EDWA 5FHAL 3BISA 4HFUH 3RGVA 4Y4HA 5JW4R 4KQ4L 4OGAC 3DROB 3KXFE 2EYRB 1EHAA 2EXWC 5ESVB 5JPMB 2VR9A 4FXGA 5HYJD 2BHZA 2VKWA 1UZ6E 1Y0LA 3O3DB 1Q72L 1XGUA 4PJAB 2ARWA 4NCC1 5GGUB 3MV7A 1R3KB 3P4MA 4FABL 4P4KC 4XZUB 1LEIA 4KGLA 5IHLB 3KNBB 3WFCL 3I50L 5HDBE 4HUKB 2JK5B 5EDXA 1EGJH 4O00A 3KJ4C 1SJVA 3DARA 1UB6A 4MAYB 1UJ3C 4TPRL 3S6CA 1IBGH 1WAAA 3CPLB 1FV1A 3SO3C 3UTQA 1QUNA 4JO1L 2Z8WC 3RNQB 3MRBA 3UAJC 2PF6A 1U8NB 2NZ9C 3EGSB 3FO9B 4DGIL 5H37H 1NUFA 2G2RB 1RULL 2C1OB 5FKAA 1UM5L 1NAMB 1DL7L 4X6CB 2OTUB 5IMMB 3GSNH 5KOMC 1C5DB 4MJIE 1XH3B 3R0MA 3V79C 4QHUA 3IFOB 4X7TA 2QJDA 4FQ2L 4NNPL 1ONQB 1ZEAH 5F1IB 4D0DB 1FNGA 5EU6B 3PWUB 3CXHJ 4LDOB 4M93C 1G1YA 1SQ2N 3K46A 3QCTH 5LGHL 5DGQA 3MRMA 1QRNA 3NAAL 2NY2D 5HYSA 3QIBB 1OWRM 2X4RB 1MIEL 4U1HB 3IFLH 5CBEB 2VLLB 3EHBD 3OAYK 4LLUA 3F12A 1LK2B 3M07A 5BZWA 5C0FB 4ZUUB 2BSSB 4JRYB 3O8XC 5JORA 4F9PA 1L4IA 1ZGLP 1D6VL 4YEEA 5ITFA 2NY6D 5CP3A 1WFTA 3OKLA 5I1AA 5D1ZA 4O02L 3BN3B 4ZUTB 1HILB 4YQXL 4L4VE 1AJ7L 1IM3A 2L4OA 1D3CA 1MCBA 1WZLA 2J12B 3BW9A 3MOBH 1VPOH 2A9NL 4ZDHB 5IFHL 4JGJA 1U8LA 4J8RB 2EO1A 4F3FA 3HCVB 5B3NA 1A21A 2A0LC 4OLUH 3S8WA 4AZ8A 3U4EA 4HIXL 4IRSB 5EO9A 3UJTL 4PG9A 2Z92A 3L5WB 1KXVC 1YPZF 1NBVH 2OXGA 3CLFL 2DTML 1E4JA 3ZDXE 4N8VB 1F45A 1E4XL 1NC2D 1F42A 1UWGL 5GSVB 5C7XH 1IEBA 3GMLB 1K5NB 5I15L 4AT6A 4K7FB 4U6YA 5DRNB 5AD0B 1T3FA 3KPSB 3RWGA 4O4YL 2YOCA 3JWNC 1FRGL 4OCWH 4XX1E 2NNAB 3CSGA 4O2FB 4RA0C 3S4SB 1A7NL 5EBWA 5EN2B 4NN5C 2Y7QA 4CMHC 1R0AL 4KDTC 2AQ3A 3QFJE 3G5XB 1VB9A 4NHCH 4HG4K 2R4SH 3MV9D 5FYLH 1WCBB 5MP6H 5KSAB 1G7LB 2AEPH 1B0GA 2NX5E 3ZMRA 2Y72A 2FBOJ 3B9VA 3C8KA 5BRZE 4JLRB 4JREC 5D2LF 2ADGB 5D5MF 2VISB 2VXUH 1DSFH 4R97B 1ZVYA 1UQSA 5FFLA 4RSVA 4L5FL 4Y2DA 4GAGH 3D69B 3EUUA 4LKXB 4JO3L 3ZTJH 1UEYA 3IKKA 4NSKB 2D4DA 2R9HD 5B38A 5B8CC 3RKDD 3B5TA 1T04A 3RPKA 2PTTB 3SGJC 1L0QA 4CVWA 1SVZA 1J8HB 2Z8RA 5E2UH 1IT9H 2LVEA 4XPGL 2CDFB 1IILE 3ZKMC 4WW2A 3ISWA 4N5ED 4QO1A 1T7ZA 5HYFA 4Y4HC 4MNGA 2D7NA 3BZFA 5H35B 5C0BE 1NAKL 3MRRA 2VDKL 2YKLH 2ADIB 4PRHA 4XNZC 1MWAA 1UCBL 5I30H 2YD6A 2GCYA 3O4OC 2D3VA 1NKOA 4Y16B 4POZD 4NWUL 2F5BH 4P5MB 4JRXD 3L3HB 2ZCHL 3PL6B 2NQCA 2V5YA 1EHNA 2PYED 2VZTA 5EO0B 2Z9TA 2Q3ZA 1MLBA 2J1KA 1MELA 5EBLB 3V0WL 5FGRA 3G9VA 2IG2L 3VFWA 2AKRB 4IJ3C 5K9KA 1IRAY 1FAIH 2XICA 4YBQD 3BPOC 4NZJA 1T89A 4NQDD 4OSUH 2ZNXA 5KVGL 4CADA 1DDHB 1XF1A 5A2JH 4XAKD 1K8IA 1SJXA 2OCFD 3P73A 1CQKA 3U82B 2X4NB 1OPGH 1UH3A 1Z5LA 2HJKA 3DTXB 5GJTH 3T4YA 4DKEL 2HT3D 4HDIA 5CBAA 4HWUA 3GMQB 2Y07L 4JCLA 4M6NH 3EJYD 3RUGA 3WUZA 3HI1B 2YEZA 5IGXH 3F5WA 4ZFFA 1VENA 4WWID 4NC0B 1RUAH 1XGQB 5J13B 5AG9A 4MD0A 2R4RH 3IDGA 1FG2A 3MJ7B 4ODXA 1WZ1H 5BVJA 3CXDH 4V1DB 3KPPA 3ZKSD 1T4KB 1X5JA 2DQTL 2WINA 5CGYC 4C55A 4NYLB 5HHOD 1MVUA 4LGRB 3RHWF 3QZWB 3ZL4H 3SQOL 5D1ZC 3MJ8B 3D85A 2FJFB 3PWNA 1A3QA 3GI8H 5IBLC 4LNVA 2NY1C 4MCZB 3KLAA 4WFGE 1I4FB 4K8RH 4LCIH 1G6VK 2CH8A 4QTHB 1VGEH 4R3SB 5B22A 1MOEA 4NQTA 1F2QA 1INQB 3O81A 1DVFA 2PW1B 4GRWH 2LE9A 4V2CB 4X6CE 3ESUF 2VE6B 3BN9D 1F4WH 4NRYA 1BZ7B 1G7JB 3N9GL 2GUOB 5D9SA 4IRJB 4UOW1 1FH5H 5D7KE 5FOBB 2X89D 3GO1L 5I66A 3SKMA 4OFYA 4XT1C 2VDNL 5EC2A 1MNUL 5MEQA 5C3LD 4OZFG 3QEQB 3LKRA 2BMKA 4UILL 3CVHL 3QCVH 1ADQL 2UZXB 3JXAA 1J9CT 5CEYA 4JG1H 1EEYB 4JRYE 3WLBA 3T2QA 4LCYB 2EDHA 2OYPA 2NY7H 1F4YL 4OT1L 3O6LL 1UENA 1XF3A 1NFIA 1UZ8B 2CPCA 1RZGA 5D6CB 3AXLB 5EZOL 3QDGA 4G80B 4KK9C 12E8H 4Y2DC 3PV6A 5J12C 4LSQL 3R1GL 3HC0A 3JV6A 3L9RB 3G6JA 3D0VB 5FUCE 3B9KA 2D9QB 5EU4B 3V6BR 5I75C 1IEAA 4WI8A 1I8LA 1U95A 4BZ1L 1P1ZA 4YDVB 5E0QA 4DK3A 1QZ1A 1Q38A 3MRDA 1BD2B 1F00I 4TULH 2X4TA 5GPRA 2XNAB 2HJFA 3MR9B 2EXWD 2FEEL 4WW2C 2DI7A 3H0TB 4FFYL 4G9DB 4OKVB 3A67H 2NY3B 4TQEH 5F96H 3WIIL 5I8OH 4LAQL 3EYVB 2D7OA 5HVFB 2GYSA 3WL9B 4X9IA 3KYMA 4MJ2A 5IMOB 2XWBB 2BRRH 1IVLA 4UV7L 2CDEB 2BNRB 5IB2B 2V9RA 5JOPE 3KPSE 4WUUB 1LE5B 5ACMA 3I2CH 4HMCA 1YY9C 5E7BA 2GSIA 4Y5XA 5D70H 1OGAA 3U7WH 4JRWA 1LEKA 3UAJD 4TUOA 5J6HB 2NZ9D 2RIKA 2AV7A 3QDJD 3OHXB 3UJJH 3RWDB 4AM0B 1DQMH 1H0DB 3QJFB 4N9GB 5FYJL 2YD9A 4GKZA 3F58L 5E4IA 2W60B 1T89C 1AY1H 2R56H 5JOFB 3UPRB 1MHCB 3I6LD 3LQAH 3WFDL 2NLJA 2EYSB 2F5AL 3IS0X 1DBKH 2AGJL 3QUKB 5DJAB 2EH8H 1A5FL 1MCNA 1HQRB 1QLEH 3HZVA 5E8DL 2COQA 1YYMH 1IFHH 4R9HA 1TPXC 4MX7A 1G84A 4J12A 5F3BA 3S37X 2O93L 1P7HL 3QUXC 3UZEA 3O8XD 3Q3GA 4JB9L 2Y06L 4O2EA 3L3GA 4K71C 1OP5K 4LEOB 5F7DB 3EO0A 5DEFB 1WBZA 1A1MB 3QNYA 4PYGA 1NCTA 1S7WA 5E9DB 1Q8MA 2WUBH 3LH2L 5F8RC 4LSPH 4Y5YA 5KSBF 1MJ8L 5I8EA 1RUMH 4UNUA 5CZVH 5DC0A 5A16B 1W8OA 2V2XB 2FGZA 1VCAA 3ULUD 2WWKO 4KKAD 1JHKH 1N5AB 43CAB 1U2CA 2J88L 4D94A 2H6PB 4IS6B 4PP2B 2AEIT 4LPCA 4JKMA 5GGTH 5HVHC 2JCCF 1EFXB 4JFFD 3MOQA 3O11A 2IWGA 1IEHA 1Q9OB 1TFHA 3N0PB 4ELMA 2OZ4L 3K2MC 3SE9H 5K9OB 1CWVA 1D5BB 4QTIL 4TRPL 4CNIA 3TBWA 3QH3A 3BFOA 1BIHA 1BZ9B 4L3CA 3MC0A 1A0QH 1ZA3B 4LVHB 3MXVL 3UZVB 1HQ4B 2QKIB 5EZLB 5EZJA 4Z76A 2Y6SC 4WHTB 2HFEB 1FLRH 1I8IA 1F6FB 1ES0A 5TH2A 1EHLL 1GIGH 1GGCL 1WEJH 3QXWA 3P9LB 4CDGC 3NH7H 1S5IH 3OF6D 2G5BB 3CCHB 4UT9H 3RA7H 1LO4H 3BEWA 4G6AC 1CT8A 4G42B 2FX7L 3UTTD 4FFZL 1WIOA 4GW4A 3FO0H 5E08H 4K94H 3RWEB 2DQJL 4G8IB 1OARH 1DN0A 1RJZB 3RKPA 4X6FB 3RIAK 3GB7B 3S36H 2IQ9H 2ICEA 3TYGL 3B9KC 3BPLB 4ONGL 2P44B 5DJ0B 4PJCA 3ZKMD 4EJ1C 3EO1A 4HX1A 1AGEA 3KPTA 2B1HH 1HCFX 1I8LC 2R2HA 3OKDB 4ZUVA 4F7CB 2K7PA 4Y4HD 1RMFH 3RWFA 1DUYB 3T65B 4TNVF 2HVKB 3FB5A 5GRJH 3IJSB 4JPKL 4F7TA 5GGRB 3DYPA 5EO1A 5TE7H 2VB5A 2UY6A 3NIFE 4DZ8A 2B1AH 3V2AR 2BVOB 3MV7D 2R29H 5IG7A 1HKLL 2B4CL 2N56A 2KH2B 3ULSA 3BWUC 3DWTA 2Q7YA 4LBEA 2XZAH 3HNSL 3T0EE 2VIRB 1JCKA 1ZWIA 1YPZB 4X80L 4NNYA 5DK0B 2Z35B 3QEQE 4Q9CA 4Y5XC 4PJDF 5FCSH 4WI7A 3R0NA 5DGRA 1NEZA 4WGVB 1IAII 1HXYB 4ZUSA 1MCIA 3TNNA 4Z7VF 1G7HA 5J3HD 4XHQA 3NTCL 4JVPA 1HDMA 5EU7C 2YWZA 1HH6B 4GBXB 1RIVL 1KF9B 2WK2A 2B8OT 4QY8A 1KJ2H 2X9YA 1OLLA 1EGJL 4KVNH 4LVEA 5GS0C 4H5SB 1IBGL 4WRLA 3V5HA 1JK8A 1QLFB 4TNWF 1QRND 1FBIH 5DMGD 5L2KA 1WITA 3E0GA 4BK4A 1Y6KR 5D2LB 5D5MB 2PW2A 3DNKA 4UQ3A 4HJJH 5ESAA 1UXSA 2R1WB 3PDOA 5GGSA 4MB5A 4XNUL 3GSNL 1SBSL 3IU4H 1FPTH 2UVEA 1ZEAL 3QRGH 4MCYA 5KVFH 3VXUA 5KSVB 5D1ZD 1A6UH 3QCTL 5E1AA 4FFVD 5IB5B 3HPJB 3BP7A 5IBLD 4Y5YC 2YD5A 4GW5B 5INCA 4WUUE 5E6IB 2E7BA 4R96A 3UTOA 4MYWB 5DFWH 3SGDI 4G6KL 3D0LB 3REWB 3LD8B 4HIEB 3WYRA 4PRAB 1RZKC 1ZS8B 4I9WD 4H0GA 1F3RB 1LMKA 3MNZA 4LK4A 3GMOA 5C0CA 1JF5A 1DBBH 4MA8H 1JMZA 4NRZB 3F7QA 3P40A 4MZ3A 2YXFA 4P3DA 5FO9A 4S1RH 3SE8H 2FBJH 5ELIA 2HLAA 4KMLB 5DHVA 1FO0A 4LOUC 2ESVB 1O0VA 3B83A 4OLUL 3V8OA 5DMIH 4MXVE 3ZDYF 4A6YH 1K6QH 3DUUB 4WI2A 4HWEH 2X40A 4PRBA 1NBVL 1TNMA 3N1FC 5E8NA 1C5CH 1JPGA 1PLGH 2Z91A 3SGKA 3O3AA 5FYJE 4WY7H 4DOHB 1I8MA 3DRTA 5I6XC 4V2BA 4MHHG 3ZE1F 1YECH 1ZLVH 3NPSB 1BLNA 4P2QA 5I1DA 1KCKA 3MRCA 1R5VA 3PWPD 3WDJA 5E9DE 2LTQC 4QRQB 3PGFH 4Y2DD 4FQLH 1IC7H 3IDNA 2NXZD 4OCWL 3T04D 3HRPA 4QHMB 4PRIE 4L8BA 3FFCB 1PFCA 1O7VA 2H41A 2IADB 3DXAB 5ADPH 1GVIA 1FYTD 5EIVA 2XPGA 4NHCL 2R4SL 5FYLL 3EDDA 4LVNB 5IB4B 1T7XA 5MP6L 3KDMB 1OAQH 2AEPL 4KROB 4CN1A 1YJDC 3L95B 2W65B 5C0GA 1FHGA 1M1SA 3BZEA 1DUZB 4UT7L 2VXUL 1OW0A 5EU5A 3CH8A 3NGBC 4UIMB 1RV6X 4GAGL 2OBGA 2OLDA 1JGEA 4MSWB 2YSSA 2OM5A 2EH7H 4PRHD 3BRGC 1TQBB 4ZFZA 1KTDA 4PJ5B 4Q9RH 3EJJX 1FCCA 4M6OH 1BVLB 3VW3H 3PHOB 5HDOA 2D0GA 5MENB 2YHGA 5J11B 5E2UL 1IT9L 1YY9D 4LF3B 3RGHA 2H8PB 3JV4B 3ETBF 1B9ZA 2X70A 1VFAA 5C07A 1Q9WA 5DR5H 3QQ4A 1DFBH 2VXSH 1FL3A 1W0VB 1IGJA 3KJ6H 2ICWB 4XBPA 1UH2A 4AIZA 3W5MA 2YKLL 4ODUB 5I30L 4XWOC 4HHAA 2QBWA 1FZJA 2F5BL 1XGRA 1U8PB 1XZ0A 3I6KA 4GUPB 5KANI 3QXUA 3ABZA 4AJ0A 1LO5B 3MFFA 1RUPH 4Q6IA 4J1UB 3VD5A 5DJ8A 1FSKC 4EDXB 5ANMB 2DWDA 3PGDB 1BAFH 4RBPK 2ZOKB 4XX1G 3MRFB 1EMTH 4XNQB 2ZUYA 5HGAB 1CGSH 1HH9B 1FAIL 1HHJB 4JZOA 2IH1B 3X12B 5E03A 3PE9A 3QUXD 3T3MF 4R7NA 1PZ5B 2YMXH 4GXUM 4NM8H 3P0VH 4OSUL 3VXPA 1TMCB 3F7YB 2XTJB 1KLGA 4Y1AA 1OPGL 2IPTH 2JTDA 2JJVA 5GJTL 1T21A 1AO7A 2VWEE 4R90H 3OB0H 1SJHB 2VC2H 1DJSA 2GHWB 2PYFB 2ZPKH 4M6NL 5T5NG 2AAVA 1AXIB 5IGXL 4F33A 3RX7A 5CSZA 4RRPA 1RHHB 3LEVH 4YK4C 1K4DB 3OKNB 1RUAL 1QVOB 1CTOA 1QO3B 1P5UA 1WZ1L 3CXDL 3CK0H 1P4LA 5H94B 1S7SB 2XA8H 2G9HB 5CMAA 3C5SA 1QPXA 3ARFB 3FT4A 4KAQH 5DJCA 3W9EA 1QSFD 4Z18A 4FQQA 3ZL4L 2XN9A 1UM4H 4HIJB 3U6RB 1HHGA 5JHDB 4YR6A 1QBML 1Y18B 3HFMH 3GI8L 1YEEH 1FNEB 2BSRA 5D71L 4PJ7F 1EV2E 4DEPC 4K8RL 4OFYD 1J88A 4LCIL 5ACZB 1P53A 3M1BB 1VGEL 5D2LE 5D5ME 2DJSA 1KTRL 3ULUF 1XCQB 4G6AD 3TYFA 4YHYB 1FIGH 4NKIH 4UQ2A 1BJMA 1DE4B 2E7HA 3BZ4A 1JGDA 5FGBA 3SGKC 5HYJB 2DS4A 1YY8B 5TDPA 1F4WL 3W2DL 5KZCD 4MDIA 3L5IA 1F8TH 1FH5L 3EOTH 3CX2A 1NBYB 4OGXH 1ZLUK 2OR7A 1KFAH 2DDQH 5CP3H 4PGJA 4M9OA 3MLTB 2H32A 4IRZH 4OUUA 5DMYA 4HWBL 3G5YA 3QCVL 2FLBT 4JG1L 4MD5B 2HVJB 3H3PH 1RZ7H 3GSOA 4W68A 5L88H 1MJJB 4JZJC 2CRMA 2Z4QA 4Y4KB 2GFBA 3VFNB 5KSBB 1OW0C 5HHVH 1DQTA 1U93A 1JL8A 12E8L 4OCYH 1KIRA 2DMBA 3V0VA 2I9LA 5CSGA 1OY3B 4XRCA 5D72L 3HPLB 1V05A 3GUTB 3WKNA 3E3QE 4BSWA 1R3HB 2NY2B 1JTTA 4K7PY 2JCCB 2X1OA 1T1XA 4TULL 5JR1H 1KCVH 3FN3A 3OKOA 2CJUH 1G7PB 1MEXH 1AD9B 3GSRA 3T0WA 1OGAD 4GAYA 3A67L 4TQEL 5F96L 1Q9KA 4DOHE 4HKZB 5I8OL 2NY6B 5E95B 5IVNA 3CSYA 1PY4A 1GH7A 4OI7A 4RGMB 2PO6D 2BRRL 1E27B 5D7JA 2IFFH 2V7HB 4P2OA 1T5WA 1LE9B 1B90A 4Z5RA 3I2CL 2R2EA 5GS0D 1S5HB 5TGBB 4XC1H 5I17B 4Q6IC 2OL3B 3FFCE 1S7TA 5E2JA 5D70L 3DXAE 3U7WL 3R8QA 1KCSH 3W9DB 3UJJL 1TTUA 2AJZA 2GTZB 1DQML 3AAZA 4EUPB 2GK2A 1MCFA 4S1DC 1AY1L 1X4YA 3V5DB 5L8JB 3C5ZA 3DI2B 4K3HA 1WAAF 1S78C 2LQRA 4WJ5B 3LQAL 4WU5B 1NC2B 3NBNA 4PJXA 5E2WL 3MRQB 3TVMB 1DBKL 3TO2A 1VDGA 3WFZA 4JN2A 4QRTA 15C8H 4XVJH 4PJ5E 1S7UA 2EH8L 3MRPA 3CH1A 5FYLE 4M7ZB 2AXGA 1NANH 1QLEL 3T08A 3F7VA 1E6OH 5DZLA 1IAIH 1J0IA 5C0IB 5MENE 3KPNB 1YYML 1D5IH 4OD3H 3ZT6A 3CNKA 1P69B 1MWAH 4CMMA 3VGAB 1ODAA 5C08A 5GZNC 1E6JH 2V5RA 2W9LA 3MV9B 3SBWA 2XWJB 2O5ZH 1K4CB 3T0BA 3SOBH 4Z7OF 3PJSA 3DV4A 3EFFB 3OJDB 4IIQB 3MRKB 5JPNA 3T1FB 1ZTXH 3GJFK 4NCDA 1J18A 2WUBL 4KFZC 1EO5A 4LSPL 4FXLA 1MJ7L 3NCCB 1FFOA 5DUMH 1RUML 5CZVL 4UBDC 3U30B 2A6JB 3O45B 1ZHBB 4LOUD 3B9DA 3QCUH 5LXGH 3RVXD 5ANME 2DWEA 1EAJA 3GFUA 2QLVB 4PJDB 4LSDA 4QGTA 3HRZA 1YMMA 4WTZG 3JWOC 5GGTL 3WFEH 3QA3A 4J3SA 4D3CL 2AI0H 1OOAA 4Z7VB 3FTGB 2GAZA 1FFNB 4N5UA 4NM4H 1JZ4A 1K8DA 4P46A 2A83A 2CXKA 3K0WA 5CWSB 2R23B 3SE9L 1WICA 4XB7A 5D4QA 4LCUA 1QBLH 3ILQC 1S7XA 3ET9F 2ORBL 2C26A 2ZZUT 3HNVH 4C4KO 2DQGH 2OJEB 2YWYA 5FGBC 3SGDH 1A0QL 2ARJQ 2CUIA 2IPKA 3NACH 3O3UN 2HRPH 2ZCLH 4XPTH 1YEIL 1YN7A 4JRXB 4F15B 1E0OB 3BQUA 1XF5A 1FLRL 2PYEB 4ISVB 3GKZA 3QO0B 3OR7A 1LO3H 3GIZH 1WEJL 3HR5A 5TFSH 3NH7L 1LP9A 4YEFA 1CDUA 3RA7L 1LO4L 3QEGH 2SEBA 3AFLA 3LRSB 5FO8B 3MOAL 1ZK9A 2E3VA 3RBGA 4PV9B 3IXTB 5IEHB 1ND0A 3WS3A 1I9RH 1X5ZA 3OSKA 4NQDB 3FO0L 5FHBL 5E08L 4R4FH 4K94L 1MCRA 2LAGB 2CLVA 4LEXH 4FXKB 3VG0H 5FM5M 5IBUG 1EO8H 5EIQA 3S36L 4YC2B 3V6ZB 2IQ9L 2LFGA 3H9YA 1CIDA 4XP1L 2CLRB 1T2JA 1P2CB 1AP2A 4PJEA 2X4UB 3VFSA 2VERN 2B1HL 3GSUB 2J3SA 3UC0L 3C6LA 2VH5H 4JM2C 3WFHA 4H20H 5BMFH 3T0XA 3KPOA 2VL4A 5GRJL 4U6XA 4XPBH 1L7TL 1JNHA 3CFDA 5TE7L 1KPUB 5HHOB 1N6VA 4HJGA 5DRZA 5HYJE 5IEKA 2B1AL 4PGBA 4WW2F 3WNNA 2DB8A 1ZANH 4LLYA 1CQYA 4WHYG 4WUKH 3N1PC 3WEXA 1N7ML 4NZTH 5D7JC 4P2OC 2QHLA 2XZAL 3IFPB 4LLVB 4LRNH 2M2DA 1EBAA 3MNWA 1FFQA 4X4ME 2ZG2A 1QR1B 3U0TB 3S37H 1ZHKA 3HZKB 5DLML 4GRWE 1JZ5A 2DL9A 2XRAH 2IAMB 2E9BA 1OCWL 3FB6A 5IJKA 4XMPH 1QQDB 1LNUA 5FGSA 1B2WL 4JFDA 3ZKQD 5KSUB 1U3JA 5KSBE 1BECA 2WIIA 5JW3H 3C5ZC 2B2XH 1KJ2L 4KVNL 3VXUD 1GC1L 5F3HB 2FSEB 3RIFF 4MDJB 4LASH 1A6ZA 4C83B 1Z0NA 1FBIL 4LLAA 4RMSA 2IALA 4KRNA 1ITCA 3AMKA 4HJJL 2JCCE 4P0DA 4BELD 4P9HC 1XR8A 2VN4A 1WLHA 4JFEA 1OAUH 3RUGF 5KN5B 5CZXC 5DEGA 2B0SH 4XCNA 5EPMB 4L8DB 3UCRA 4Z7NF 3IU4L 4YHNB 3SBWC 1QKZH 1FPTL 3VXRA 1KJ2B 5HHPB 5KVFL 1I7TB 1A6UL 2YBRA 5KW9H 5FA3B 3DRQA 1S7VB 3BH9A 2R1XA 2MWCA 4ZSOB 3CLEL 2RR3A 3T09A 4NCC2 4R2GC 3TH3T 2V2TB 3OKEA 2RFXA 3CDGA 4N0FB 5MI0C 3VG9B 5A3IC 4KI5C 2VLJA 1DBBL 1T1WB 4UT6H 4RWHA 4X8JA 2RCSH 5LKNA 2VLRA 2VITA 1IAKB 3G04B 3OJ2C 3DGGA 2D31B 4S1RL 4P46C 2FBJL 4KWUA 5F9JA 2XQBH 1BBDH 4AYFA 4XCCH 1YNTA 1G9MC 1LD9B 2D2OA 3SDDA 1FJ1B 3QUYA 4D0CA 5F93C 3ARYA 2HG5B 4G6JH 3VH8B 1CGWA 4QLRA 1S9WB 2EDLA 3VXOB 4N8CH 2VDRH 3BQUC 4WW1B 4A6YL 4KJYA 4HWEL 4XAWH 1NC4D 3FB8A 1IGMH 4BUGA 1C5CL 4FQXA 2ZOLA 4F7EA 4WY7L 3V4UL 1RUQH 3MV9E 4XBEH 1UWEH 3MCLH 1AKJB 2BCKA 3QDJB 4CUCA 5IVZB 1YECL 1MCPL 5D7IA 4Y5VB 3FFDA 5HPMB 1M7IB 3PGFL 4QCIB 4ZFGH 3UO1H 4HS6B 1RZKH 1IC7L 3OZ9H 3TBTB 3VWJD 3RI5F 1EPFA 2R39A 4X98A 2N4IA 1WF5A 3P2TA 1G7MB 4M93B 1HNFA 5BQ7B 2APVA 3D87B 2BOBA 5ADPL 2PCPB 5T1MA 5HBBA 4OFIA 3F6LA 4XP5H 1OAQL 4IM8A 2EO9A 3RPIA 4F7PB 5T5FH 3LKPB 1F3DH 1XT5A 3QFDA 3C60D 2K7QA 4B50A 1H5BA 2IQAA 5FO7B 1CXIA 2KL6A 3VXTA 3G6DH 1GGBH 4Z7VE 2X4SA 5IM7B 3DVNB 3IVKA 3NA9H 1ZE3C 1UJTA 2IBZY 2NTFB 2EH7L 3GRWA 4FMFA 2EDTA 3O6FC 3OBAA 3MLPA 1E4WH 2WLZA 2BC4B 4U1LB 4Q9RL 3VW3L 1QBAA 3AS0A 5DI8B 5SWQB 4JRXE 3PWJA 1F90H 3FQRB 1HSBB 2PYEE 4I48B 2FIKA 1VA9A 5DR5L 1DFBL 1OB1A 2VXSL 4JKKA 5GZOC 1AXSA 1XF2A 1JI1A 2ZSWA 1UC6A 3LKSB 1KULA 5A2KH 5LGJA 1IC4H 1CGXA 2W07A 1J05B 5DJ2A 3GMNB 4JFFB 4S1DD 5F9WC 1WC7B 1S78D 5IJKC 4HEME 1QD0A 1YJDH 4MS8C 4NQDE 1BQHB 4N0YH 3UTZB 5CZKA 1DLFH 5ACLA 1RUPL 2QQNL 4XAKE 1U8MA 1AO7D 4L3EB 2VQUA 4HS3B 4F37F 2X7LB 2BOCB 4GW1A 3TN0A 3PABB 3ZHKA 4ZPVA 1BAFL 1Q9LA 1EMTL 3QIUA 3HZYA 2YC1A 1CGSL 2XWTB 1KUMA 3D6GA 4X9BA 4NN5B 4CMHB 5GZND 4X4XA 3ZYIA 1EA9C 1KIQB 2YMXL 3SDXA 3P0VL 4XNYH 4NRXA 2Y5TB 3VFMA 5KS9A 1JF1A 3ILPB 4JREB 3UTTB 5GJSH 3IDUA 3KPRE 4R90L 5IR1B 3I3DA 2CR6A 5HHOE 3W11C 3PIQB 4S1QH 3MRGB 4B7LA 3RVTC 4XVUD 3W82A 3LKOB 1KCUH 4UBDD 3DO7B 4HLZG 1DQJA 3QIWA 4QRPA 5D93B 5B8CB 1F6LL 3BGAA 4BQ8A 3BIKA 3GSQA 2A77H 3ZDYE 1EAPA 1D5XA 2Z0BA 4PBXA 4Z0BH 4B0MM 1V3LA 3FQWB 3LZFL 1SYSB 4M7LH 5ID0A 3ZE1E 2DRUA 2HFGL 1MVFA 5K9JH 4Y4HB 3A0OA 4D0BB 4JJ5A 1LO2H 4MJ5B 2HN7A 3ILQD 3MROA 4PJIA 2QADC 1U0QA 1FNFA 2D03H 2QEJA 1T6WA 3O4OB 4O9HH 4NQEB 1Y0LB 4YXLH 1U8QA 1YEEL 4WDIA 4CW1A 5F7LB 5ICXB 3MV7B 4TTDC 3SDDC 3OR6B 3P4MB 5T3ZH 3QUYC 3W39B 4ELMF 1NGYA 3S5LG 1LILA 3OAYH 1JZ2A 4LDEB 5AZ2L 1FIGL 1UB6B 1AQDA 5E6YA 2NTSP 2AEQH 3BPOB 4Q0XH 1FV1B 3UTQB 3ARXA 3P0GB 3O9WD 4FQXC 2A73B 3PHQA 2UWEA 2DLFH 1FP5A 1WCQA 1E28B 4L9LA 1F8TL 5ERWB 3OJVC 3TA3A 1NCCL 3EOTL 1QFPA 3TIEB 2O5XH 4OGXL 4GG8A 35C8H 4G8GA 4NKOA 4PJ8A 4QHUB 2VZUA 1A1OB 4WHCA 4X7TB 3V5KA 1KFAL 3ARSA 2CK2A 2DDQL 3SKJL 4XMLL 4N0UA 4M5YL 1QEWA 3PWLA 3MRMB 1QRNB 4JM2D 5HYSB 2VZ1A 3H3PL 4EZMA 3HMXL 1RZ7L 3ECBB 1VKXB 2RAMA 2P7TA 3SJVE 3U4AA 5DHVH 2OTPA 2NY5C 5ALCL 3UBXA 1KC5H 1H5BC 4XP4H 4U3XA 4NDMA 5HHVL 1FO0H 4OCYL 4YGVA 3OGCB 5JORB 2QSCL 4PJCF 1JGVH 4PRDB 4ETQB 2RB8A 1YDPB 5ITFB 3K2UH 4OFPA 3BRDA 3OKLB 1OGTA 5D1ZB 1RIHH 3GNMH 4PGCB 4AENA 1AI1H 2Q86A 2MHAA 3AMLA 4P2OD 4HZLA 5MERA 4HEPG 3IRPX 5CLTA 2VNCA 5J7CC 4R0LA 4YBLB 1B0WA 5JR1L 1KCVL 4PY8I 2CJUL 1MEXL 3KWWA 4M43H 3T3PF 4M6MH 5KAQF 2E9JA 3NCJH 3ROOB 3QQ3A 5CINH 4PTUB 4PGEA 5ISZA 4WVRA 1UYWH 5EO9B 1BX2A 5HDLA 4AMKH 4ZAKB 3C2SA 2Z92B 3ARDA 3WUWB 3FQTA 3DETC 2IFFL 4X5WB 4PUBL 5GQBA 4ZQKB 3C5ZD 2C4FT 1LEGA 3T2OA 1EZVY 5GSRB 3EYUH 3I6LE 3ZE0F 4B53A 2XZCH 5JDJA 2EC9U 3OTTA 3LN5A 2EE6A 1BJ1H 1T3FB 1KCSL 3TN0C 3RWGB 5DJ6A 4OM0H 5C8JA 1I1AA 5I1GH 5H37G 3QIUC 2A6IB 4NZRL 1L0YA 5EBWB 3BWAA 5C08D 5CZXD 1FCGA 1MCSA 3O41A 1BVZA 3WHE0 4LSVH 1U91A 4QRRA 1AIFA 2AJSH 4XCYB 4YDLB 4NO2A 3VFUA 4W6YB 3WHXA 4HD9A 2X9XA 3PWPB 4XVJL 4NO0A 5IMKA 4Y2DB 4JFQA 4PJ7E 5J12B 2XFXA 2NXZB 1IAIL 1KIPA 2XXCB 4OUOA 1Q1JL 3LN9A 4R2GD 4H1LB 1N6QH 1D5IL 4OD3L 5B38B 4YZFF 4ZMAT 5I75B 3QIWC 2ADFH 3GJFA 4MNHA 1T04B 1E6JL 3LHPL 3TLRA 1FYTB 3OAUH 3VXSB 5B3JF 5A3ID 2O5ZL 1Z9SA 4ODSL 1N6UA 3LSOA 4CU6A 4KI5D 1DBJL 3SOBL 1NGWA 5EFIB 5CEZD 3ALWA 3MBEA 4RFOH 1QFWM 1KJMB 4OZHE 4WW2B 3TCXA 4AIOA 1ZTXL 4TUJB 4JFFE 1EXUB 4P46D 4H88H 3MX0A 5FA4A 5DD1L 5HHQA 3MRRB 5DUML 4DZBB 5C0JB 1CDIA 4PRHB 2GCYB 3QWRA 3QCUL 4KC3B 4XHJC 2ERJC 1ZLWK 3ZKNC 2HTKC 4MGXA 3VD4A 3A6CH 2BXZA 2AI0L 1UKTA 2FWOB 3FZUC 4NM4L 4HBQA 5ICYA 4AQ1B 5DZOA 3V6FA 5ENWA 1J1XL 1ZSDA 3VRJA 3VFWB 1TVDA 1QBLL 5B4MC 5TDNB 5K9KB 4NFCA 1MCQA 4KKBC 2DQGL 3QHFH 3UTTE 1J1PH 3NACL 1HWGB 5KJRH 2HRPL 2ZCLL 4XPTL 5DD6A 4QXTB 4CADB 4L9LC 1WK0A 2DLHA 4JANA 1CFTB 3TA3C 1K8IB 3MV8E 4GKNB 4L8SA 2YA0A 1CR9H 2HJKB 1Z5LB 1LO3L 3GIZL 4JY5L 4X6EA 1T5XB 4PJ8C 4HDIB 5CBAB 1QLRA 5TFSL 3RUGB 4DFIA 5L8KB 2R0KL 3N85H 3F5WB 4ZFFB 1C16A 4HS8L 4W4OA 1TPXB 4AEHH 1INDH 4C56A 3IETA 3E6HA 3O6MH 3SY0A 4FQPA 4QXGH 3QUXB 4OZGA 2BY3A 1I9RL 1BEYH 3ES6A 4ODWA 2C3GA 1J10A 1P84K 1S3KL 5BVJB 1OT1A 4JEGB 3VXMD 4CN4A 3O6FD 4R4FL 3JWOH 5F7UA 4LEXL 2WINB 5JNYB 2VABA 3VG0L 5TJWK 4LPWA 1EO8L 5J9PA 1MVUB 2AXFA 4CL7A 3JSSA 3U83A 2D4FA 4HPYH 2W0PA 1J0JA 3PNWB 3KYOB 2BNQA 2XI9A 3MV7E 3O2VH 4GG6A 2Z31C 3HI6L 4CBPA 3EOAA 2A2QT 2VH5L 4QOKB 2W59A 4H20L 4I8DA 4ELKB 5BMFL 5T33H 4GXUN 5M95B 1ERNA 4R0LC 5GZOD 4XPBL 3IDYB 5HVHB 4KTDH 3FO2A 1MCWM 1WAAE 4PJBB 1WIUA 3HR6A 1WBXB 1EK3A 3ZSTA 4OF3A 1CIUA 3QPQC 4MS8D 1CGYA 1QSFB 4HCRA 5J0BA 1OSPH 1ZANL 1HHKB 2H32H 1N8ZA 4JFDD 5EBMA 4WUKL 1A4KA 3ARDC 3P4LA 4NZTL 4QRSA 1QFHA 4XGZA 1XIWA 5DK2A 4G8FB 3TESA 2BHYA 4NRYB 2K1MA 4JPIB 2R0WH 1AXTH 1CFNA 2A74B 4JDTH 4OCSH 2KDGA 3MGTA 2DIJA 3S37L 4J3TA 3L3JA 3CUPA 2XRAL 1QRNE 2Y36H 5EC2B 4Z7OE 1TQCC 1BZQK 43C9A 3NIDF 5MEQB 1AFVH 1I1AC 4XMPL 3NCBB 4GAJH 2XY1A 1I8KA 1CF8H 3BI9X 3LV3A 1CU4H 5CEYB 1FN4A 3W11D 5JW3L 3Q5TA 4P23D 1IGTA 3VXRD 2B2XL 2MMXA 5KZCB 3QDMA 3ARQA 4PPTA 4DN3H 1KBGH 4EOWH 1RZFH 1RZGB 1R24B 4J2XA 4P49A 5KTEH 1FL6A 1I7UA 2YK1H 1CE6A 4LRIC 2V9QA 4WO4D 4IHOA 4X6DA 1NDGA 3AROA 3IJHB 1IGIH 1VADA 3HC0B 3P4NA 5TE4H 3BX7C 1TZIA 1KCRL 1OAUL 3DVGA 4NKMA 3BXNA 1U95B 1I3GH 1P1ZB 2BERA 4M1DH 1MCLA 4OZIB 1QKZL 5BV7C 3QSKB 1XAUA 5F88A 4I9WE 3MRDB 2VLJD 3MBEC 5KW9L 1R3JB 3QNXB 1P7QA 3G5VB 5CJXA 5IMLB 1BOGA 3MLSH 4RZCB 2OX5A 1EERB 3OKKA 3KPLA 2DBJA 3ZLQC 3MZGB 1CK0H 1T2XA 4TTDD 1R3LA 4LVOC 3QUYD 3KYMB 5BCAA 3TNMA 3QO1A 1H3GA 4E41A 3UJIH 5IB1A 4L3AA 5FB8A 3EYQC 2ADJA 1O7SA 5C2UB 3HI5L 1IGYA 2WANA 5F7HA 5GS0L 3AU1B 1UZ6F 4C4KT 3BUTA 1PBYA 4LFHG 2RCSL 1B6DA 2P46B 4Y5XB 3DHMA 1OGAB 2D7MA 1U2HA 1OP5H 1R5WA 3LOWA 5FF6A 3C6SA 2AV7B 4MD4B 4XCCL 1KPRA 4P9HH 1IARB 4QHNA 5GGRY 4LQFH 1ETZB 2PO6B 4NUJA 3CGTA 4G6JL 1JI2A 2EE3A 4X99A 4D9LH 1J5OH 2NLJB 4WI5A 2EKSA 1LWRA 2VDRL 2AV1A 3BMVA 2VL5A 4L8SC 3SGEI 4XAWL 4MQ7B 1M7DA 1RJLB 1IGML 1G0XA 4XNXH 1FYTE 2APWA 1OAXH 5I1LB 1RUQL 4BZ2H 1UWEL 3MCLL 1G9EA 4WTXA 4ODHH 4W4OC 3MJ9A 2VAJA 4PLKC 4HUVA 4MX7B 2QSQA 2WBKA 3IYLW 1P7KA 5F3BB 5D7LD 3CU7A 2AEWA 3KS0J 4ZFGL 4WI3A 3UO1L 1RZKL 3OZ9L 5JXED 4O2EB 1GYAA 1I85C 3K74B 1JNNH 4HKXA 3EO0B 4MNGE 4U3CA 2IEPA 4M7KH 1XF4A 3QNYB 5C0RH 4PRHE 1S7WB 3AREA 1G9NC 1ZXQA 3BGFC 4XP5L 1I7RB 4TVSa 2K9UA 5T5FL 3HG1B 5K9QG 3VE0A 4YHIA 2OR8A 1G9MH 4D2NA 3PF2A 4FTVA 4APQA 2IAND 4DK6A 4MJIA 4PY7A 4PB0L 4NQCD 3C9NA 4QXUH 4YDJA 4JM2F 1ZVSB 1E4WL 4S2SA 3H42H 3DETD 1T66C 3ULVH 4MAUH 5IIEB 1J86A 4E5XB 5ETUA 3TC9A 4ELMB 4JM4H 3GHBL 3VFRB 5F1NA 4KH2A 1C7SA 5AYUH 1Q94A 1F90L 1Z2KA 3TBWB 3QH3B 4WGWB 3K1DA 1A9EB 3L5HA 3ARRA 1MHEA 3L3DA 1HXMA 1XIWC 4RISH 5CHNB 5K59F 1JWMB 3TN0D 4X5XA 1CG9A 2DQUH 5HYIA 3TCLA 3LVEA 3RUGE 5EOQH 1MFNA 4EI5D 5EZJB 3QIUD 4Z76B 4XH2A 3DMMD 3KG5A 3MLUH 4Z7NE 2C3VA 1ES0B 2L0DA 4YHPA 1H9VA 5BOZG 2J8UB 5IBTL 5I6XB 1OP3K 1YJDL 4OZFB 4N0YL 4X9HA 5HGHA 3H7BA 3BEWB 4U6VH 1DLFL 3DX7A 4YPGA 3DURB 3LAFA 1XMWA 2LTQB 4OGYH 3TT1H 4RQQB 4GW4B 4PRNA 4OLVH 4U1SB 5KG9B 5DRXB 5M94B 4F2MA 2HFTA 2A6DB 1H15A 1MQ8A 4QRPD 1M71A 4H25B 3REVB 2FO4A 1DN0B 3RNKA 4HWZA 4PJXF 5IFJB 2ICEB 4XNYL 1T1YA 2P43B 3QT2A 4NFDA 4OFVA 5ABDE 3WNOA 2I24N 4PJCB 3EO1B 1AGEB 1QRKA 1WV7T 5CAYB 2R2HB 4ZUVB 5GJSL 4CU7A 3KYKH 3J8F7 3M8OH 3NGBB 2ATKA 4S1QL 1H3WM 3UTPD 1B0RA 3VJ6A 4LDLB 5GISH 2BVEA 1KCUL 4OF7A 3I9GL 5HGDA 3QFJA 4MQTB 5CJXC 5EO1B 3L7FA 1VGKA 3T2NH 2A77L 4DZ8B 2WP3O 4XHJD 1I1FA 3S9DB 3ZKND 2HTKD 4Z0BL 5AWNH 5LJYH 4OD2A 1S9YA 1JGUL 3GSWA 4LCCA 3QEUA 5TF1H 1KN4L 2Q7YB 4LBEB 1JUFB 3IXAB 5K9JL 3FZUD 4NGHH 1S7RB 1LO2L 2D7PA 1M6OA 1NGXA 2NXYC 5B4MD 4Q97A 4KKBD 5IW1A 1L6XA 1H8NA 2D03L 4KI5F 4O9HL 4WEBH 2ZSVA 4ZUSB 3U0WL 2XYCA 3FQUB 3I02A 4DWHA 1G7HB 1XR9A 3TA3D 5DHYB 4MB4A 3L3KA 1JNLH 1UEMA 1HDMB 2UZIH 1VSCA 1JWUB 3HS0B 4G8GD 4PJ8D 4RIRA 1NMAL 1JZ7A 4M3JA 4QY8B 2VDPH 2DIBA 2G75A 3PV7A 1AE6H 2WBWB 4KGJA 1FFPA 4JG0H 4LLMA 4Q0XL 3V5HB 1JK8B 3VXNB 2R1YA 1PYWA 1F13A 1QSED 2IMMA 3TFKD 4M61B 2DLFL 3MO1A 3RL2A 2PW2B 3B3IB 4UQ3B 2FL5B 5INDB 3PDOB 4FQJH 5GGSB 3CFBA 3GSXA 5F1OB 1MI5D 1LP9F 2O5XL 4XVTH 35C8L 4X7DC 4HV8A 3BSZH 3L5XL 4RAUB 3EYSH 5FUZH 3RIAF 2Y9RT 4HKBB 3VXUB 3SE3A 3OJMB 2Z31D 1KB5A 2YRLA 3HA0A 3AREC 2DD8H 2YN5A 1NJ9B 2ILLA 3BP7B 5D1QD 4JQVA 1X6NA 5INCB 3IS1X 4PFEA 4R96B 1GZQB 4Z95H 1LDSA 4XP4L 3PWVA 4DGVH 3BDYL 4APQC 3VFOA 1X5FA 4B41A 1FO0L 1IAMA 1OGAE 2NY0C 2HRLA 4PJEF 4ALAH 3QPQD 4NQXB 3K2UL 3MNZB 4GRMB 4ODVL 3GMOB 2QHRH 3EW3B 4I5BB 3ARDD 1PKOA 4OI9A 1RIHL 3GNML 5BZDA 1RZIA 2X1QA 1AI1L 4NO5A 2BDNL 3FT3B 4KDWA 2VLMD 4QT5B 5EU7E 4BFIB 2C5DC 3M17A 4FQIL 4HUXB 1MFDH 1PG7X 5EC1A 2HLAB 3WXVH 4H0HB 5JLZB 1NUDA 5DHVB 3MCG1 2YD7A 2FHCA 3KYAA 4M43L 2H2PC 1A6TA 5ESVA 4X6BB 2EICA 2CDGA 5I1KL 1FO0B 3BKCH 1MREH 2K3TA 5CINL 3WMSA 3EDEA 4N0RA 1CL7I 2GI7A 4OBSA 4PJAA 4PRID 5FV1L 1UYWL 1WTGT 4AMKL 1R3KA 1NMBH 1NCDH 3BYTA 4HGMA 5E8NB 4EKXA 4I18C 5DUBB 2ZCKL 4I2XB 3O3AB 1I8MB 3DRTB 3KNBA 1BJ8A 3DUSB 2JK5A 3EYUL 3F7RA 3BD4A 3CVIL 4MAYA 2XZCL 1BLNB 4L4JA 3TM6A 5JA8B 2E6QA 3BHBA 3MRCB 5IHUH 3RNQA 1NSNH 1U8NA 3EGSA 3FOMB 5C92A 1MFBL 5I1GL 3WS6A 1CTNA 3GRWH 4L8BB 2C1OA 1GGIL 1NAMA 1NC4B 1ZHNB 3U4BL 5IMMA 3H9ZA 4LSVL 4KV5F 3KLHC 1G6RL 5DRWB 2AJSL 4D0DA 4JZJB 3NOIA 3PWUA 5EU6A 3MBED 4BFEA 2GJ6B 2F54A 1QG3A 1X4XA 5F7FA 5EU5B 2ENYA 4UNTA 5FYJU 2CK0L 2X4RA 2AJYH 4JN1H 2BSTB 4KK6C 2VLLA 3VWJB 4ELME 1JGEB 4WWKD 2YSSB 1GL4B 5C0FA 3MUHL 4ZUUA 4DW2H 1RAMA 5EOCH 2FJHB 2BSSA 4JRYA 1P4IL 4ZFZB 4RBPH 5IF0B 2YUVA 1Q0YH 3EYQD 3CFJA 1G6RB 1ZT4A 3MV11 2NW2B 3ROLA 5LQBH 3C60B 4RFOL 4LCCC 3CJJA 5JQHC 2X70B 3IDMA 4ZUTA 1Q9WB 3QUZA 5HVWA 4H88L 3DLQR 3OKMA 5HHNA 3EO9H 5HDQH 4JKPH 4K3EH 2P8MA 5FK9A 5F9DC 4J8RA 4HHAB 3VGGA 5F9OH 4WENB 4FQHA 1XGRB 32C2B 5KBNC 1CLCA 1ORQB 2ZUWA 4IRSA 3MFFB 4M48H 4Q6IB 4YE4H 3A6CL 2DWDB 2RJMA 1UKSA 2IBBA 3CSPA 1PG7W 1AQKH 5GGQH 1HYSC 3H9HA 4U3HA 4PLKD 3DV6A 3ZKXC 3LN4A 1C08B 3BPNC 5DVMA 4C56D 3GMLA 1K5NA 4PJCE 2YUZA 3QHFL 4K7FA 5DRNA 1J1PL 3KPSA 3RWJB 5KJRL 3VXPB 4U6HB 2CXGA 5BXFB 1TCRB 4JZNB 2ID5A 1CR9L 2HKHH 3SE4A 1A1NB 1AO7B 3VMNA 2ATPA 3G5XA 3CU1A 4JPVH 1WCBA 4OCNC 5D7IF 3MLRH 3T3PE 3N85L 2CUMA 4F33B 3SE3C 2BNQD 1U3HA 2CMRH 2VUOA 1CXEA 4AEHL 1VFOA 2ADGA 3O6ML 2VISA 1GOGA 4QXGL 1IM9A 3IU3A 4DQOH 4JQVC 5CIPA 2P5WA 1A2YA 4JHAH 4NSKA 3U9UA 3ME0A 3JWOL 3MMEA 3MREB 4Y19A 2J8OA 1OAKH 2EYTB 1T66D 2VQ1A 2P8LB 5CMAB 3SGEH 4DAGH 2PN5A 3C5SB 3RHWK 5I8CB 2A1WH 3BP4B 3H9SA 3MRJB 5DJCB 3W9EB 1V3JA 3LB6C 7FABH 4I4WB 3ZE0E 5EOTB 4FQQB 4XPHH 1J8HA 4KK8C 3IF1A 3B8SA 2CDFA 3O2VL 1A02N 1HHGB 2IPUK 1NUNB 4YR6B 1MRFH 1DZBA 4TSCH 2MNUA 1HHIA 1S7QA 2BSRB 3BEVA 4P5TB 4KTDL 2ADIA 4XCEA 4JAMB 2P5EA 4ORGB 4I1NB 5E70A 4ODBD 4P5MA 1RHFA 1OSPL 5JA9A 4BKLA 2VDLH 4UQ2B 2AK1H 4HGWA 3I3BA 5LWYH 2R2CA 1JGDB 5J6GB 2VZVA 2HT2C 3ARBA 5TDPB 3CXHK 4YZFE 1CGUA 2R0WL 1AXTL 3QDMD 2AKRA 4OCSL 1JTOA 3VXUE 2EEAA 4YHOH 4ZOCA 5B3JE 5TQ0L 2X09A 2EDDA 2JJTA 3GIVB 3RY4A 1AFVL 3S3PA 3WS6C 1OTTC 2XXMB 4GAJL 1CF8L 3DTXA 4HZAA 1AGCA 1CU4L 4AY0A 3O9WB 2X42A 3C08H 3GMQA 1WJ3A 3GSOB 1OP9A 4PTTB 1KPVA 4L8CA 2Z4QB 5HY9A 3SEPA 5C0CE 4DN3L 3SDXF 1KBGL 4EOWL 3MRHA 1DEEA 1RZFL 1XGQA 2GFBB 3PDGA 5KTEL 2YK1L 2MQ0A 1U93B 2C7UB 4RA3A 3V0VB 5KS9F 1N3NA 1IGIL 2AABH 3MJ7A 4M62H 5TE4L 2VO5A 1RJYB 3BPCA 4V1DA 1KEMH 3VA2C 5LBSL 1GGUA 4M1DL 4BSWB 4JM2B 4M1GH 4OF8A 1Q0XH 3QZWA 1T1XB 2OMBA 5K33A 3UMTA 3OKOB 2DQFB 5T1LA 3GSRB 1QFUH 3O3BA 4ZO6A 3MLSL 3QQ9C 4I2XE 3QUZC 1Q9KB 4M4RA 4X5LA 4MZ2A 3I75B 2P42B 5GRXG 1CK0L 1W2KT 1SMOA 3QEHA 3IJYB 4P2QE 4PBWD 3X17A 2CIIA 4P2OB 3UJIL 4PJIF 4LMQE 4R3SA 1VEMA 3QR2A 4Z5RB 3KYNB 1IZJA 4IRSC 1CFVH 5IVXA 2PXYB 1PSKH 5A43C 4JFOB 1AR1C 1XGTA 2R0ZH 2V2WB 1BZ7A 5J1AB 1ACZA 5DA0B 4RDQG 2GUOA 1MHPL 4P9HL 4KKCC