5KSAA

Bel602-dq8.5-glia-gamma1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWSLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksaA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksaA01
3MNZA 4OZHE 5FYJD 1JWSB 4KI1A 3E1F1 4PJGF 4PRPD 3QRGH 4LEOA 4MA1C 5ESAB 4LFHD 1TPXB 3C6LA 3B3IA 2ZG2A 2IBBA 4ZPTB 3WFEL 4O58L 1KCVL 2CDGA 1A7NH 2WWMC 3D0LA 2JF1A 3EDJA 5TGBA 2WNGA 3MJ8A 2DQCH 4QHNB 4PGBB 2APTA 4V1DB 3PQYA 1J1XH 1Q9OB 4UIKH 2HKFH 3CLEL 3MMEB 4LOUC 4KHTH 1ZT4A 2H32A 1BPVA 2WUBL 1E6JL 4OF6A 3V5HA 1OCWL 3N1GC 4AH2B 3G5VA 5DD0L 2KDGA 3KLAB 3Q3GA 1KIPA 2VITA 2DWDA 4R0LC 5IFAL 1CXLA 4NOBA 5FYLH 2DQFB 5E00B 5L7XL 3MJGX 1A6TB 1QLFB 2W91A 3MRIA 5DS8A 3QCTH 5FO7A 4GRMA 3A6CH 4HXAH 1IM3A 3P40A 5GRVK 3AXLB 3TFKC 3WLBB 1ZMYA 4HFUL 2MCPH 3MFFA 2IADB 4KVNH 4PJEB 4LARH 3QXVA 3QHZL 3UTZB 5DK2A 1T5XB 4M7JH 4UT6H 4J6RH 3MUZ1 3V5KA 5IUSA 1WBZB 2NNAB 1TZGH 4L3EB 1IEHA 3REWA 5K9KA 2Q87A 3KAAA 1WSST 2GKIA 3HE7A 2ID5A 3DROA 1OTSC 2UWEA 3HHRB 5EU3B 3HRPA 4HBCL 3EYFB 1GZPA 3GBMH 3SGEH 1SY6L 2WSKA 2ZUQB 5JW3H 2F15A 1FL5B 3I3EA 4N1EA 3T77B 1RZFH 1C5DB 4QRUB 3DX9A 3QIBD 3MGOB 4X6DB 1FNSH 4YDJB 5T33H 2J8UE 2GJZB 3IJHA 2XKNA 5HGHA 3P0YL 3TGXA 4HS6A 1FJ1A 4ZO8A 2LTQB 1FVDB 4GS7C 4R90H 3FOLA 1A4KB 4EDXB 4EOWL 2XRAL 1G6RA 1HQRB 3HN3A 1EEZA 1AFVH 1DUZB 2Y36H 4NJ9H 2ZJSL 5DJ2A 3UJTL 3U30C 5DRNB 1T89A 4JFED 4OZHF 3IFOB 2YWYA 5E7BA 4NN5C 1UZ6E 4D9RD 1OP5K 2P45B 1QPPA 1ZEAL 3CDGA 3QDJA 5JHDB 1WTGT 4TULL 2A77H 1MWAH 5DJZA 5FYKL 3ZKXC 1JYVA 1MPAH 1YEHL 5KW9L 4NFDA 5HHQA 2FEDD 5IJVA 5J57B 4Y4FA 5KSBB 4WTZG 3KYMA 3LKNA 5IBUB 1AJ7H 2Y23A 3U7YH 1JHLL 4XWGL 2XPGA 4MNHA 5EBGA 2O26U 2YC1B 4LAQL 8FABA 3QQ9C 4ZPVA 5C0FA 5I74C 1Q9KB 3QQ3B 2N4IA 1IVLA 1I8KA 2BVOA 4WFFE 1ND0A 2AK4B 4GAJH 3MJ6A 4WFFD 2ARJQ 4PJ5A 2FH8A 1N5AB 2VXTL 2VQ1B 5C2BL 4K3JH 3IRPX 2XZZA 1CFQA 5DUPH 4A2MA 1FGVL 4GSDH 1Z6JT 4LQFL 3VG0H 3H3PL 3QPQD 5C92A 4LIQE 3C5ZA 1CCZA 4JM2F 4GQ9H 5D7SL 4AZ8A 1D6EA 1OPGH 5F1KC 1S7SB 5EH1A 2R2EB 2YPVL 4X7SL 5IT2L 4U1IA 2Z91A 3JBG7 1SMAA 2SEBA 5E94A 4E0RB 2GFBA 1D5XB 3ZE2E 1WIUA 4QHLA 1Q1JL 3EOBA 2MNUA 2ICWA 3OQ3B 4DW2L 4HG4K 2NXYB 2FECI 4EDWH 2DL9A 5ALCL 2P7TA 2BRRL 1NC2D 4RMVA 1YEFH 2MKWA 5EUKA 4P3CL 4PRAB 4WWID 1FZOA 1TPXC 4GW4A 1UENA 3MLRL 4OCSL 4YPJA 1TJIH 3UPAA 5CSZB 3MV9A 2BNQE 3OR6A 2EDWA 3NFNA 3ZE1E 1SEBB 4IJ3B 1T21B 1VFBA 3REVA 3V4VH 4XPBL 3ZMRA 4EUPB 3PWVA 3RL1B 1XGYH 4ACPA 1JF1A 2ATPB 1UZ6F 3ALXA 1QO3A 4G6AC 5D72L 4LKXB 1WFTA 3QO0B 5E9DA 4NC1C 3MJ7B 4EQ3A 3TJHD 4Z7VA 4JZOA 3TESA 5J13B 4O2EB 3DUUB 1MHEB 3TN0B 3QEGH 2ORBH 1QA9B 4S0SD 1I7UB 3EW3B 2MQCA 4OGXL 1E4XH 2YA0A 4C56A 2HT3C 1ADQL 5IG7B 1DBKH 1UKSA 3FONB 4PJCB 1MIMH 35C8H 3DWTA 3ISWA 2ESVA 3MOBL 3JZ7A 4RWHA 4CN1A 4J1UA 3PWNA 5B4MC 2NPLX 3NZ8A 1KGCE 3OF6D 5TQ2H 2C4FT 5HI4C 3V0VB 5DXWA 1KGCD 2C1PB 4Z95H 4AQ1B 3MV8B 4JRWA 5ITBH 1MHCB 5IHUH 4U1MB 3EOAA 4YBHA 5SWSB 1KYOJ 4U7KA 2UZIL 3LV3A 2DMKA 4R8WH 5T1KB 2V17L 5F1NA 3QUXA 1RHHA 4KJQD 1U3JA 4LCUB 4R6UA 3H3BC 3N50A 1KELH 2V7HB 5I1KH 4YE4L 1HIMH 4WNQA 4JRYB 4YDVA 4URTB 2ZUQC 2X10A 3F65A 8CGTA 2ZP0T 4TUOA 5HYFA 1I8MB 3N1MC 1RIHL 1U8HB 3SDXA 1BX2B 3OAZH 2G2RB 1GOHA 2LTQC 1Q0YH 3ZE2F 5IB2A 1AHWB 4LLQA 4PJ8D 4G7VH 2X89D 2ZCKH 4QRQB 1DN2A 3L5WB 1EERB 4QXGL 4OI7A 3P2TA 3MYJB 3PWLB 1KSRA 5DQJA 5A2FA 5ID1B 1MCFA 5MEOA 2VDRL 5AD0A 5EG6C 1JE6A 2X4TA 1Z9LA 1PKQA 5HHOB 5KZCD 4BYHA 4JDTH 1NANI 2BOBA 3QULB 5DMKA 3FHQA 4YAQA 5B38G 2Z8VC 4G7YL 4S1SH 5IKCB 3CVHB 1ZLSH 2MTPA 3OKOB 2DF3A 4LU5L 1I7RB 5CJ8A 4ZFGL 4UOW1 4WW1B 1TTFA 5DTFB 2F74B 4KJWC 4MA8L 1P4IL 3RHWF 4NNPL 4TYUA 3BGMB 2DKSA 3CZFB 3IJSA 4PJ9B 1Z5LB 1U8JA 2FX7L 4P2QB 4LLDB 2BSTA 2CUHA 2PR4H 4YIQA 3T1WA 5ISZB 4WV1C 4OLWL 5MENE 2GAZB 4XVUD 3IXTB 5I19H 1EHLL 3GMPA 4DKEL 3UTTA 3FOMB 1FSKB 5MEND 3CNKA 3TVMA 4IRSC 4I0PA 4LPVA 5I9QB 4FFZH 4WI8A 1I1YB 2I5YL 3K0WA 5GHWL 1U6AH 4DK3A 2UY6A 2GUOB 5EU4B 3SGKC 5KN5A 5DLMH 1XIWA 1FYTE 3GSNA 4UQ2B 3QUZA 1K8IA 2WBJC 4XCEA 4P2RE 2XN9A 1FYTD 1HH9B 3BKCL 5DHYA 1G7LB 1WWCA 5GS0D 2E7BA 2HYMA 4ZUUB 3QHFH 2V6HA 4P2RD 3KYKH 4HS8L 1IRAY 1CFTB 5C0CE 1U8OB 4JFOA 4HWZA 4UINH 1S3KH 4CJ0A 5C0CD 4X5XB 4UTBH 4WI9A 5ECJE 4C59B 2X4OA 3WO4B 4LMQE 3OAUL 3QDME 1EFXB 3LPWA 3HCVA 3KDMB 2VDOH 2K3TA 5GS2D 3QWQB 1FN4A 5ERWB 4CVZA 3QDMD 1MI5B 4OFKA 1U8KA 5T3XH 2NXYC 3ROOA 4YHML 5JORB 3MOAL 1N0LA 1YEJL 2VLLB 1T0MA 5A3ID 1W72H 5K59E 2Z9TA 1KJVA 4RA0C 3U1SH 1BQHB 1KPUB 2EE2A 4NZUH 5FV2A 5F9JA 4IOFC 1RHFA 1RUPL 4U2ZA 1YEEH 1GVIA 4IJ3C 3RNQA 3U48A 4QRRB 5FF6A 1ETZB 5HYSG 5J9PA 5DJ8A 4P57B 4UNVA 4ZFZA 4IOSD 2FATH 4PJXB 5J6GB 2XKUA 5FCUH 3NIGE 4XC1L 3DIFA 5J13C 3PP4H 2Y7QA 2AGJH 1CTNA 3LQMA 5AZEL 4NC1E 2B8OT 3QEUA 3I9GL 3EDDA 3RWJA 4GRLA 4K23H 1IEBA 1PLGH 3QXWA 4XBPA 1ZLVK 2NX5E 4LSRH 3M1BB 1YMME 4H25B 1SBBA 4MQTB 3OJMB 2HT3D 1UM6H 5JXEA 2IANB 2NX5D 3CSYB 2Y07L 1YMMD 1YNTB 2J6EA 4I3RL 5I2IB 3AS1A 5B4MD 1IGCL 4DCQB 5C0RL 4JFZH 4BQBA 5IB5B 3SKOA 5HI4D 4OT1H 3LPFA 4G6FD 5DEFA 1XH3B 2D2OA 1N7MH 3NA9H 1FIGH 1ZHKB 4N9GB 4NOFA 1C7TA 1NAKL 3LD8B 1MCEA 2FB4L 1NFIB 5E8EB 4E5XB 4PRBB 4XX1E 1INDL 4NKMB 5I1AB 4ELMA 1MFNA 1IGTB 2Q8AL 2ADIB 1RZGB 3FCTB 1GGCL 1AI1L 5EU5A 2EDHA 3HUJE 1DUYA 3DUSB 5D7JC 4NO5B 4LP5A 4NQVA 3UTSE 3EYVB 4M8QB 3ZKMC 1GC1L 4RNRA 2R0KL 1J8HA 3UTSD 3WUWG 4BUHA 5E8OA 4KDTA 1I8LA 5GRYA 1E28A 3BSZH 5IVXB 1OAUL 3RIFK 4ERSH 3LRHA 1II4E 2A6IB 1NFDE 3K8KA 3EDKA 2ENSA 1YN6B 3RBGA 3O11B 1AKJB 3ZL4H 3VFOB 4PBXA 1T7VA 1EEQA 1CDHA 5K59F 2CUIA 2XZQL 4GKOA 4K7FB 2FR4A 3IF1A 1DSFL 2FGWL 1MLBA 3GSOB 3U9UA 1BQSA 3QQNA 2R23A 1CGYA 4K7PY 3D2UA 3O3BA 4EI5A 3MRFA 1AP2A 1C1EH 3FMGH 1VA9A 5GGVL 4QEGA 1YA5A 1NGPL 3NIGF 4NQXA 4JO1L 4PLJD 5AG9A 1XGTB 4G6KH 4ENEC 3IFPA 4JG1H 1W8OA 3HE6A 1QHOA 2PTTB 2HMIC 1IJ9A 4MXQC 1QBLH 2DIJA 5IHLB 2W60A 4F8TA 2HFFA 1T5WB 1GXEA 4PR5A 5IJKC 4AIZA 1PGRB 4UV7L 1LP9A 1NGQL 3KPSE 1FSKC 5EO0A 2A0LC 4BUGA 3AM8A 1GZQB 1NPUA 3DXAA 2YPLB 4BH7B 4Y89A 4U6HA 3KPSD 1E27B 2HWZH 3L3DB 3RL2B 1CGTA 1FGNL 1UVQA 3RDTB 3CJJA 3B5GA 1UKTA 1FAIL 3GJEB 2VDPH 4IRSD 1CL7I 1KCLA 3QIWD 5FAAA 3UJJL 3WS3B 4RISH 2A2QT 3VXSE 3BH9B 4QF1B 2IPKB 3T3ME 1KJ2A 2C4FU 3VXSD 3FQXB 4KKBC 5C1MB 3ZLQC 2WBJD 1JFQH 3FAWA 2BHUA 1WK0A 4Y5VA 4Y16A 1XF5A 2JB5H 4FQXC 3T1FA 1QYGH 5DVNA 1U8NA 2BERA 4HS3A 3WO4C 1MVUB 1F00I 4NCDA 4LEXH 4EI6B 2NR6C 4CJ1A 2F53B 5H2BA 4NQCE 2NW3A 3CFCL 4NGHL 5EIVA 3HUJF 1FL6A 5FYKE 1P7KB 4NQCD 3OB8A 5CCKL 5LWYL 2IALA 3AB0B 1CE1L 12E8H 2DQGH 4O2FB 5DC0A 5FYKD 3GSQA 4NT6B 2W59A 3N06B 1UC6A 1WZKA 3WFHA 4KZDH 5ETUB 1NFDF 1ZSDA 4FQHB 3HG1A 2XIDA 2BSSA 5E2TH 1QFPA 1NBYB 4QYOA 4WUKH 5F8RC 5CD3B 2N56A 4YLQT 3VE0B 3MZGB 2WWKT 4XPHH 5K9OA 3DJ9A 5IHZA 3VRLE 4Y7MA 4XPTH 4UTAL 1KCUL 2DAVA 5B39G 1ODAA 5F7HA 1WBYB 4LIQH 3UZEA 3ARED 3SE8H 2QQLH 4G9DA 2NW2A 3S34L 1JV5A 2DKMA 1S7WA 3SDCC 5JMRA 5EOQL 1NCCL 4HFWB 2ADGB 5KSVA 1CXKA 4FMFA 5JUEH 4MCYB 5A2LH 3OKDB 4PFEA 4LHUG 2VLJE 3D39B 3LB6C 3O6KH 3SEPA 5HPMB 1OARL 3O3DB 4H5SB 4RIRB 3WIIH 3QO1B 2VLJD 3TZVB 1CE6A 3N1QC 2OTWA 1FZKA 4NQEB 4YBLB 1KCSH 3NGBB 2R9HC 1LEKB 4H1LA 2A38A 4M7LT 2EKSA 3NCYS 3BIAX 2Q7YA 2EYRB 4KJPD 3LD8C 7CGTA 2C1OA 4O51B 4IMKC 1KCRH 3GJFK 5FM5M 2XXCB 2A83A 5E7FA 4MJIA 3MRDB 4Q0XH 1XGRB 3CUPB 1IAII 1KLGA 3DX7A 4NYLA 3T3MF 1P7HL 3BT2L 1RZKL 5HSFA 1NLBL 3QG6B 1NCDH 4PRNA 5EIQA 3G5YB 1DBJH 2XWBA 1RK0A 1E4WH 1KN4L 5HHVL 3V52H 3RI5F 3FT4B 4ZS7L 5EO9B 2QQKH 5D7JD 2MJWA 4HF5H 4RBPK 4YBQC 1VEMA 2MQ3A 3G08B 4P0DA 3T2QA 5CZVH 2EIDA 4UT7L 1I75A 1NQBA 2ZSWA 3QPXH 3IGAA 1GAFL 4B5EA 4OLUH 4HUVB 3VD3A 4DGYH 1F4AA 3ILPB 1BBDL 2AJUH 2ZZUT 3THMH 3HNSH 3RIAF 1TZHB 4NQUA 1IZKA 5HHOE 4HKZA 2EDLA 1RAMA 2V2XB 4OAWB 4DN3L 2PXYC 3G6DL 2XFXA 4F9LA 2A1WH 4FFWC 5ENWB 4NKIL 2YEZA 1CGXA 4G80B 1V7NL 1S7UB 4U7MA 3SKMB 4LSDA 1C08A 4KUZL 3BP5B 3VRLF 3UBXA 5CEZL 1IMHC 3DO7B 6FABH 4PGJA 2CKBB 1T4KB 4P2QE 1KF9B 4JZNA 4OJFH 4ENED 1URLA 4WTXA 3QNZA 3LQAH 4OLYL 5EOCH 3KPMB 1FDLH 2OTPA 3TT3L 4ZOCA 1IQDB 1KIQB 3GO1H 3RDTC 1GGIL 1OB1A 5FECA 4DZBA 3NTCL 2VSCA 4X6CA 4Q2ZA 5EUOB 3ZHLA 4OZFB 1QRNA 2HFGH 3HNTH 5JW5B 1ZT1B 1R0AH 5HHXL 3OXRB 1MCOL 2F58H 3SOBH 1QLRA 4OZIB 1GIGL 2EDNA 3BJLA 2AJZB 4OIAA 1OQXA 4QOKB 3X14B 1CFSA 1Q9WB 3WJLA 1N2RA 4W4OA 1SBSL 1KEML 4NC0B 1S9VB 4BELD 3CFJB 3IT8D 2HJKB 5C07E 2X4SA 5T1LB 4Z7UE 4ZUSB 4MX7A 2EDYA 2MHAB 3IDUA 5C07D 4M1CC 1ZTXH 2NY7H 4CDGC 4NO3A 2V2TA 1KPVA 5CWSB 1DBBL 4F7MA 4FQXD 2C7UB 2EH8H 3T2OA 3LCYA 1PAMA 4JO4L 1FH5L 1V7MH 2NYYC 1DANT 3AB0C 2EH7L 2NR6D 3OJDA 1JP5A 2MOVA 4HT1H 1BVLB 2AXJA 1CGSL 5GGVY 4ORGA 3IB4A 3GUTB 4HW6A 4XNYL 3D1MC 5EIIA 1S78D 3MBEB 3CVIH 2Q1EA 3T65B 1NDGB 5CZXC 2NZ9D 3P73B 1DL7H 4PTTB 3MNWA 4IOIB 1U93A 1J8KA 4O2CA 2OL3A 3DHMA 3U4BH 2G75A 4XP6L 4DKAA 4FZ8L 4P5MB 1OSZA 4FP8L 3BESR 1IC7L 1OTUD 3T0EA 3I84A 4KRMB 2ZWLT 4ZD3L 3U36A 3MLWH 4I2XA 4P49A 3F7YB 1D5ZA 4MSWA 5GS0H 5L2JB 2E27H 3JV0A 2DIBA 3VXME 1Y18B 1TNMA 1TTGA 3ZO0A 1GL4B 3MQIA 1MNUL 1OAZH 3QUML 4HLJA 3P4OB 4Y2DB 3VXMD 5AWNH 2VB5A 3VD4A 5AYQA 5E1HB 3WD5H 3WSQL 3SKNA 4LSPL 3SDCD 3FO2B 3BP7B 3IRZA 5F1IA 4Y4KB 5IW3A 3TZVC 2DQDL 4WY7H 3RUGA 2HLAA 5M7QA 4Z0XA 2CLVB 4HUMB 4UIMA 3BWAB 3NGBC 3C08L 2VDQH 3LB6D 1MCBA 4LLYB 5EOCJ 4HUUB 3KYNA 1N6QH 2P48B 4YQXL 3TIEA 5B8CC 4KRPD 5JOEA 2JJTC 5DMIL 1CICB 4OF7A 5IVOA 1U8IA 5ADOH 3BP4B 4PY8I 4ZFOB 4ALAL 4ELKB 5TF1H 2P43B 1UWXH 1DBAH 4AEHL 1S5HB 4YXLL 4DVRH 5SX4I 5DJYB 1TETH 1HHHB 3ARQA 4GLRI 3Q2CA 4GJTB 2YRZA 3B9KB 3T4YA 4YXKL 2VL5A 1JZ5A 1FNLA 3B9VA 4KPHL 5DURD 4HEME 2PCPA 3KVQA 4E41E 1N6UA 2H2PC 4D2NA 4N68A 4Z7UF 5F7UA 1EJOL 5GGTH 3OB0H 4QTHB 4E41D 4TRPH 1FV1A 2R69H 2YSSA 4P3DA 5DJ6B 1M6OA 4MXWL 4WHDA 2BC4B 1QEWA 3BO8B 1HHIB 4AMKL 1I7ZB 1F6AB 3G6AB 5BRZE 3TO4B 3IXAB 3FTGB 3EO0A 1L0YA 2YPKB 1HWHB 3O0RH 2LU3A 4MHHG 4PJHB 3WIFB 2Y25A 1R24B 5BRZD 2YZ8A 5D2LA 3X3FH 4F8QA 3TC9A 1DEEA 3ARUA 4TSCH 4Z5RB 1JNLH 3HZVA 3GSXB 1PW3A 1YNKH 1A6WH 4QHMA 5J1SC 1MFCH 2F19H 4HUNB 3P9LA 5ACLA 3MRLB 4PJXF 4JO2L 4RFOL 3RGVB 2UV3A 2PXYD 1HKLL 3SCMA 1ZGLP 4FFWD 5E24E 3IDNB 2BMKB 3KPRA 5SWZA 5C0BA 4NQDB 1K3IA 1RUAL 4OB5L 2JIXD 5EC2A 2J1KA 2A6JA 2FEEL 3FO9B 1AY1L 3V7MA 2Y06L 5JR1L 2YPLE 1RZKC 3ARFA 4W68A 1N5YH 1I9IL 3PGFL 5HYQA 1HSAA 3ESUF 5FKAB 3JV4B 1LD9A 4Y2OA 3RWGA 3K46A 5DJCB 3IDJA 3B8SA 1K3ZA 4XNZB 3S37H 3UYRH 3QH3A 3CLEH 3OPZH 4DKDC 3LS4L 3QG7H 3PHQB 1O7SA 4D0CB 5FK9A 4OLVL 2FIKB 3C09B 4JKMA 5HI5C 3WKML 5DD0H 5TDOA 2DM4A 1LMKA 1U8MB 3C60A 4MD5B 4PJGA 3U7WL 4CVWA 3DGGB 5IFAH 1M05B 4QRPA 3BKMH 5D7LE 3UROR 5L7XH 3O4OB 5JZ7C 2GCYA 4X4MA 3L3OB 5D7LD 2AXGA 2R39A 4C83B 5ACZA 5HYJB 3LQZA 4PJ7E 1DVFA 4XPGL 5IW1A 2F53E 1N59A 3IJYB 3L7FB 2B0SL 3DYMA 4QXTA 1CL7H 1W0VB 1PG7L 2Q8BH 3MUGB 4XHQA 4HFUH 3TNMA 3V2AR 1CBVL 4R7DA 2HT2D 3QHZH 4D3CL 1KXQE 3O2DL 1CZ8L 2KPNA 2IF7A 5EBWA 2VERN 3MNZB 5T5FH 3GKZA 4ZTOL 1MRDL 3KPTA 4LEOB 4DGVH 5DJDA 3KS0H 3C6LB 5CD5C 2X1PA 5D8JL 3B3IB 1A7RL 4GXUM 2XNAA 2CDGB 4HBCH 1W72A 5TGBB 3D0LB 5IVZA 1B0WA 5E1AA 3MJ8B 3L6FA 2DJ4A 1E4KA 4RRPG 2XZAL 3VWJD 1T80A 1MFAL 4PGZA 3PQYB 4XCCH 4YDLB 5E08H 4P2OC 3OTTA 4F15B 2Z35A 1ZT4B 3VI3E 2H32B 5F9OH 3V5HB 3P0YH 3G5VB 5IWLC 3VD7A 3Q3GB 3ET9F 1KIPB 3QT2A 1FBIL 2VITB 2YD5A 2DWDB 4LAJH 4X80H 3BIKA 4EOWH 1DQLH 4Y4KC 3F6IA 3UTOA 2GSIA 3HI5H 3MRIB 2L0DA 1R5WA 5DS8B 3H42L 5FO7B 1CLYL 2YKLH 5IMMA 4GRMB 2NLJA 2D4FA 1ZHLA 3VW3L 5C08A 2QSCL 5JOPE 5FYKH 2V5YA 4GAGL 1YEHH 5KW9H 3MFFB 1MFBL 2R2HA 4HKJB 5JOPD 1R3LA 1CICC 4KK6D 1FORL 5DK2B 5A2JH 5GZNC 2HJFA 1MFEL 5EPMA 3V5KB 4XWGH 2AJSH 4MQSB 4N0UA 1O7VA 3REWB 5K9KB 1KJ3L 4NQSA 3GMQA 1KACB 4GMSH 1NGYA 3HE7B 2IPTL 3EAKA 4WFHD 3SE3A 3DROB 2UWEB 4PRPA 1EMTH 1SEQL 3B9KC 1WCBA 1XGUA 1GZPB 4LRIC 2VDML 1BBJA 3N1PC 1G7JA 2YBRA 3MRQA 4HC1L 1MY5A 4M6OH 3DX9B 5C2BH 4XCNA 5LGHH 2WQRA 5DA4A 2Q6WA 2H2PD 3IFLH 3IJHB 2XKNB 4HZAA 4PJ7F 5HGHB 4HS6B 5JDJA 1FJ1B 3TO4C 4LQFH 4M00A 1KYOK 1IGFL 3L5IA 3QNXB 3FOLB 4HUXA 4KMTH 1VGEL 5FM4A 2ZOLA 2J2ZA 5DUBA 2R1XA 1G6RB 4QXWA 4KROB 5FOBA 1EEZB 5JW4Q 5DJ2B 2GTWA 3NH7L 1HH6A 1CVRA 3RZWA 3S4SA 4NHCH 2K7QA 1DANU 3F6LA 4L9LC 1T03L 3CDGB 3QDJB 1SYVA 4G6JH 1FIEA 3KJ4B 2XI9A 3KS0J 5DJZB 5DMGD 1AD9A 3AAZA 5HHQB 3RGVC 2FL5A 1MRFH 2EDKA 2VZ1A 4OGZA 5IMLA 4Y4FB 5JQ6L 1Q1JH 1DEDA 1UWGL 3KYMB 3LKNB 1PJ9A 2RCSL 3C9NA 2XPGB 4MNHB 4DK6A 2VWEE 2VQTA 2FX8L 4XCYA 2F9BT 1YQ2A 4MDJA 2BRRH 8FABB 1EGJL 4ZPVB 5C0FB 3VI3F 4P3CH 4X99A 4XVTL 5GS1C 3BKJL 1I3RA 1I8KB 2BVOB 4YHLL 1ND0B 1DBML 3R0NA 1ITCA 1EX0A 2EIZA 4BQ9A 4S1QL 4PJ5B 4DQOH 1QBBA 3U82B 1CR9H 4XPBH 4P99A 1MJ7L 4P59L 5K9QG 5CILL 4XNZC 4MJ4A 1CFQB 3QIBA 3VCLA 1N4XH 1NCUA 4X7TA 5D72H 3UJIL 4ONHA 1PY9A 1UACL 3C09C 5E5MA 5A43C 4MQ7A 5DR5H 2J8UA 2C3HA 3C5ZB 1W8NA 3S36X 1X5AA 3QP3A 1D6EB 2ZUVA 3INUH 3O4OC 3X3GL 5HI5D 3BYTA 3MOBH 5EDXA 4YDKH 4U1IB 4LLVA 4JFEA 4X9IA 3U0WH 4QY8A 2FJGA 3IDGA 2SEBB 3CVHH 5E94B 2FD6L 5EU7C 2GFBB 1VFMA 3ALWA 5DHVH 3JV6A 4FOMA 4QHLB 1F2XK 4NIKB 3EOBB 3VFVA 1JRHI 2ICWB 3WYRA 4G9FE 5A2KH 2J5LC 2P7TB 5EUKB 4G9FD 4YH6A 1NCBH 1EEUA 2ZKHH 1KBGH 1FZOB 2V17H 2YXMA 4GW4B 3C6LC 1Q72H 3UZQA 3L95A 5CP3A 3MV9B 1VGKA 3OR6B 3AVEA 3NFNB 2EC9T 1VFBB 1A5FL 3REVB 5CD5D 3PWVB 5E4IA 3ULSA 1JF1B 1X6LA 1WWAX 1BFSA 4YDLC 3D18A 1QO3B 3CH1A 4U0RB 1OAYH 4F15C 5E99H 3SJVD 4Q9CA 2QQNH 4Z7VB 4JZOB 5DO2C 2ZUXA 4MLIA 1OTTC 3PGCA 5IQ7L 2I07A 3IYLW 3S37X 2H2SC 1TVDA 4P2OD 2AABH 4C56B 3WKNA 3OAZK 4QXGH 1IGMH 1F5WA 4X9BA 2ESVB 4J1UB 2P8LA 3LN9A 3PWNB 3VXPA 3NCJH 3NZ8B 4H20L 1CG9A 1XF3A 1RZ7L 3NN8A 3IDYB 1K4DA 1YEDA 4P46D 3BE1H 1A7PL 4RGOL 4WEMB 4ORZC 3EOAB 1VFOA 3WIHA 3LV3B 3ZYOA 1EAPA 3S8WA 4N8VG 4M7KL 5KVDL 3UYPA 4F2MA 3HE7C 1NC2A 5F7DA 5F1NB 1MCIA 4KK5C 3QUXB 5KS9E 3VGFA 1RHHB 4GMTH 2OXHA 1C5BL 2FX7H 4TVPL 2R2CA 4YX2L 4WNQB 5CINL 4YDVB 3FT2A 1NKRA 1OAXL 3V4UH 4TUOB 4Z0BL 3DETC 4PRHE 3SDXB 5L2KE 4JFPA 2DJSA 1F11A 5GHWH 3BI9X 4PRHD 1WAAE 5L2KD 1CI5A 5LXGL 5IB2B 5CKGA 4LLQB 4XTRC 3RKDC 4JR9H 5TJWK 4HSQA 3MLYL 4KROC 3AFLA 2ED9A 3BKCH 4RWYL 4M1DL 2VISA 2WBKA 4ZYKA 1G0YR 5DQJB 1IC4H 3DECA 3RNKA 4HS8H 3TIDA 5MEOB 5AD0B 4JANA 2X4TB 1PKQB 4PS4H 2CKNA 4R0LA 2BOBB 1RZJC 4JO3L 5DVMA 4HWBA 3OF6A 5DMKB 4YAQB 5IB1A 4Y4FC 4GH7B 1I3VA 3CLFL 2Z4QB 3MLUL 5CJOL 4HMEA 1UH4A 1V5JA 1AQKH 2VXSL 3CC5A 3NBNA 4UQ3A 3SO3C 1YEJH 3IJSB 4HK0A 4L4TE 4Q7DA 2OK0L 4KKCC 4NQDE 3DVNA 1U8JB 4XVSL 4LPXA 2BSTB 2DQTL 2M8XA 4YIQB 4L4TD 2PNDA 4FA8A 2DYPD 1RUPH 1PEZA 2YRPA 1QSVA 2X9YA 3SKJL 2ZSVA 3GMPB 3UTTB 3EDEA 4ZODA 2DLTA 2DS4A 4NWTH 3TVMB 4I0PB 2EDXA 4MQXD 3P9MA 1SJXA 4XC1H 1B0GA 5KN5B 3IU4H 3VMPA 5AZEH 5C8JA 3GSNB 1RJCA 1LO3L 3C5ZC 1K8IB 3GDBA 3QUZB 4XCEB 2ZOKA 5J3HD 4PJ8A 2X89A 4B41A 1SYSA 3I9GH 4M6ML 3GSUB 2JJSA 4ODTL 1KEGL 4XP1L 3FB7A 5LBSL 3G6JE 1BZ9A 3DSFL 5KTEH 5KS9F 3OKNA 3WXWL 4EQ2A 4JFOB 4HWZB 3RX8A 2OM5A 1OL0A 1HYSC 2BSRA 5EU7E 1IGCH 3HCVB 3O41A 5C0RH 1FN4B 1JHKL 3HAEH 3S7GA 4CVZB 5C0GA 1U8KB 4BFGA 4UB0L 5BW7A 1X6NA 4KQ3L 1ZGLM 1GYAA 3ROOB 1T0MB 3TJEL 4R96A 1NAKH 4NFCA 1KJVB 1WAAF 4V2BA 4K71C 5ANME 2FB4H 5F9JB 4U1SA 4FQIL 1T20A 4PY8J 4OSUL 1INDH 3GRWA 3RNQB 3VMNA 1MJ8L 2ZCLH 5BV7L 5J9PB 5DJ8B 2J8OA 4RX4D 1JI1A 4ZFZB 3CIQA 4ZNEE 4XCFH 4J8RA 1AI1H 5HYEA 1I1FA 1YEIL 3PXHA 3TYGH 3WFCH 5MENA 5DGRA 3KR3L 2VDKL 4QNPE 2FJFA 3EYUL 4OD2A 1GC1H 2Y7QB 25C8L 2E9JA 3F7QA 3QEUB 4K55A 3JWDL 4Z77A 4JPWL 4DEPC 1N0XH 3RWJB 1JGUL 4GRLB 2QR0A 1IEBB 2GEEA 4HBQA 1FYTA 4JLRA 4XBPB 4K3DL 1KPRA 3P77A 2H2SD 2IQ9L 4P2RA 3T09A 5JMOC 1YJDL 2XZQH 1ZVSA 3IDYC 2NY0B 2FGWH 5BS0B 4M7ZB 5C0CA 4S1RH 5BQ7A 2DQEL 3SKOB 3RWHA 1A1OA 5DEFB 3ALPA 5FGBA 3QDMA 4K7PX 2R0ZL 1OGAE 5GGVH 1QVOA 1NGPH 1RURH 3WMSA 3ELAT 5CAYB 4XPFL 1X5HA 3QUXC 3RY6C 1EIBA 1OGAD 3AU1A 4NBXB 4OD1L 4U2YA 5C09D 4JKWA 4ELMB 1Q0XL 1LQSR 4N5EC 4GRWE 2G60H 3MROA 4JHAH 4UV7H 2C5DC 1IAMA 4PRDA 5EU5B 1NGQH 2EXYD 1FFOA 2MCG1 3S88L 2AV1A 3G6JF 1DUYB 1BEYH 2QSVA 3HFML 3AMLA 4NQVB 1FGNH 4K8RC 4RNRB 2BHZA 1J8HB 4F9PA 2DI9A 5E8OB 3PE9A 4KGLA 1KB5L 3OKKA 1E28B 4LPCA 1KB9K 5GGTA 1NMBL 3G9AB 1YYMH 1FNEA 1RV6X 1SJEA 4XTRD 2QQQA 1U8LA 4X6FA 4J3OC 4KROD 3HC3L 4GOSA 2FR4B 4KZEH 3IF1B 2VZ3A 1Z9MA 2NX5A 1MLBB 1YMMA 4JVPA 4XH2A 1A21A 4HIEA 4KTYA 3U9UB 3B5HA 2FHFA 5DC9B 2R23B 2BY0A 4HAGA 4C58B 1HHGA 1BREA 1P5VA 3D2UB 3O3BB 3QZWG 4EI5B 1XT5A 3CX5J 3MRFB 3CFCH 4NGHH 3D6GA 1QSEE 4PJFE 4QNPF 2XY2A 4NQXB 5D7IE 1HZHL 4CVXA 2X1WL 3IFPB 4XHJC 1CE1H 2W9EH 3VDBA 1Y6MR 1QSED 3HE6B 2EC9U 4RFEA 3SHSA 2CIKA 3RQ3A 1TXKA 2W60B 2HFFB 1RFDL 3GKWL 3GI8L 4PR5B 3KGRA 4AIZB 1LP9B 5IEHA 5EO0B 1P5UA 1UM5H 3VXUE 3DXAB 1PDKA 3TVMC 4I0PC 4U6HB 3VXUD 1WZ1L 1UVQB 3T3PE 1NFKA 1XIWC 3HUJA 1AGBA 3UDWA 4TPRL 4UTAH 1KCUH 4M6NH 3UTSA 5D96B 3QUZC 4XNMA 1ERNA 5HHMB 4R2GB 1DQQA 5HPOA 5ADPH 3S34H 3L1OL 1KJ2B 5C0ND 1AR2A 5EOQH 1NCCH 5H94A 1NMAH 4S1DD 5I75B 3QNYA 3ARVA 4NN6B 1NFDA 5IFJA 1OAQL 2QHLA 3LS5L 4Y5VB 4Y16B 1XF5B 4JHWL 3T1FB 1U8NB 2UWEF 4HS3B 3TCXA 4GRWF 4XMKH 4CW1A 5A16A 5H2BB 3MLXL 4P5TD 5TE7H 2NW3B 2X70A 4MA7H 4S11A 1J86A 1FL6B 1JPGA 5LQBL 2IALB 5CEXA 2XICA 3W39A 2IH3A 4IS6A 3GSQB 1MCRA 2Q76B 4XNUL 5HHNA 5A40E 2ZUUA 1L0XA 1UWEL 2XQYG 3WFHB 5GSVA 1HI6A 3ZTJG 3TM6A 3WLWD 4BH8A 2BXYA 1ZSDB 3FT3A 4CNIA 5KBNC 3HG1B 5D5ME 1RZKH 2BSSB 5EZIL 4QYOB 1NLBH 3TA3D 1JZ8A 4HIIA 4OM1L 3VGBA 3WFDL 4OZFH 1JTPA 2KBGA 3KPSA 5K9OB 5IHZB 3GMMA 4X4YA 5E9DE 4Z7VE 2ICWI 1K4CA 1SY6A 5E9DD 2DMCA 4G9DB 3MXWL 2NW2B 3QIWA 3RHWK 1JV5B 4UT7H 4HKBA 5KSVB 3I2CH 3G5ZA 5D70L 3H9ZA 4PJFF 3PG2A 2R29L 4X7FC 2CRYA 2J8HA 1PYWA 4XI5D 1ED3A 5JXEC 3VXSA 2XZCL 4LVHC 4FZEL 1NJ9A 2WBJA 5LGJA 1BBDH 2NY0C 1G9NL 3RVUC 1CE6B 2W9DH 2OTWB 1FZKB 2FCBA 4JPVH 3V8OA 5E5UB 4DN3H 3CMOL 1I9JH 2YD6A 4H1LB 1MREH 2EKSB 5E2WH 2Q7YB 4XP9L 1Q9LA 1V3KA 3T3PF 3IFNH 4OF5A 4NQCA 5ICXA 4G8GE 2C1OB 4NNXA 3Q6GL 4G8GD 3EGSA 3PUCA 2A83B 1WWBX 4JGMA 4MJIB 4OUUA 4NYLB 1AD0A 3DX7B 4OLYH 2IC2A 4U4BA 1MUJA 3K2UL 2P4AB 4G5ZH 4PRNB 5ICZA 2FBJL 2VR5A 2XWBB 1RK0B 3CDFA 3CXHK 4K3EL 4KI5C 3WL9A 1MFDL 1I8LC 2GITA 4P9ML 5HHXH 5CJ5A 1JGDA 1MCOH 2IEPA 3GHEH 2GT9A 1A0QL 5GGRY 2Z92A 3AREA 2LABA 2ZSWB 4JQIL 3IGAB 3JWDC 3S9DB 2P49B 1CK0L 3VFNA 1SBSH 1UA6L 1KEMH 1S7XA 2IH1A 5E2UL 3VXRE 4UOW0 3H7LA 3WEXA 5J11B 1UYWH 2NY6C 4UUJA 2QSQA 5IESL 3GZKA 5MERA 3VXRD 4H8WL 1YJDC 2OTUA 3B2VL 1MJJA 2VLJA 5FHBL 2W38A 2WUCH 2Z8RA 4I18A 4EI5C 5DJXA 1NAML 2XFXB 5D5MF 1DBBH 1CU4H 4K94L 5D1ZC 4JO4H 2YEZB 5LCVL 4X83A 1FZJA 1C08B 1JUFA 2DLEA 3HE6C 5E2VH 3LAFA 4Q6IC 3UBXB 1IT9L 4Z7VF 3N85L 4F58H 3K8MA 4JZNB 1XF4A 2D3VA 3QNZB 1JYNA 3AM8C 4XAKE 4TVPE 4X4XA 2VC2H 5D9SA 5F7NC 3QA3A 4XAKD 2HT4C 1TJHH 4TVPD 1JNHA 1OB1B 4FZ8H 4QTIL 4DZBB 4X6CB 4UZGA 1R3HA 1IC7H 1QRNB 1R3IL 2B1AH 3ZE0E 1LNUA 2YUWA 5L9DL 5D96C 3PWPE 1QLRB 4ZD3H 4R2GC 5D7JA 2UZXB 1S9KC 1IFHL 5I1IH 1HE7A 3PWPD 1CFSB 1XIWD 1IC5L 1N2RB 2XN9E 4GKNA 4X7CC 5GXBB 4JM4L 4ZO9A 3U46A 1MNUH 5I75C 2XN9D 4NN6C 4Y5VC 4Y16C 5AYUL 4TN9A 2X4SB 4MX7B 3SQOL 2DQDH 1ADQA 2MSPA 3P30L 1HXMA 1NEZA 2X1QA 2EECA 5CGMA 3QEHA 4P23D 4NO3B 2V2TB 1KPVB 4OQTH 3MA9H 4F7MB 4Y4HD 2WV3A 5I1JL 1F4XL 3VG9C 2R2BA 3OJDB 4YQXH 1MEXH 4RFNC 4ORGB 4E42A 2P24A 3LVEA 5GGQL 3ULVL 1OAKH 5DMIH 4HWUA 5DHVA 1A14L 1HHKB 3F12A 1CD1A 3EOYG 5HXMA 3GMOA 3QUYB 5EIIB 1EHAA 5F7MC 1IKFL 3LH2L 2X4QA 1UCBL 4Z8FL 4YXLH 4MJ6A 3MCLH 1J05A 3RU8L 2ATKA 2MWCA 3MNWB 2VLRE 1U93B 2W65A 4O2CB 2OL3B 2AKRA 2DLFL 2G75B 1UWXK 2VLRD 5TPWL 1OSZB 1HCFX 3DOSA 3T0EB 3RZCD 3ARTA 1M7XA 3U36B 3R1GH 1X7QA 4I2XB 4HGWA 2HRPL 1D5ZB 5E8DL 2PW2B 4MSWB 4FG6C 4AMKH 4GG6E 3IETA 3O6FC 4QWWC 3H9SA 5JA8B 3CZJA 1N8ZA 5E6IA 3OB0K 4RQQA 1FRGL 1X9QA 4I48A 1XFPA 5DD5L 4NBZB 3SKNB 5F1IB 3TCLA 1NCAL 4HIJA 2BFVL 2VDLL 3RUGB 2HLAB 3FB5B 1CXEA 1R3JA 4JFDE 4Z0XB 3V0AC 1ZE3C 4UIMB 2ARJA 4JG0L 4NP4L 1X5YA 5GS3A 4LASL 5C07A 2A9MH 4JFDD 3FB6A 4Z7UA 3KYNB 3I6KA 4BSVA 1UJTA 3RWIA 1U58A 3TIEB 2FX9H 4RFOH 2MPAL 3GNML 1U8IB 5MP6L 1RZ8A 1HKLH 4WI6A 3ZE0F 4YUEL 1J0ZA 2G5BA 2YR3A 2CGRL 3HNVH 3QUKA 4OB5H 4ELME 1A02N 5MI0B 1H8NA 2NXZB 1MVFA 1T83C 3T4YB 3MUHL 2VL5B 4KK8C 4CU7A 3CFEA 2NQCA 2PCPB 1O0VA 2H3NA 5BJTA 3E8UH 1I9IH 3PGFH 3DHJA 4KI5E 1DDHA 1B4JH 1U9KA 1UB6A 1FV1B 2H32H 2YSSB 1J8HE 3BX7C 1M6OB 3MRPA 4P3DB 5K33A 1QEWB 4R4NC 4DJMA 4KI5D 1B90A 1ITBB 1KLUA 3LS4H 5IBUG 5FGSA 4HIXL 3EO0B 5K9JL 5JW4M 4OGAC 2ZUTA 5J11C 2AV7A 4PV8A 5D2LB 3VXMA 3T8XA 4WVRA 2OR7A 4JPKH 1DEEB 3O8XD 3SDCA 3HZVB 1C7SA 2HVKA 1IARB 3VRIA 4KTEH 1VACA 2NY6D 4BJLA 1BAFL 2I27N 4F9LC 3AGVA 5L8LB 4HJJH 4QHMB 2QADB 2HH0H 2KZWA 3P9LB 1A1MA 4N8CH 2B0SH 4IMLA 1BVKB 4YDIL 2NY4C 3CSBA 3SCMB 3BZEA 5T1MA 3KPRB 5D1ZD 5SWZB 3B43A 5C0BB 3U7AA 1CZ8H 5EC2B 4GG6F 2HAZA 4GRWH 4ZXBC 1QQDA 2A6JB 4ODSL 2Z93A 1AO7E 1RVFL 5D8JH 1A7RH 4OFVA 4IMKA 1D6VL 3DXAE 5TE4H 1TLKA 1AO7D 3ARFB 2VL4A 4U33A 5HYQB 1HSAB 2IFGA 1LD9B 5DFTA 1VB9A 3RWGB 3V4PH 5KVGL 1MFAH 3TLRA 1FNHA 3IDJB 1L7TL 4EN3D 4B7LA 2HT4D 4E41A 4ODUA 3QH3B 3LIZL 3RFZC 1LWRA 5F1SA 1D7FA 4M5YH 5FK9B 5CGTA 3RPKA 4R2GD 5TDOB 3C60B 4JREB 2NY5L 4PJGB 3PABA 2Z31A 5BRZA 4QRPB 5J4MA 3EYQC 2GCYB 3VU2A 3H42H 4ELMF 2AXGB 5ACZB 3LQZB 2Q3ZA 1DVFB 5IW1B 1D5IL 4EUPG 3VW3H 1N59B 4QXTB 3LHPL 3I02A 3RI5K 3VGGA 3V7AG 4GAGH 4B53A 1XGQA 3TNMB 1QFUL 5E8PA 2D9CA 5TE6L 1LO0H 4R7DB 4KI5F 2PXYA 5CHNA 4RMSA 5EBWB 1FC2D 3D9AL 5F3BA 1G6RL 4Q9QL 4NRZA 1KJ3H 2Y9RT 4N5UA 3RTQC 2JIXA 5DJDB 4ZS6C 1I1AD 2XNAB 5F7EH 5F88A 3RIAK 1W72B 5IVZB 4WTWA 5E1AB 3O6LH 4TOYL 4H26B 2I25N 4RMRA 3L6FB 3QSKB 4OCRL 5IV2A 4NUGL 4HC1H 4QCIA 1RULL 5FB8A 1A22B 5I1GL 3HI1A 4GXVL 4M61A 2XTLA 3O9WD 2Z35B 4P9HC 2NY1C 3C5SA 3UEZA 1CS6A 3VFMA 2FRGP 1LO2L 3BHBA 3H0TA 1P4BL 3BIKB 3MBXL 3QI9A 3O6FD 4QWWD 3NCYP 1R5WB 3L5JA 3NH7H 4QXUL 1IGJA 3L3GA 4QHKI 2EE6A 4Z7WE 2NLJB 1DLFH 3I3DA 4NNYA 3WDJA 1LP9F 1OSPL 5D7LA 5C08B 2VLKB 4NZRL 1BLNA 4AIXA 4R3SA 4XP4L 2R2HB 2X2YA 3BN9C 1R3LB 4X9FA 4OFPA 4PJ7A 3UC0L 5JQ6H 1J11A 2C9AA 5HVWA 1UWGH 2HJFB 5F7LB 2RCSH 5EPMB 4N0UB 3GBLA 4NQSB 4KWUA 1EGJH 1B6UA 2NXZC 1NGYB 3CXDH 3D25A 4XVTH 2A6DA 2YD2A 4PRPB 5I1EL 3BKJH 3MLPA 3JVGA 1WCBB 1XGUB 4OZHB 2APWA 3MA7B 5T3ZL 3MX0A 1BBJB 1G7JB 5LAXA 2PF6A 2YBRB 3MRQB 5J7CC 5GSRA 4S1QH 1E0OB 3CSPA 5DWUH 3PNWA 3VWJA 4XCNB 2DQHH 1MJ7H 4P59H 5CILH 2I60H 2H6PA 2IBGA 3VI4E 3QAZB 4JDVA 2Q6WB 3S98A 2BXZA 3D3VE 1GJIA 1JYXA 1UACH 5FCSH 3D3VD 4HUXB 2ZOLB 3FZUC 5DUBB 2R1XB 3PV6A 3U9PH 5F9AC 5FOBB 2AJYL 3HZKA 3MLZH 3WNNA 1HH6B 4R97B 5DRXA 2APFA 2WP3O 7FABL 3X3GH 1IAKA 4OGAD 3S4SB 3TBTA 4HH8A 3HI6L 4PD4J 4O02L 4X6BA 1WGOA 2R4SL 1SYVB 2ADFL 3GK8L 2QADC 1AD9B 3AAZB 2FL5B 1VFUA 5IMLB 3SGEI 3NABH 3SCMC 3C9NB 3V79C 3C8KA 4XCYB 2NY4D 1FLTX 1J1PL 1PKOA 4MDJB 4YHYB 4X99B 5B8CA 4Q9RL 1I3RB 1JMZA 3ZYZA 2LVCA 5GGSY 2O5YH 5HJ3A 4XZUA 2XG4A 4YWGH 2EIZB 3RWCA 4LL9A 4ZXBD 4XRCB 3ARFC 1L4IA 1W2KT 3B5TA 3V6ZA 1T7XA 5C3LD 4HDIA 2R0LH 4X6CE 4Y19E 4K8RH 3FN0L 2DWEA 3VH8A 4Z7WF 1QACA 3QIBB 3VCLB 4X7TB 3O3UN 4FQ1H 2D7PA 4ONHB 4Y19D 3IAQA 3WBDA 1ZANL 1P84J 4LSTL 5E5MB 1NC4D 5CP7A 5IQ7H 2XWJA 3UBXI 4CN4A 4MQ7B 2J8UB 2AXHA 1FYHB 3C60C 4X98A 4JREC 1ACYL 3RWDA 1A2YA 1A64A 4PUBL 5DDHA 1BQHG 2N7BA 1WBXA 5MEQA 1G7HA 1RIVL 1H5BC 4LLVB 5C0EA 4JFEB 3NVQA 4QY8B 4GAFB 2FJGB 3IDGB 5FUOH 1DVFC 4H20H 2ERJB 3MRKA 1JNNL 1RZ7H 5F7FA 4D94A 4P5KA 1T1ZB 4XMPH 3JV6B 1R5VA 5IM7A 4OTXL 3VFVB 4OLZH 4QLRA 4NM4L 2VAAA 4RGOH 4LVNB 3BPOB 5TQ0H 3VI4F 1JCKA 1J7VR 4YC2C 3NFPB 1S9WA 5KVDH 4XWOC 3N9GH 3L95B 3M17A 4TVPH 1C5BH 3V6BR 1VGKB 3CGTA 4Y8AA 2HN7A 4K2UH 4H0HB 5CINH 3RTQD 1E4KC 3FFCE 3MLTA 5ICYA 3ULSB 1HQ4A 4ZAKD 4ZS6D 4OKVA 4AM0B 5IFHL 3FFCD 2Q3AA 3D18B 3CH1B 4Z0BH 2X4RA 5KVFL 1X5GA 2KUTA 4XGZA 3PGCB 1U42A 3K1DA 2I07B 4I13B 4HJ0C 4CGTA 5IBTH 2NY1D 5I15L 3MLYH 2P1YA 3DGCR 4RWYH 4M1DH 3UPRA 3ZKND 2NY5C 2P8LB 3MRJA 5H35A 3VXPB 5EO1A 2VKWA 1CG9B 2F5AL 1XF3B 2VDNL 3NN8B 3C2AL 4JN1L 4BZYA 2A9NL 2BK8A 4NCC2 4JO3H 1YEDB 3QWOA 3WFBL 4FABL 4HCRL 5I1HL 3L3KA 4M43H 1OWRM 1YEGL 4UU9A 3MLUH 3NACL 5EULV 4X6CF 1J18A 1BWMA 4LSVL 3OZ9L 4TTDD 1EAPB 2W0FA 1EVUA 4KTDL 3BDBA 4F2MB 4KMQA 1NC2B 5F7DB 3ROLA 3SE3C 1QTYT 5JW4N 3ULVE 2F8OA 4G9FA 1Z3GH 2DQTH 4FNLL 3MJ9L 4HD9A 3ULVD 4BFEA 1E4XI 1SVZA 1T1YA 5CJQL 3A0OA 1UH3A 3MLVL 5SV4A 2DQJL 3MLSL 3TYFA 2R8SL 4MA1B 4L4VA 1X5LA 2DLIA 2EDDA 3S97C 2UVEA 3QAZC 5GRJH 4MZ3A 3JXAA 4RGMB 5EA0H 4JFPB 1WT5A 2VRAA 5I18L 1F11B 2W9LA 3LKSA 5D71L 4MS8C 3S35X 3SJVA 4LPTA 1MQKL 2IG2H 3IDMA 5ESQA 1LO3H 2QHRH 2E6PA 1E6OL 4P2OA 5DYOB 5DZLA 5M95B 3ZDYE 4OLXL 5IF0A 2VISB 3EYSL 4ZYKB 3F7RA 4XP1H 3M45A 3RNKB 3FZUD 5LBSH 3TIDB 2J6EH 1WQVT 1S9YA 4JANB 4G6ML 1G0XA 3WXWH 4R0LB 4WCYL 2CR3A 4CU6A 3HPLA 6CGTA 5IB1B 3NCBB 4UT9H 4HWEL 1Q38A 3HS0A 4ZUTB 3OMZA 4U0QB 4P46A 1HSBA 5J56B 1JHKH 1QFOA 3O2WL 1WLHA 2XQBL 4LSUL 4UQ3B 1VENA 4HK0B 4AEIL 4YHYC 3RA7L 3DVNB 3V95A 5F7YC 2EDEA 4KY1L 4FQ2L 3I6LE 43CAA 3K2MC 1QR4A 5L8JB 3PIQB 4KAQL 2H1PL 4IRJD 3I6LD 1KV3A 5KS9A 1MJ8H 2ZSVB 3SE9L 2O61A 1NBZA 3KYAA 1YNLH 5C6PB 4LHJB 4TSBL 4FTVE 4BQ8A 3QIBC 1NL0L 5GGUA 3KR3H 3P9MB 1KJMA 2VDKH 4FTVD 4LRIA 3LEYH 1B0GB 4NJAH 1T7YA 3CX5K 3J8F7 4YFEA 1JN6A 2JCCE 2YUVA 5C8JB 1R3KA 3VXNA 2FZ3A 3JWDH 2EC8A 2ZOKB 4JPWH 4PJ8B 4YXHL 4GKZA 1V3JA 1JGVL 3GSRA 1SYSB 1JGUH 5CGYD 1A7OL 3OKLA 4LSSH 4LCWE 1QOKA 4WEBH 3FB7B 4K3DH 1P2CB 5HHPA 4ONGH 1RMFL 4UBDC 4AY0A 1BZ9B 1JMXA 1D9KD 4PJBE 3OKNB 5MEPA 1WZLA 5C7XH 4LCWD 3ULVF 1RJYA 4ZTPH 1YJDH 1ES0B 1UGNA 2PYFA 3QUMA 4K9EL 2BSRB 3KPQA 5KZCB 5DVOA 4D8PA 5GRZA 3EO9L 3O41B 4NKQB 2FEDC 4S2SA 1X4XA 4BSJA 1YY9C 5IP4A 4LVNC 5C0GB 3BPOC 1I7TA 2DQEH 4L9LA 2E9BA 2ENYA 4MAUL 4X5WA 3ZYIA 2EXWC 3FRPG 2R0ZH 1FE8H 4R96B 3V6OC 3BZDA 5I8OL 1B3JA 1MH5A 4NSKA 4U1SB 2AEWA 4OD1H 1T20B 4GAYA 3NPSC 4UOJA 4L4TA 1Q0XH 4L29A 3ZDYF 1J1OL 5BXFA 2OMBA 2DYPA 5D2LF 4FXKA 4J8RB 4Y5YA 1I1FB 5GS1A 3S88H 5MENB 1YDPA 3HFMH 1YYLL 2FJFB 4OD2B 4POUB 3EBAA 4PP2A 5FIEA 3QPQC 1KB5H 4Z77B 1KJ2H 4FQLL 2QR0B 3UP1A 4OKDA 1FYTB 4JLRB 4JE4B 1KPRB 3P77B 4OZ4A 1F3JA 2IGFL 4P2RB 1T1XA 4BFIA 3AS0A 4LKCA 3ES6A 5FUZH 3G6JA 2Q86A 3WUZA 5C0CB 1TJGL 1F58L 3JSSA 4MAYD 3ARBD 5BQ7B 1DQJA 3BKYL 3F58L 3P3YA 1CGWA 3RWHB 1A1OB 1S7QA 5CSGA 3QDMB 1XAUA 4MB5A 4M9OA 4XNXL 1QVOB 2OR9L 1HZHH 1YZZA 2DD8H 2JB6A 4I1NB 4IM8A 3AU1B 3VFPA 1EUTA 2K7PA 2JCCF 1JBJA 1QFHA 5FYJE 1ROWA 5EFIA 1T2QH 3FQUA 1RFDH 3GKWH 3GI8H 3MROB 4I9WE 1F8TH 5ANMA 5GISL 4A6YL 4HPYL 4I9WD 1L9MA 2V7NA 1FFOB 2AV1B 5E0QA 3EJYC 3M8OL 4RX4A 4Z78A 4PJBF 1PZUB 4RGMC 3VFUA 2J88L 1NCTA 1WZ1H 1GHFL 4ZNEA 3D0VA 1HKFA 4HUWA 3B2UD 3TJHC 1CN4A 4NWUL 1WITA 3OKKB 4TPRH 1L9NA 4I3SH 2QLVB 1CFVH 1K6QH 1DQTA 1RJZA 2DI8A 4MS8D 1FNEB 3S5LA 1SJEB 2Z8SA 1U8LB 3OAYH 1IBGL 4X6FB 1C8PA 2A6KA 1MAML 1T5XA 1MJUL 5KVEL 1YECL 2NX5B 3U79A 3U4AA 3MPCA 1BWWA 1GSMA 1YMMB 4JHWH 4XH2B 4HIEB 4AL8H 2D9QB 5SX5H 4H1LH 5EU6E 3WDIA 3QRGL 1HHGB 5DQ9A 5C6TH 1JF5A 5C0JA 3MLXH 4KKLC 4ZSOE 2HTLD 5EU6D 1QBMH 4OZFG 1A7NL 5BCAA 4G6FB 3MUJA 4CVXB 4EXKA 1FL5A 4WI2A 3BZ4A 4RFEB 2CIKB 3JTTA 3WE6A 1J1XL 3SDYL 2HKFL 3QDGE 5D1QD 1OGAA 4KJQC 3MGOA 1ACZA 5C09A 4J23A 4P4KD 4F7EB 4WW2A 3QDGD 5IEHB 1T04A 1HNGA 3O2DA 3KWWA 1KN2H 3LQAC 5DQDL 5T3ZE 3MRHA 5FYLL 4OM1H 2QV2A 3WFDH 1EA9C 2CIIA 4Y1AE 4M62H 5T3ZD 3QCTL 3BGAA 3QWRD 3HUJB 2BCKA 1AGBB 4Y1AD 3UTSB 3A6CL 2YRLA 4XNMB 5IW6A 4PJ8C 1DQQB 3BQUD 1AQDB 3FQNA 5CBEA 3MXWH 1W0WA 1H3WM 5DRZA 2JJSC 3T0AA 2XA8H 2MCPL 5H94B 3EHBD 2VH5H 4LARL 2R29H 1XF2A 4YHKL 5EORL 3PWJA 3W9DA 3K3QA 1NFDB 4JKLA 2XZCH 2BNRA 4FZEH 4JFEE 1KIRA 4L8DA 1IILE 1G9NH 1XCQA 4D9RE 3MOQA 4UBDD 4CW1B 4L5FL 5A16B 3LN4A 5ILTH 5DD3L 3NAAH 1FPTH 4QHKJ 1Q9KA 5I1CL 2X70B 4U3XA 3LMJH 5BW7C 3CMOH 2J4WL 1JPGB 3TP4A 3BUYA 4RDQF 3GBML 4BZ1L 5CEXB 2VQUA 3I3BA 2IFFL 3LKRA 3W39B 2IH3B 4IS6B 1YY9D 1T2XA 4OI9A 1QSEA 5HHNB 3V6OE 1QHPA 4HKXA 4PJFA 5D7IA 5T33L 2EXWD 1SM3H 5GSVB 3FN3A 1HI6B 4WFEE 3T2NL 2LU4A 5C0DA 2FDBP 4BH8B 2DKUA 4XVUC 2HKHH 3FT3B 4ODBD 4CNIB 3EZ8A 3WXVL 1VSCA 4WFED 3CK0H 2B2XH 4HGKC 2FBJH 4HIIB 3DBXA 2Y36L 4WV1B 3KPSB 4CKVX 2FSEA 4K3GA 5IGXL 3TNNA 1KXVC 3VXUA 1M7DA 3GMMB 4X4YB 1MFDH 3LRGA 4HJGA 1TMCB 1K4CB 4P9MH 4X4ZA 4IRSB 3QIWB 2A77L 1MWAL 4HC1A 1A0QH 5F3HA 4HKBB 1MPAL 2NMSA 3LEXA 4JQIH 3G5ZB 3RKPA 5GS0C 1LVEA 1CK0H 3NCCB 4O9HL 3KPPA 1UA6H 1PYWB 1ED3B 3VXSB 5E2UH 5FUCE 4LVEA 1NJ9B 2WBJB 5LGJB 4WWKD 3U7YL 1UCTA 1F4WL 2HRLA 3IS0X 3R8QA 5IESH 1HDMA 5GJSH 4X6EA 5JIPA 4JVUA 2EKJA 3MV11 1EBAA 4LDLB 4U1NA 1NAMH 4P5TA 5FGBC 1Q9LB 1FNGA 3DV6A 3V6FA 5LCVH 4NQCB 4N9OB 5ICXB 4M03A 4NNXB 5A3IC 3GSWA 1A47A 4D0DA 1IC1A 1OD9A 4WEUD 3EGSB 4LKXA 4GSDL 2J8UF 3VG0L 4UAOB 3DURA 1PFCA 2OL3H 4OUUB 4O2EA 5DFVD 1AD0B 4CADA 3LEVH 3MUY1 1MUJB 5E5RB 5ICZB 4X0KA 3RX5A 1EGJA 4MA3A 3VFRA 3BISA 3TA3A 3WL9B 1OPGL 4F9PC 1KFAH 5D5MA 1MAJA 2GITB 3EJYD 4PRIE 1IM9D 1R3IH 4P9HH 1YQVH 5L9DH 1QFWL 1CDBA 1JGDB 2P8PB 2GT9B 5JDSA 4N8PA 3WDHA 4PRID 3N0PB 1UXWA 2Z92B 3AREB 3BZFA 1BOGA 1IC5H 3VFNB 1S7XB 5TDNA 2IH1B 4WHYH 3WEXB 1MCSA 2GW5A 1OP9A 1RJLA 5L6YL 1WJ3A 4UUJB 1KTDA 1LE5A 4YFLI 2E7HA 5MERB 1JGLL 2BDNL 2OTUB 3ZZ1A 1MJJB 3SQOH 2VLJB 2VMFA 2D0FA 4HXBH 3DLQR 4I18B 5DJXB 1TJIL 2CO7B 2B4CL 2F8VA 5INDA 4LHUD 1X5KA 2CD0A 1F4XH 5I8KH 1OGTA 1FZJB 4CAGA 3V4VL 2YHGA 1JUFB 3BN3B 3RVWC 1A6UH 1XGYL 4KKLD 3AY4C 3CFBA 4WI7A 1EEYA 3JV5A 5GGQH 3ULVH 1YPZA 1A3RH 1IKFH 1XF4B 4J3WA 1UCBH 3KHQA 4G8GA 2X1XR 5AAMA 3DPBA 4F57H 1EPFA 1UEMA 2ORBL 4OCMC 3RY6A 4X4XB 5D9SB 3QA3B 3L5WA 3P4NA 4KUCD 2DLFH 3H6JA 5TPWH 1A7QH 1FG2A 1JNHB 4M48H 1MOEA 3UDWC 5DK0A 3A67L 5D7JB 1J0KA 2R1WA 1REIA 2X40A 4GKNB 4Z95L 4YGAB 4UNTA 5ITBL 1HHJA 5IHUL 1FRGH 3OKOA 1I3UA 1JTOA 1A6PA 3SDAC 1ZLUH 3KJ6L 4DFHA 3ARDC 2BFVH 2VDLH 3VXRA 3VGAB 5FEBA 1HXMB 3QBTB 1NEZB 1N3NA 4YFLF 1CLCA 3QEHB 3LDBB 1PSKH 3T08A 4LASH 1KELL 4WHTB 2R2BB 3ZE1F 3HMXL 3BMWA 4E42B 4PLJC 2P24B 2MPAH 2BHYA 1JPSH 3GNMH 3BMVA 5DHVB 3F12B 1CD1B 4R4BA 3GMOB 4YUEH 1R5IA 3LY6A 1NH6A 2X4QB 4X7EC 5IBLD 1A4JA 4MJ6B 1J05B 1Q0YL 4JFQB 2ATKB 4G7VL 4FFYH 1CD0A 4LPUA 2W65B 2OI9B 2AKRB 4I5BA 3GGWA 4NBYB 1A6VL 3ZT6A 2BX5A 2W92A 4IRZH 1X7QB 4HGWB 3F5WA 3GIVA 3QIWC 4JDTL 1NGXA 3IETB 3H9SB 2C3GA 5C71A 3E0GA 1N8ZB 1G9ML 1P69B 4RQQB 3PWPA 2EYSB 5K9JH 4H88L 4I48B 1FO0L 2COQA 2KQMA 3MFGB 4P2YA 5ERWA 1TQCB 5F6HI 3Q0HA 3BP6A 4HIJB 5DZOA 1G7MB 3TCLB 2L7JA 4HV8A 1CWVA 3MACH 1RIUL 1R3JB 1RU9H 3BPNB 4NZTL 2ARJB 2PR4L 5C07B 5D2NA 1BAFH 3FB6B 1XCTA 4Z7UB 5BVPH 4P23A 3I6KB 3Q5OA 4BSVB 4FQXB 5I19L 4Y4HA 3RWIB 3FRUA 1F3DH 2BVPA 5I66A 4YDIH 3LZFH 1C5CH 1J5OL 1MQ8A 3K7UA 1RZ8B 4GFTB 4FFZL 2G5BB 3DI2B 1GGYA 5J6GA 5B3NA 3QFJE 4UAOC 3QUKB 1MY7A 3WHXA 3QFJD 3UAJC 4KHXL 1IGIH 5I8EA 5I17A 1D6VH 2CK0H 4WU5A 3HC0A 2H3NB 5BJTB 4G3YH 2VLRA 1WUNT 1DDHB 1CFBA 2ARWA 5IOPA 1UB6B 2Q7NA 4ETQA 3MRPB 1RY7B 3RZCA 4O5LL 4LMQI 1U3HC 3VFSA 1KLUB 3AREC 4YJZL 3LIZH 2W0PA 2XACC 1CFNA 2VDOL 4RGNE 1WISA 2AV7B 4PV8B 1WC7A 4B7IA 3VXMB 4GG6A 1FL3A 3T8XB 2NY5H 4P4RA 4RGND 4MGXA 1X3DA 4YZFE 5TH2A 5I76A 4HHAA 3SDCB 3H2WA 2HVKB 3AC0A 1S8DA 4OGYH 3VRIB 4KKAD 4JQVA 1VACB 2DTML 4I18C 3A6OA 1DFBH 2IBZY 1D5IH 4JFDA 1A1MB 3LSOA 4IMLB 3LHPH 4JGJA 1OF2A 2VXUL 4UI2A 4KJPC 4FFVD 4Z7OE 3U0TA 3MRNA 5E8NA 4KRPB 3BZEB 5FCUL 4IDJL 5T1MB 5FYJH 3UXFA 3MSPA 2JELH 3E6HA 3CU7A 4JB9L 4M8QA 3RVWD 1QQDB 5SWQA 2AGJL 2Z93B 1V3MA 1KC5L 2C3VA 4Y5XA 4IIQC 4FMKA 1NMCC 4K23L 5DSCA 1PLGL 3RGHA 3LOWA 4PD4K 3ZKQD 4TOYH 5DURB 3C8HA 1VDGA 1CD9B 2EDBA 1UM6L 3V5DA 4EKXA 1JTTA 3U4EA 4E41B 4ODUB 2EEBA 2ITDA 5I1GH 4K7FA 3HR5A 4GXVH 4H0IA 3OWEA 2WQ8A 2BVQA 3MCKA 1QSFE 2F54E 2HTKD 1A1NA 1NCWL 3QCUL 4JFYA 1HOCA 2AJVH 4WHCA 3VGEA 1QSFD 2E3VA 4UMGA 2F54D 1F3DJ 5IB3A 1EZVX 1RI8A 1P4BH 3OBAA 3PABB 3KPOA 3MBXH 5BRZB 2DQIL 4XC3H 2VZUA 1N7ML 1FIGL 5GGRA 1JZ6A 3VGAC 3QJFA 3OHXA 3O8XA 3SDAD 4TUKH 5HDBE 3LDBC 2Y5EA 3BDYH 3OX8A 3ARDD 3ME0A 3I02B 4XB7A 5DD6A 5AZ2H 2RHEA 4C4KO 4MB4A 1XGQB 2X4UA 1UQSA 4XP4H 5E8PB 4DTGH 3BH8A 2B4CC 4KQ4H 1GZQA 2PXYB 5CHNB 2OQJA 4BH7A 4YPGA 2P5EE 1P84K 1E27A 5D1ZA 3HAEB 2M2DA 5F3BB 2P5ED 2X41A 4NRZB 2JIXB 1DLHA 3E3QE 4JFXA 4KVCL 3SDDD 4C4KT 4Q6IA 2CXKA 1Z9SA 2OS7A 5I1EH 4QHUA 2OI9C 4ERSL 5BMFL 5F88B 1TTUA 4GUPA 5T3ZH 4GBXD 2HG5A 3ZL4L 4YZFF 1AO7A 5IV2B 4QCIB 2GY7B 1BQLL 3HI1B 4M61B 2YUXA 5FYLE 2I9TA 4EN3A 4XMLL 1XMWA 3C5SB 2P5WE 5FGCE 5E6IC 5FYLD 5KVMC 4F3FA 2VAJA 2MQ0A 4PGDA 3BHBB 3H0TB 4KV5E 1WIOA 2AJXH 2P5WD 2YK1H 1AR1D 2W0LA 4Z7OF 1ZWIB 1TQCC 2HJLA 1H3VA 1Z2KA 5JA9A 3FMGL 3M07A 3VWKD 2AJYH 5EWIL 1NBVH 1KB5A 3BFOA 1IGJB 4G6KL 2O93L 3L3GB 4Z18A 3BPNC 4L8SA 1MCPH 3BAEL 4NNYB 5F89A 1JHTA 3HI6H 1QBLL 3EJZD 4NT6A 5D7LB 4M5ZL 3HLAA 2ADFH 1BLNB 1PBYA 4R3SB 3FFDA 3RBSA 2UUDH 4PJ7B 2D7OA 4MCZB 2X4NA 2HWZL 1AE6H 5H37H 1JJUA 1S78C 4HULB 1J1PH 5CP3H 5JW4R 1LO4H 3D25B 3DMMC 5HVHB 4TQEH 4Q9RH 2OXGA 2NZ9C 1CXHA 4RISL 2WWKO 4U1KA 3IVKA 1I1AA 1PQZA 5HVGB 5LAXB 3K80A 5GSRB 3LRSA 3W5MA 4HFWA 4JRXA 3UAJD 1CLOL 5CSBA 3PNWB 1OTUC 1JFQL 3VWJB 5HDBF 2H6PB 3MRMA 4JDVB 2X42A 1A3QA 1QYGL 2HLFD 3O9WA 2O5ZH 4LEXL 4N0RA 3HZMA 1MHPH 1U3HD 3PV6B 3TH4T 5F7KC 3LKPA 4WI3A 1G9MC 3HZKB 2Y6SD 3F7VA 3I75A 3TV3L 4TNWF 3O6FA 5DRXB 4CRPA 1IAKB 3TBTB 2R4RH 5IEKA 2P46B 2PW1A 4X6BB 2LQRA 4L3AA 3O4LE 5JXAL 4LF3A 3P11L 4MJ5A 4Z7WA 1WEJH 3JWOL 3ZTNH 3O4LD 3WIHH 3QXUA 4WUUE 4OTXH 4KRPC 3BXNA 4NM4H 3KXFE 4WUUD 1MHHA 3GHBH 4TSAL 4XPHL 4KRLB 2OMNA 3KXFD 4XPTL 3RWFA 5JOFA 1KB9J 1JWUA 3HRZA 5B8CB 2FECL 1BFOA 4KV5F 1JK8A 3SE8L 2GHWB 5HJ3B 4XZUB 4ZQKB 4PYHA 3RWCB 3G08A 4C55A 4O00A 4F7PB 3DVGA 3V6ZB 4HDIB 4HZLA 5I0DA 1T83A 1FAKT 2DWEB 3VH8B 1FQ9C 3U2SA 4L8BA 5AUMA 5CP7B 4UDTA 4MB3A 2XWJB 4NC2B 2DRUA 3PV7A 3PJSA 1KCSL 1I1RA 4X98B 3S6CA 5DFWH 4NO0D 3D3VA 1U41A 3RWDB 2Z31C 4QKXB 1A2YB 3MODH 3MO1B 5DDHB 1WBXB 5MEQB 1G7HB 4OIIH 4MNQE 1P7QD 5C0EB 4HWBH 5KSAD 3ULUL 4CU8A 5DD1H 4BSWA 3CFDA 3DO7A 2F5AH 2VDNH 3MRKB 4YFDB 4MNQD 3DVFA 3RAJH 3C2AH 4JN1H 2X7LA 4LP4A 5F6IB 4P5KB 2A9NH 2VR9A 1R5VB 4Q0XL 2E7CA 1YN7A 3HB3D 3VA6A 5I1HH 5I0ZA 2VAAB 1NEUA 3BRDA 1J9CT 5IROA 3DX8A 3NACH 5HGBA 5FHAH 2OCFD 2KZ1B 5ESVA 4Z76A 4LSVH 3OZ9H 3V52L 3IDXL 5HDQL 1S9WB 4KTDH 4QT5A 5T5NG 1MSPA 2QQKL 1TIUA 3C5JA 1I8IA 3M17B 1ONQA 2VZVA 5CZVL 2AJZA 4FNLH 3MJ9H 4XBEH 2HN7B 1HN1A 4JZJA 3FO1A 4ZXBA 3MLTB 5ICYB 2AERT 3H9YA 3RVVC 1HQ4B 4OKVB 5L8KB 2R8SH 1J88A 2AJUL 1I4FA 2X4RB 1DCLA 4XGZB 4PJIE 1ORQA 3MGTA 3ARWA 3EYOA 4Y19A 4HMCA 3E2HC 4XBGB 3H9SE 1QKZH 4OM0L 1NC4A 3VDAA 1GC1C 1MQKH 3Q6FA 3QI9C 3SPVA 2A1WL 3UO1L 3H9SD 1E6OH 5DJ0A 2VN7A 4NFBA 5E6ID 3ARGD 3EYSH 5H35B 3HMWH 3MRJB 4W81A 5EO1B 1I85A 5GJTL 4LCCA 1J87A 5F44A 3KPLA 6FABL 2RQ8A 3MBEA 4OJFL 4U1JB 3QWOB 5F93C 2ITCB 4HWEH 2QBWA 2AVGA 4HAFA 1BGXH 1FDLL 1U36A 2VXQL 4UU9B 5AG8A 1DN0A 4IOIA 2HT2C 2BRQA 2GJJA 3GO1L 1FLRL 2W0FB 3L5HA 2XQBH 4RZCA 4WDIA 5JHLH 3O3AA 1L6XA 3ROLB 1NAMA 4N1HB 3RA7H 5HVHC 2HFGL 3GRWH 1AXTL 4G9FB 1R0AL 1DQMH 3JVGC 3SOBL 1OP3H 4FQ2H 4H0GA 2ZPKH 1A6AA 3OXSA 2E9IA 2H1PH 1T1YB 3DMMD 4WTZA 3NCEB 9CGTA 3TYFB 3K81A 1IQWH 4RSVA 3RTQA 5FDWA 3VWJC 5BOPA 2ZCHH 4ZAKA 1CD8A 2WK2A 1NL0H 3FFCA 3UTQA 4BKLB 3SJVB 5J6HA 4IHOA 2NY7L 3TWCH 3IDMB 4ZUVA 5ESQB 4P2OB 4M9PA 3QIUC 4YXHH 2EH8L 3GM0A 4G42A 1JGVH 4DKFH 1Q94A 4M02A 1V7ML 5IF0B 3GBNH 1A7OH 3VXOA 2XTJC 3MRGA 3UMTA 5CLWA 4PG9A 1S9YB 2HVJA 2UVFA 2O5XL 3D85D 4APQD 4JJHA 4DAGH 3HPLB 3HKFA 1QG3A 4K9EH 15C8H 5GS2H 3HS0B 3CXHJ 1NUDA 3EO9H 1HSBB 4P46B 4GW1A 4KK6C 3WHE1 3NIFE 5JLZB 4PJIF 1A6ZA 1WZMA 1QFWM 2PYEE 5I8OH 3X12A 1K2DB 3MLWL 3MV01 43CAB 1C12B 1UG9A 3W11D 2PYED 2E27L 3I50L 5KS9B 1F3RB 2OJZH 2CMRL 2X9XA 2O61B 1NBZB 5F8QC 4QGTA 4UNUA 3EFDH 3W2DL 1TVHA 3DSNA 1R24A 2FJHA 2NTFA 4KGJA 5GGUB 4FQJL 1KJMB 4X8XA 4D9LL 1YYLH 3DRQA 3GMLA 4PJDE 3RWEA 3I85A 3LN5A 1BJ1H 1JN6B 2YUZA 4PRHB 2ADJA 1R3KB 1KTRL 3VXNB 5L2KB 2VDQL 4GKZB 5CJXA 1T6VN 1G1YA 3GSRB 4AQOA 3RPIA 3OKLB 3QEQE 5HHPB 3VD9A 1MCLA 2MKLC 2IGFH 3QEQD 5MEPB 1CXIA 2Z31D 5ADOL 1G7IA 1RJYB 3VFWA 4PLNC 1TDQA 2BMKA 2PYFB 4J3TA 5F6HJ 3QUMB 5F6IC 5TF1L 1T1WA 1DBAL 1HYRC 1M7IA 3KPQB 4D8PB 5DMGC 5TFSL 5GRXG 2LV4A 5FOJA 3TPKA 1FFPA 5GRUL 5BVJA 1TVBA 4S2SB 4YGVA 5I8CA 3BUTA 3BKYH 1I7TB 4L9LB 4X5WB 1X44A 2I9LA 3IKCA 3A6BH 4PP1D 2QKIA 4XNXH 2OR9H 1I3GH 1MCWW 4N0CC 4ESKA 5FKAA 1MH5B 2R69L 4NSKB 5DJCA 2QJDA 2VWEC 4UDUA 1FG9C 4GAYB 2Q20A 4L4TB 4L29B 1NLDL 5BXFB 2DYPB 3S36L 4FXKB 4RMQA 4IRJA 5GISH 4HPYH 1INQA 2IAMD 3O0RL 3SGDI 1OW0A 4Y5YB 5GS1B 1WTLA 1YDPB 5BZDA 2YOCA 3MV7E 5GGSA 5IMKB 5DZNA 3O45A 4O58H 1KCVH 3WFEH 5DHXB 1QSZA 4CN6A 3LKQA 3MV7D 3RVVD 4FTVA 4H1LG 4PP2B 4NWUH 1A6WL 4LCIL 5E6YA 1BIHA 3BVNA 1MFCL 2E7LA 3NIFF 2JCCA 2WUBH 1E6JH 4OZ4B 1F3JB 1OCWH 2Y1VA 1T1XB 4BFIB 3QI9D 1W0YT 2OSLA 1QPXA 5EN2A 4LKCB 1D9KA 1MAMH 1U91A 3ES6B 5KVEH 4LCWA 1U95A 4OF8A 3G6JB 3G5XA 1D5BA 2Q86B 3ULUC 5D7KE 4PJBA 1U3YA 4L1HA 5JPNA 5JQHC 3OAYK 1DQJB 1H5BA 5D7KD 3QDAA 4UV4L 4WO4D 5F96L 4KJYA 1S7QB 2PO6D 4J7RA 2PN5A 1N5YL 5SX5K 3CFKA 4EVNA 4PJDF 2JB6B 5CUSL 1L7IL 3VFPB 2FO4A 3H9HB 2D7TL 1BJ1J 4YO0A 5B38A 1T66D 4XB8A 3S37L 5EFIB 3SDYH 3UYRL 3OPZL 2D7NA 3FQUB 4GG8A 1LE9A 2J5LB 3QG7L 3BEWA 5ANMB 4WI5A 1PZ5A 2V7NB 2BZDA 1HXYA 3W0WE 4Z78B 3IAPA 3RX7A 1QLEL 4MVBC 3VFUB 1WT5C 2CRIA 5DQDH 5HGDA 3GB7A 3BKML 3W0WD 1SY6H 3D0VB 1KTKE 3KYOA 4HUWB 1MCCA 2Y5TA 3FQWA 5LVEA 4WGWB 5D93B 5I1LA 4W70A 1FNFA 1RJZB 5E2JA 3TH3T 3AROA 2R0WL 3UBXG 3VXTA 1CL7L 3S5LB 2Q8BL 4HKJA 5D4QA 2R56L 2XTJE 1P4LA 1U2CA 4YHKH 2A6KB 3QIUD 5EORH 4L8CA 4NM8L 5C0AE 3T2PA 2XRAH 2ZUYA 2XTJD 5T5FL 4YHPA 2ZJSH 5EC1A 3UJTH 5C0AD 4JM2D 5F7WC 4L5FH 4DGVL 1TCMA 1BD2E 4P46C 5DD3H 5DQ9B 5C0JB 5I1CH 4MAYA 3ARBA 3C8DA 4J4PC 1GH7A 2GSGA 1IM3B 1ZEAH 1BD2D 2J4WH 4LVOB 4LBEA 4TULH 3TBYA 4BZ1H 2I24N 4PY7A 2IFFH 3BZ4B 4XCCL 1BHGA 3JTTB 3WE6B 5E08L 3L7EA 1OGAB 4OF0A 3SY0A 4NN7B 5C09B 4LQ1A 2CDFA 1JHLH 4WFHE 5F9OL 2X6MA 4WW2B 3T2NH 1T04B 1ZXQA 4LAQH 3WXVH 5DF0A 3QNXA 3KWWB 4GRWB 4X80L 2EIEA 3MRHB 2ZNWA 1DQLL 2CIIB 3HI5L 5IGXH 2D7QA 5B3JE 2BCKB 3TH2T 2YKLL 2VXTH 5IW6B 5HYSA 3FQNB 5CBEB 2ZNXA 3PL6D 1W0WB 1G7QA 5HI3C 3ZSTA 5DRZB 3BOVA 5EZOL 1FGVH 3H3PH 4O9HH 1XF2B 2XA3A 3PWJB 3W9DB 2YD3A 3PXJA 5A1AA 1TQBB 2BNRB 2GJ6E 1KIRB 5DC4B 4L8DB 1JZ4A 1F4WH 2AJSL 1XCQB 5D7SH 1X5ZA 5AEAA 2GJ6D 3LN4B 4GMSL 1X5FA 3WV0A 4ZO7A 1ZS8A 2VSDA 2NY2D 2YPVH 4X7SH 1EMTL 4HPOL 5IT2H 5HD8D 3WN5A 5I73B 3BUYB 5EU6A 3LKRB 4M3KB 5IJVB 4ZSOA 4M6OL 1I9RL 1FFRA 2NY3D 1QSEB 5LGHL 4HKXB 4PJFB 5D7IB 4DVBA 4DW2H 1MCJA 3IFLL 5D1QA 3GFUA 5ALCH 5D1XD 4N0CD 5C0DB 3SO3B 3JWNC 4P4KA 2CK2A 4KU1A 2YA2A 4D9QE 2LAAA 3QDGA 2EO9A 4KMTL 4Y5YC 4WHYG 3ZDZE 3ZHKA 3MLRH 4OCSH 1BIIA 4D9QD 1M4KA 3DBXB 3I6GA 1QBAA 1IAIL 3R8BB 5IR1A 2FSEB 3TNNB 3DX6A 4MQXC 3VXUB 1M7DB 3VFTA 3P4MA 4NHCL 4HJGB 1BVZA 3B9DA 3QWRA 4UILL 3MNVA 3DYPA 1QFWH 4Y1AA 4G6JL 5J3HC 5F3HB 3U6RA 3BQUA 3LEXB 1MRFL 3KPPB 2GK2A 1A3LL 1C16A 4OGXH 2BNUA 3Q48A 1ADQH 4XXCC 5L6YH 4MMXC 3WUWA 1HDMB 2GI7A 4X6EB 4M3JA 1JGLH 3NZHL 5IIEA 2BDNH 3MRRA 3ULUE 3STLA 2Z91B 3KLDA 1T0NA 2APBA 4U1NB 4P5TB 2AEQL 3ULUD 5LKNA 2B4CH 1F97A 1SJHA 1FNGB 3DV6B 3V6FB 4DQOL 2BNQD 5EZLA 1CR9L 2YN3A 5B3JF 5ACMA 1D5MA 3GSWB 3GIZL 4MZ2A 1K8DA 4LDOB 4D0DB 1N4XL 4HGMA 2WWMD 2FLBT 2UZIH 3DURB 3UCRA 1EJ6A 2WIIA 3B9AA 2CRZA 4GW5A 4HLZH 4CADB 3V6OA 2EIBA 4PV9A 3L3IA 5CEZE 5DR5L 4K71B 4X0KB 4LOUD 4MA3B 3VFRB 5CEZD 3TA3B 4L4VE 3INUL 4YE4H 1T3FA 5D5MB 4YDKL 4L4VD 3U0WL 4MVBD 3A67H 3QDHA 3SJVE 5D93C 5HGAA 3CVHL 5JDSB 2FYYA 1UXWB 1RIHH 3BZFB 5E9DB 3R4DA 4JEGB 1BOGB 1NUFA 4K7PL 5TDNB 1AGDA 5J1AA 1UJ3A 1RJLB 1KTDB 1LE5B 3VJ6A 4DEPB 3KJ6H 5JIIA 3TFKD 4WWKA 32C2A 1NCBL 3VRJA 2H26A 2ZKHL 4JJ5A 1KBGL 1Q72L 1T6WA 3LKOA 4JFFE 4ODVL 2JJWA 2VDRH 1ZLUK 3ZDZF 2APVA 2FH6A 4WJ5A 5INDB 4LVOC 4JFFD 4NRYA 1OGTB 4G7YH 2PKDA 3HMXH 1OTSD 3CFBB 4ZDHA 1EEYB 4J4PD 2H41A 1YPZB 4LU5H 4ZFGH 1OAYL 4NN7C 2EYTA 5E99L 43C9A 2OZ4L 2QQNL 4WW2C 5FO9A 5FV1L 5CMAA 1OOAA 4G8GB 4MA8H 1P4IH 4NNPH 2AABL 2ICEA 2EXYC 5GPRA 2CJUL 3P4NB 2DI7A 3IDIA 1IGML 2H9GA 1FG2B 4OLWH 2HFEA 1N6VA 1EHLH 1A6VH 4PTUA 2FO1A 5DEGA 4DKEH 1ZK9A 2P42B 5DK0B 3NCJL 2E5EA 1ZOXA 3ULUF 2D03L 3T0VA 1IM9A 2R1WB 2I5YH 1PY4A 4PRIA 3OGOE 1SQ2N 1G9MH 1HHJB 3BE1L 2YZ1A 1RUKL 4H88H 4XVJL 3WJJA 1FO0H 4XP5L 4F80A 1TQBC 2Z4QA 5HI3D 4XNQA 5B39A 2RAMA 2FIRT 1G9EA 4LLMA 3VXRB 4W4NA 1RIUH 5E6ZA 1N3NB 3SN6N 3GJFA 5F72S 2HA1A 2D0GA 4GMTL 4NZTH 2BJML 5I73C 3GMRA 1FVEA 5L0QB 4U05A 3VXQA 4U1LA 3QQ9D 1EXUA 1B0RA 4FXLA 4LHUA 1CQYA 4D0BA 4LK4A 1N64L 3OAUH 3N1FC 3V4UL 1J5OH 5DVLA 5J1TC 4R4BB 1GGBL 4MNGA 1UZ8A 2UYLA 3KHOA 1R5IB 4HCRA 5FFLA 1FZMA 4YHMH 3EJJX 3MOAH 5GRWA 1A4JB 2AK1L 3O3EA 1UFUA 4JR9L 4KXZH 4I5BB 4KHXH 4Y8DC 3GGWB 4LSQL 3GSUA 1U8PA 3SKUD 1IC4L 4JY5L 3MJ9A 4PJAE 3AMKA 3F5WB 3GIVB 4PS4L 1NGXB 4O5LH 4ISVA 3EFFA 4ODXA 3PWPB 1XIWB 5C0NC 4M6AA 4F37F 4DOHE 4L1DA 3WNKA 4S1DC 1F02I 2XT1B 2XN9B 3F62A 5CKAA 1AQKL 3X17A 3BP6B 3K4AA 5DHYB 4HV8B 4O4YL 3HPJA 3SGDH 3OKEA 3ESVF 4LFHG 5I1DA 4EBQL 1K85A 2DTMH 1ZVYA 5D2NB 1LK3L 4CMMA 1BOYA 1XCTB 4P5TC 1CT8A 4U6YA