5KSAB

Bel602-dq8.5-glia-gamma1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
190
structure length
190
Chain Sequence
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksaB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksaB01
1AQKL 2R23B 3P9MB 1NQBA 4R97C 2PXYB 5EU6A 1NGZA 5BW7C 1CCZA 4JR9L 4L1HA 3VFPA 1ED3B 2VLJD 3LS5L 3GO1H 1YPZB 1FZOB 3RGVA 3Q1SL 3QJHB 2ICWA 1TVBB 1SYVB 2BNQD 3V95A 3T0DA 4GRLD 2FEEI 3O45A 4G7YL 3VFOB 5EIVA 2DDQH 3KNBA 3QZWB 3U0PA 5JHDB 2BCKB 3Q6GH 4XBGB 1MCJA 4K3JL 5HPMB 4Y7MA 3RAJL 4NYLA 5F3HB 4M7KH 5DLMH 3KPOA 2ZWLT 1U8LB 2CSPA 4PJGE 4MAUL 1I3RB 1X5YA 4WHDA 3HC4H 5DK2B 3AREC 3MXWL 4OKVB 1GL4B 2J1KA 3MLWL 4U6YB 4QRTA 2Q7YA 3HZVB 2UVFA 5DYOB 4O58L 4WFFE 1KJMA 3QPQD 3F6LA 3PGFH 3NCYS 4M1DH 3O6KL 4ZS7H 3DRTA 5EULV 3ZDYF 4DVBB 1F8TL 3BP5B 2IBBA 5J6GB 1GGUA 3U46B 3VGHA 3J8F7 5E8NB 3DROB 3SDXA 1D9KC 3RTQC 4MVBD 1NEZG 5TE7L 1UH2A 5JW3L 1LEIA 4NUGL 2O93L 4BFEA 5I8EB 2CK0H 2ZSVB 4HS3A 4ODHL 1S7WA 4YPGA 1QFWI 2VABB 4HCRH 3ILQC 4JFYB 4BKLB 1IC5L 5JW4M 5LJYH 4Z7OE 4TUKL 2XZQL 2J4WL 1JZ3A 5CEYB 3O4LA 2Z91A 4R96B 3MYJB 2OTWB 3ZKSD 1DQLH 5ELIA 4DGVL 4X6DA 3ZYIA 1UKQA 4YDJB 2A1WL 3JBG7 4KPHL 3KPRA 5DJZA 4IMKA 5HDBF 1ZAGA 1NCAH 4DW2H 1OGAD 3EYFA 5EOCL 3UBXA 1FO0L 4OZHE 5F1SA 5T3XD 3BP4B 4P2OC 5L2JA 5GS1B 4LSSL 1G9NH 4MAYA 2X9XA 1ZS8A 4PJGB 4K8RH 3EOBB 2JE8A 3TH4T 4X4YA 3I6LE 5C6PB 3QUYA 3TM6A 4X0KB 2E7HA 3ALPA 1YN7B 3RTQD 4ORGB 5T3ZD 5DHXB 4DFHA 5FOBB 3OX8B 1KCSH 1CFNB 4FZEL 3GMRB 1KT2A 4MGXA 1ZLWK 1ZMYA 3QEQA 4QHMA 1BVZA 5GSRB 4Z7NF 1HHGA 4PYHA 3DV6A 4M5YH 3MRFB 1QBLH 4AZ8A 1I3GH 3JV4A 2R1XB 4JKPH 3IDJA 5GXBB 2BERA 4GMSL 2CIKB 4I2XE 4M4PA 2YD5A 4NHCL 4X4XA 1FL3B 3QIBA 4I0PA 2DI9A 3L3HB 3U9UA 3RZCD 1KYOK 2VXTH 5KSBA 4WUUA 3FT3B 3WFDL 2RGSA 1D5ZB 1ZXQA 3ZDXE 2H3NA 1VPOH 3QEUB 4WI7A 5GRVK 2OR9H 32C2A 4CW1A 3ALXA 3STLB 1WFUA 2B5IB 3UYRL 1VESA 3L3IA 4X8XA 3T2PA 4XMKH 3DX7B 1S8DA 4O2FA 4Z77A 3PQYE 4L9LB 1UWEH 3O2DH 1F4WL 1LDPL 2PYEE 4HD9A 4Q9QH 3TIEB 4OZHB 5EUOA 3U7WL 3SDDD 1LP9E 1T03H 4ODUB 1U8JA 3S35L 1N3NA 1RZGB 5T33H 2R0LL 2J88H 5FECA 3RNKB 4Y4FD 3C60C 4KHXH 2CGRH 1ONQA 4RAUB 2NX5E 5GS0C 4F7MB 2A38A 5F3BB 3GJEA 4ZSOB 4NKMA 4F9PC 1XF5A 1I4FA 3A0OA 4QRQA 1RZ7H 3R8BB 4KROC 1SEQL 3ULVD 5D1ZA 3O3DA 1FVCA 1NBZB 4FQIL 4NQDE 5CSZB 4JFDA 5IIEB 3PP3H 1J8HB 1U8KA 4QYOB 2OXHA 3SGDI 4UT9H 5FYJL 2G60H 2RR3A 3G5ZA 3M45A 1G7HB 1X3DA 4Z7WA 3X13B 2EDXA 4NO5A 4RWHA 4ZTPL 3SE9H 3Q5OA 1OCWH 1NBVL 4XTRC 5IVXF 4I3GA 3U4BL 3N1QC 5B8CC 4TOYL 1IFHL 4K23H 5DO2D 1B0GA 1VGEH 5IMKB 4HF5H 4K7PY 1QSVA 2WP3O 2XWTA 3U1SH 5I1JH 5E1HB 1Q94A 2ITDB 2K1MA 5KOMC 4U0RC 3FT4A 1DSFH 1Q9OA 5D5ME 5I2IA 3C5SB 1BJ1J 4XZUA 4P46B 3E0GA 3QG7L 2WV3A 3JWOC 5I75C 3ELAT 4HK0B 5D7SH 1F6FB 4F2MA 1PQZB 2FATH 3MGOA 3PDDA 2WQ8A 1J0ZA 3PQYB 1HHIB 2PYEB 3MBEB 4MD0B 4IRZL 4KROD 5DRNA 2IPTH 1X5JA 5HHPB 3QG6A 2DJSA 2APWA 4QHUB 5GGVY 5C9KA 1G7JA 3GK8L 1NH6A 3LEVL 4P2QE 2NX5B 1Z0NA 3MREB 3KAAA 5E2UL 1FNHA 2MPAL 5C6TH 5J3HD 3CNKA 2VERN 2DTML 1DVFC 5D1QD 3I6KA 3MODL 5F9DC 3GIZL 3RBGA 1SJHB 2VXVH 1QACA 5IHUL 2F8VA 2XYCA 4H8WH 2YBRA 1YA5A 5DEFB 3U7YH 4UT6L 5AZ2L 1TQBB 3QEHA 4QXWA 1S7QB 4QRUB 3SKNB 5EB9A 5DRWA 2VN4A 1MVUA 3FCTB 5JXAL 4ONFL 1KXVC 4OF0A 3O6MH 1LE5B 4U1HB 2OI9B 4Q6IB 5IB4B 1U8OB 2O5ZL 1T89A 3S97C 1CQKA 2IFFH 2UY7A 4BH7A 2WWMD 3BDXA 2CJUH 1AD0A 2BVQA 4OT1H 4M7LL 3UPCA 5HI5C 2NY7L 1XF3B 4I1NB 4KK6D 5D71H 3OBAA 5IROA 1QPPA 4Y5XA 5GRUH 3ARYA 3QA3B 1LO0L 5DC9B 1BAFH 5D5MB 5DUBA 2F54D 2JJTC 4ODVH 4QNPE 1WZMA 1WFOA 2OR8A 4FQ1H 4MA3A 3VWKD 1G6VK 2X09A 3NGBB 4ZO7A 4DZ8A 3IDIB 3QRGH 4F57H 5IQ7H 4NNPL 5IMOB 2R2BA 5LGHL 5HVFB 1BZ9B 5ADPL 4M1CC 2BY0A 2XWBB 3X3FH 2XT1B 1U3HB 5H37G 1KTLB 3QQ9D 3MA7B 1BD2E 4IOSD 4RZCB 1NUFA 4P2QB 3FN0L 4LBEA 4HKBA 1Q0XL 4PRPD 2I9LB 3E8UL 4QO1A 3TJHC 2DWEB 4FQXD 4FHBD 5ISZB 3F7RA 2J8UB 4R4FL 1IKFL 1BBDL 5MEOA 2A74B 1FVEA 4HMDA 5FYLE 5KN5B 4LK4A 4OZFH 1HDMB 4K3EL 4MXQC 2X05A 4U2ZA 4RNRA 4WU5B 3AMLA 4NNYA 4HWEH 5JZ7D 1E4WH 3GEWB 1EBPA 3AS3A 1T20B 1IMHC 3WDHA 3LSOA 4NUJB 5LXGL 1VEPA 4FXLA 1K85A 1PZUB 3IF1A 5DMIH 4KI5E 4MA7L 4NHUA 4MCZA 3EFDL 2C3WA 1BQLL 1RUMH 2BX5A 3RGVB 3FB7A 5TQ2L 3IXTA 5C3TA 5MERA 3BZFA 1V8HA 4D8PA 1QRND 4M1CD 4JHAH 5CBAB 3LMJL 4HC1L 4ZUWA 1FCGA 5FGBA 3MLZH 3CSBA 2GW5A 2OL3L 3PABB 2J8HA 5CEXA 5KS9A 1PW3A 2NPLX 1IQWH 5DT1H 4IRSC 2GT9A 5BZDA 3MGTA 5C2BH 1AC6A 2X5PA 1MIMH 2UUDH 4WWKC 2WNGA 5EOCJ 2D31B 3VFGH 5LVEA 4MXQD 1BD2B 2Q7YB 1FFQA 4GBXD 5C0NC 5KANI 1TVHA 2XQBH 2X6MA 3VRIA 1QQDB 3WD5L 1MCOL 3DRTB 2IMMA 4CU8A 2QKIB 3CDYA 3MO1B 3WFEH 3VA2C 4HHAA 3QQ3A 1UCBH 1NL0H 4I13B 1KCRH 2AEWA 3GSVA 4UNUA 4NNXA 3BKYL 4KZEL 4IRJC 3X14B 5HGAB 3W5MA 1YEEL 5HHOE 5EN2B 5ALCH 4HKZA 5E6IC 3SEPA 1T4KA 4MQXC 2ORBL 5D2NA 3TV3L 5HYQA 1X44A 1A6UL 1IT9H 4WVRA 2AI0H 2Z91B 2GUOA 1NANI 3NCMA 1DEEA 1U95A 5C0IB 3QP3A 5JHLH 4U1KB 3HA0A 4P2RA 3NABL 5DDHB 4YH6A 3TCLB 1U8NB 3CUPB 4I3SL 4NZTL 1ETZB 4YDVB 3AB0C 3EYFB 1J1PH 3ZKXB 4MXWH 5DQDL 4ZFZB 2JB5H 2P8LA 1Q9KB 2H2SD 1TNMA 2VZSA 5GGQL 4OI7A 1ZS8B 3LKQA 3NFSH 1URLA 5D72L 5GJTL 4E41D 4LEXL 5E95B 1AD9B 4UOJA 3RNQB 5BS0E 3REWB 3EZJB 3L5IA 1WTLA 2Q86A 4FXGA 3ZTJH 4IRJD 3I84A 4NQEE 3QUKA 2I5YH 3FONA 2AJUL 4NO0A 1KT2B 5TFSH 4C83B 3QEQB 5TE4L 4X6FA 3WO4C 4QHMB 1IAIH 1XGYH 4F7TB 4MSWA 1JNLL 1I9RH 5F7WC 2X70A 4I4WA 1M7DA 3JV4B 1FFRA 3V6OE 5HHOB 2YD8A 3SDAA 1FHGA 3IDJB 1YMME 5IW6A 3GI8H 4EN3B 3OKDB 3NACH 2X4OB 4HS6B 1TJHH 1U8PA 1MUJB 4G9DA 3BYTA 3IXAA 4OCRH 1SMAA 1Z9OA 2H3NB 4YO0A 4OQTL 5KOVC 1T5XA 32C2B 4YHNB 1DLHA 3DX6B 3RWJA 3M17A 4KKLD 3CFBA 1HZHL 4R90L 4J3TA 2ZCHH 1JHKL 4MYWB 1ZLUK 3SGJA 3WFCL 1C5CH 1S8DB 3NCCB 2E5EA 1OARH 3I2CH 4PYGA 4DGIH 2CR3A 4KDVA 4JCLA 3KYOA 3LY6A 5L2KE 3W0WA 3O41B 1X7QB 1P5UA 4TSCH 5GS0L 5ENWA 3GHEL 3V5DB 4PJ9B 3R8QA 1W0VA 3GI9H 1KPVB 1JPTL 5I1IL 1UKSA 4IS6A 4PREA 1CFTA 4WUKH 5BS0B 3AGVA 1I7RA 4EBQH 2MQ0A 1I4FB 1PKQA 1H3VA 5I16B 4NQEB 5GISL 1YQVH 2BRRH 3BESR 4NQUA 5SWSE 4JFDB 2BVUA 5HDQL 4OFIA 1J88A 1JTPA 3GRWA 1S9WB 4Z7UB 1I8MA 4NCDA 4TVPD 5F9OL 1ZA3A 4OLXH 1V3LA 3T3MF 4YDIL 5MEQB 1S7RB 5DJXA 3P30L 1UVQA 2EKSB 1AQDB 4L4JA 4OFYD 5J1TC 3WIHL 2BVOA 3BH8A 5B38B 1F4AA 1HKFA 1VACA 4MCYB 1UJ3C 1V3JA 3FL7A 3ZDZF 2VAJA 1YN6B 4F9LA 1G0DA 2XWTB 4U33A 3KLDA 3C8KA 3C2AH 3K4ZA 2DJ4A 2K9UA 1Q94B 1HWGB 1R3KB 1JUFA 2NY0C 3JWOL 5A2KH 3FRPG 2IC2A 2HVKB 4L4VE 3P4NB 5BVJB 5KVEH 1WK0A 4KJQD 3L5XL 1N64L 1SYSA 2KZWA 3OJVC 1C16B 2O61B 4PUBH 1RJYA 2NY6D 4JDZB 1G7JB 3P9LB 2GSIA 1MEXH 3IDYB 3QFDA 4KTEH 1QG3A 4BH8B 3NIDF 5CKGA 2Q3AA 2ENYA 2OP4H 1I85A 1CDYA 2VB5A 4G3YH 4JQVC 4WHYH 4N0CC 3I6KB 2LABA 2XWJA 5TDOA 5DGQA 5SWSB 1RURL 3M8OH 1B6UA 3GHBL 4PB0H 3DPBA 3BE1H 4S2SB 4HKXA 1CGXA 3GFUA 2NLJA 3ARBB 2BC4A 3PWUA 3I9GL 3WKNA 2XZCL 4ZPTA 3MRQA 1QTYT 4EI5C 4NOBA 1D5BA 5EH1A 5CS7A 1MFEH 1IEAA 3HRZB 3GSRA 4LPUA 2CRMA 4WIQA 4L29B 3BSZH 4NKIH 4N1HB 4RAVA 5I15L 4LDOB 2I24N 2R2HB 1T83A 5ETUB 4ZXBA 1XF2A 4WO4C 1XR9A 5J57B 2NNAB 3UTSE 2AEQL 5CD5D 1DQML 2XRAH 4L4VB 4X9HA 4U49A 2CLRB 2ZNWA 4LSTH 3BKCL 1JGUL 4RMSA 4DZ8B 1MCBA 3V4PL 5D96C 1MI5E 4J3WA 5CZVL 3QFJD 5IB2B 5IB3A 3V0AC 2WIIB 1U91B 5CZXD 4QY8B 1LD9A 1KIRA 1G7LA 1XEDA 4QHNB 4NKOB 4M48H 1GSMA 3RL1A 4FQHA 5GHWH 5C0CD 1XGPB 4MX7B 3WNLA 1NDMA 1JYNA 4FQPA 3ZKMD 1XH3A 3RU8L 3JSSA 3MJ6A 3OKKB 1XIWC 1ZVYA 2W65A 1ZANL 4N9OB 5F7MC 4PJ8D 1OLLA 3HUJA 4Z0BL 2YUWA 4JO2L 1U8MB 4KUCF 4XVTH 1MPAL 1YNLH 3OKMB 4UUJB 5ERWA 3RVUC 3MNWB 4ZNCD 4MDIA 1ADQA 4YUEH 2X4RA 3IDNB 4D9LL 1B0RA 1ZA6B 1KG0A 2DQDL 1OWWA 3EO9H 2W0KA 3MRDA 1S7VB 3RHWK 5ESAA 4HZLA 3FB7B 1FN4A 3VXQA 4J8RB 3S7GA 1JGDA 1RD6A 2FR4A 5MERB 3BZFB 3GMQA 5HHVL 1CXLA 2NY1C 1CFQB 4JKWA 3CFJB 4NSKB 3F12A 3TA3C 4Y4HA 5JOPD 4KRMB 3B9DA 4GRWH 5C07A 3WDJA 5CEXB 5BRZE 1FGNL 1FFNA 4L3ED 4G8IB 3HLAA 4NN6C 1U3YA 4MQSB 2PTTA 5MI0C 1UWXK 2D7TL 4JB9L 3MGTB 1MI5B 3EHBC 1DBAL 2VLKE 3QDJD 4TUOA 2X89A 4R6UA 4U1IA 4X7CC 2WUCL 1UA6H 3O6FB 4ODSL 3ES6B 1Y6MR 1W72A 5HTSA 4JFZH 4XP9H 1K2DB 4MNHB 4OIIH 4PP2B 4OD1L 4KVCL 1FNEB 1EFXD 1AFVH 5EU3A 1LVEA 4FTVE 5DJYB 1ODAA 2MHAA 5DD0L 1MHCB 1A3RL 4NNXB 3WIIL 2R0WH 3G6DH 5A16B 3CU1A 4TPRL 1YY9D 1AY1H 1F6AA 4Q2ZB 1AXTL 3TVMB 5JW5A 2V2WA 5BVPH 5E00A 1H3XA 1WBZB 4ODTH 3MV8E 3BT2L 3UMTA 2IADB 3VXMD 4OLUH 1D5XB 4RBPK 3THMH 5JPMB 3WFHB 1WUNT 3BAEL 2CK2A 2HTKC 2UV3A 5IBLC 1FAIH 4QXGL 3TZVB 4GW1B 4JAMA 4NM8L 4P2RB 4UDTB 1NLBH 1EIBA 4XNXL 1NMAL 1K4DB 2V9RA 3RDTA 4FMKA 4X7FC 2BNRD 4XC1L 4OCYL 1I1AA 3FN3A 4QTHA 4XMPL 5BRZB 3DO7B 4O51B 5JDSA 2CUIA 1OAKL 1ORQB 1U6AL 4HIIA 1SBSL 3MLYL 5T5NF 2XTJE 4MJIA 5GS2H 3UJJL 1MY7A 1NUNB 5DJ2A 2DLTA 4Z8FL 3OKOA 3OV6A 1SJVA 3REVB 5I1EH 1JN6B 5HY9A 3FFDB 3F5WB 4MHHI 5FYKD 1WBYA 2DRUA 5GGTH 1FG2B 1NCWL 3QHFL 1NDGB 3KHOA 3I6GA 4MDJA 2G75A 5E8EA 5FGRA 1QR1A 5DJDB 3PHQB 1LEGA 3V5HB 5JW4N 1CG9B 5HGDB 5IFAH 4N8CL 2ATKA 3GSWB 3L3JB 3TBWB 5LQBL 4FTVB 1VFMA 3DIFA 5ID0A 4OLWH 3QISA 3V6FA 4LHUG 2ZOKA 5CHNB 1XF4B 3VI4E 4APQD 1MJ8H 2X70B 4I4WB 4KHTH 1M7DB 5E9DE 4ISVA 1IC4H 3FO9A 2R4SL 4IDLA 1V7NL 5IW6B 3C5ZD 1RPQA 1HILB 4L3CB 4TVPL 3ULVF 2PXYD 2V17L 1JPSL 3MV8B 2Q76B 2HTLC 1E4XH 1CD9B 1RVFH 3IRPX 3MRMB 2FO1A 1IGMH 1DLHB 5I1CL 1T1YA 1WICA 2IQAB 3MA9L 1MNUL 3Q3GB 5IOPB 4BYHA 3STZB 4MS8D 2XY1A 1XGUA 3R1GH 5HHNA 1A1NB 1GH7A 3UC0L 3O9WC 3L7FA 2XG4A 3MOBL 1V7ML 1IKNC 4PJDF 2F5AL 2XTJB 4YHKH 2O5YL 3UJIL 4ZOAA 5KZCB 4Q0XH 3CX5K 2DQUH 3IAQA 5DRZB 4NQVA 5F9JA 5D7LA 4KKBC 4OCXL 2D0HA 2Z92B 5FUOH 1J05A 3LH2L 1FCCA 4FZ8H 1KJVB 1GZQB 1WZLA 2FGWH 1KCLA 2AS5M 4XP6H 5ICXB 4CNIB 3LN4A 3TT3L 5CBEA 2X9WA 3RX5A 4OV6F 3RWIA 3MRPA 3IKKA 4M00A 4YX2H 3EDFA 1DZBA 4PJCE 3SE4A 3NZHL 4DKAA 1N7ML 1KIUA 2BVOB 3ECBB 1AKJB 1RIVL 3QJFA 4ZFFA 3GMPA 1PG7L 4G8EB 4D9RE 2F19H 5B39B 2VH5H 2GTWA 5T5FH 3U2SA 2VDQL 4LLWB 2BXYA 5EZOH 1J10A 4NWUL 4U6XB 3TEUA 3MJ9A 4DZBB 1MHEA 4ZG1A 2Y07L 5B4MC 4YDKH 1ZSDA 3CK0L 4HEPG 5DK3A 1MCCA 4ELKA 1NFDE 4MNGE 3H9HA 3FQWB 1PX4A 4JO3L 1BZ7B 4OLYL 1OB1B 1T3FA 1K8DB 4JJHA 3GZKA 1QVOA 3OKLA 3VFSA 2EYSA 2HT3C 2HRPH 3MNZA 1KPRB 3KS0J 3MRJA 1Y0LB 5EC2A 3WJJC 1I1FB 3RUGE 3L5WB 1T1ZA 1KELH 3WKMH 2WBWB 4M61A 1OAQL 4G8GE 4WFFD 3PV6A 3BGMA 1DFBL 4JN1L 4JHWH 1T7VA 5E2TH 5TDOB 5JQ6H 5D70H 1ZHNA 3BIKB 4M8QA 4WHTB 1KEMH 4Z7VE 3UAJD 4XP4H 3QPXH 5L0QC 5LWYL 2OZ4A 1AXSB 1IBGL 3IKCB 3PG2A 2XA3A 4PJCB 4EUPB 1OWRM 4OF5A 1RUQL 5KG9B 3DXAA 2AK4A 4JZOB 4XHJD 4NO2A 1MH5B 3P0GB 5C0EA 1NAKL 1OTTC 2VRAA 4RRPG 2ARWA 3S36H 3L3KB 3PL6C 1OW0C 3PP4H 3ARDA 4GKZA 1DR9A 1MSPA 2DWDA 2B1AL 4ZUSA 1MIEL 4LL9A 3D5OF 4NRZA 4RISL 3WHXB 2H45A 3OAUH 1FL6A 5B3JE 3CX5J 3BRGC 2QLVB 1VKXA 5GRJH 2A6JA 1RZKC 2E9BA 2ICWI 3OG4B 3C2SA 1NFDB 2P8MA 4GAJH 4MNGB 2XN9A 4LKCB 1BWMA 1ZGLM 1ZGLA 3KXFA 5GJSH 5HDLA 3NTCL 2W07A 5EBWB 1ZT4B 3FFCB 3MACL 4X5WB 2F74A 1K3ZA 3MOAH 3VXSA 3TYGH 1A6VL 1HYRC 2OBGA 1HNFA 1YNKL 1MFDH 2VXSL 4KY1H 4U7KA 3I6LD 5E2VH 5EZLA 3MBXH 3P0YL 3NCJL 1DUZB 2JKXA 1HN1A 4JPIA 5IJVB 3DMMC 4G8GB 4MB5A 1VFOA 3MLXL 4LEOA 1A8JH 1C8PA 1T1XA 3KYKL 1J8HD 1X5HA 2R1YB 2XKSA 4ZO8A 3HZKB 1CLOL 2P4AB 2FSEB 4X6BB 4XXDB 5ERWB 4KKNA 1CI5A 3BKJH 2J6EA 5DI8A 3FJTA 3UCRA 1K5NB 4H1LG 2WIMA 3CH8A 1CFVH 1J86A 1C08B 4LVHB 3S4SG 2CLZB 2GYSA 3VXQB 1LDSA 1AI1H 2IANE 1I8KA 3GMQB 2MTPA 4PG9A 2VLRE 1FFPB 4ONHB 1UZ8B 4KQ3H 2IG2H 1F11A 5E2WL 1WZKA 4I5BB 2Q8AL 4U1SA 2PETA 3WFBL 1KC5L 5EOQL 4P46D 3RWCA 1ZTXH 3BUYB 4LSDA 4KXZI 2QR0A 5L9DH 1NGYB 1F4XL 1JFQH 3KPMA 4JDVA 3B3IA 1GHFH 3PQYD 1KLFA 5EO0B 2PYED 1JE6A 3MBED 3PHOA 5DSCA 1A1MB 3DMMD 1PY4A 5BXFA 4ODXB 2NY5C 3K4DA 3UBXI 3EJJX 5MENE 3AU1A 3LKPB 1FH5H 1CLYL 4NP4L 4P5TC 3G5YB 2NX5D 5J0BA 3JVGA 2OSLB 5DTFA 4LMQI 2B4CH 4NBXB 4NC0B 2C1OB 2FH8A 1UM6L 1CDCA 4ZQKB 1QLEH 1IM9A 3OKNA 4PPTA 4FQLH 4XPFL 5E6ZA 1H8SA 1OPGH 4Y1AA 3S3PA 4N8VA 4X7EC 4JY5H 5F1OB 5J1AB 4HQQL 2OM5A 1F6AB 1QBML 1UQSA 1A2YA 4UU9B 3INUH 1JWUA 4DAGL 4LFHD 2P24A 4NJ9H 4U1JA 1BFVL 5ANMA 5FM4A 1MJJB 2HMID 4OCNC 5IG7A 4L8SB 3D2UD 5GS3A 1A14H 1EO8L 4BZ1L 1A7OL 3VXUA 5TGBA 5ESVA 3S96A 1CICB 5D7JB 4FQJL 2VLRB 4FFZL 2CKBA 4Y19A 4LASL 4XBEL 4AQOA 5I19L 5C0FB 1UWXH 3ARGB 5DJCB 1ROWA 1MFBH 4Z6AT 5TF0A 1JYWA 4S11A 1I1AB 3EAKA 2APVA 5F7LB 2AXJA 3X3GH 5JDSB 1Q1JH 3G6JE 4HIIB 5IF0B 3OMZA 3ZL4L 5DJ2B 2AXGB 3RY5A 1PYWA 1U3HD 2AGJL 3VCLB 4NO3B 5IB5B 1WBYB 3RX8A 2CLVA 4DOHE 3T77B 3SKOB 1DE4B 4P2QD 5E8EB 5ISZD 4ORZC 3RKDC 5DUMH 2AQ3A 1EEUA 3SE8L 4OZFB 2E7LC 4C56B 4GSDL 1A64A 4ZOBA 1P53A 4CAGA 3ZO0A 2OCFD 2P8PB 3K8LA 4U7MA 1YMHA 43CAB 3GJFB 3RWEB 4QTIH 3T3PF 4U6VL 3VRLE 3VXPB 1OAYH 3KPSB 4I18A 4Z7QF 1GOHA 3KLHD 4P5KB 3WLWD 2C7UA 2GKIA 3MYZA 2NY3C 1PDKA 5F1IB 1KTDA 1SJEA 4XNUH 1T1YB 1O0VA 2D7PA 4AEEA 2JTDA 2YPLE 4Y2DB 1A4KB 4LSUH 5FDWA 3IJSB 1C7SA 4ZUUA 3D3VE 1YDPA 3LHPL 4G9FB 3WSQL 2QQNH 1ADQH 3JWNC 2XZAH 2DJUA 3VJ6A 1RIUL 4R4ND 3FQNA 1HYSC 4JO4H 2CD0A 1D6EA 2QHRL 1SJXA 4DJMA 4Y5YA 5F7EL 2G5RA 1GIGH 2FECL 2B39A 5I1KL 1FZKB 3T0AA 3GUTB 4OZIF 4UNVA 5EBLB 4NDMA 1BD2D 1A22B 5MP6L 1J05B 5C08A 2FJGB 3PWVA 3G6AA 4O4YL 3VFNA 4UQ3B 4OGAD 1NAML 4IIQA 2GQHA 4YHIB 3EO1B 3QIWA 3ABZA 1EX0A 5J06A 4FN0A 3RPIA 4YHML 4U3XA 1F97A 2Y1VA 3BGFC 4ZFFB 4M43L 3IFLH 1W72H 1HHJA 1LK3L 4ZDHA 2VDPL 4KI5D 4WENB 2YRPA 5IUSA 4PJBF 2FEDC 1MHEB 3UPRB 2Q6WB 1BPVA 1X4XA 2YWZA 1CLCA 3CVHL 3T4YB 5L88H 5IWLA 2QQLL 3D39A 5AAMA 5DR5H 1YECL 5DA0B 3H9HB 5KSUB 1S7XA 3D3VB 1J0JA 1P7HL 1ZV5A 3HAEG 3QWRA 3VGAC 2IPKB 4X6CA 2Y5TA 2UZYB 5I18H 4PV9A 4JPVL 1PAMA 1FG9C 3MNZB 5F71A 3PWJA 1NC2A 4JVWA 2CRZA 5I1LA 1YEIL 1CU4H 1KUMA 1RMFL 3QUMB 4DEPB 3TFKD 1C12B 2FO4A 5KTEL 4KVNL 3PV6B 3STBA 3BGMB 2CXKA 2FX7H 1HK6A 3G5XB 2YRLA 4HT1H 1Z3GH 3QEQD 1CK0H 4C59B 2ZCKH 4WY7H 1SBBA 4LQFL 3WUWB 4A6YB 2ICEA 1CF8H 3QI9B 4TSAL 1NJ9A 1EEYA 5SX5K 5HHOD 3ZT5A 1LHZA 1FPTL 3HE7B 1WEJL 3CLEL 1JHTB 3DOSA 4DVRH 4EN3D 4JDTH 1FRGL 3C6LA 4LCCB 4LSRH 5CJXC 2Z31B 3ARFA 3ARDB 1NEUA 5I0ZA 3RVVD 1JZ7A 2X4TA 2RB8A 5K9JH 2GI7A 3WN5B 3GKWH 1JRHI 1CL7L 3V6OC 1S7SA 5H94A 4X7TA 3HG1A 3BPOB 2BSTB 1ZE3C 1YYMH 1C5DA 4L4TA 5EC1A 1RU9H 4XWOD 3VFTB 5ITFA 4P9HL 4ODWA 1K4CA 1OAXL 3TBSB 2P5EE 4DKFH 3WJLA 3IJYB 1R3IL 3O4LE 1P7QB 3BIBX 5EBMA 3QIUB 2VLJA 2QTEA 4PRDB 4PV8A 3K1KC 4PJ9D 1JYXA 1T0MB 3MUJA 1S9YA 2HFGH 4OCWH 4KTDL 1FIGH 1JTTA 5EZLB 3SCMC 5TH2A 5BS0D 4PB9H 2DLEA 2BNQA 5HGHA 1UZ6F 5M7QA 3JUYA 5I17A 4QT5A 4GRLA 1R0AL 4NQED 3CPLA 4UOW1 4KK5D 1YEJH 3C08L 4B41A 3V4VH 1T1XB 5FF6B 5HVGB 4TTGA 5T5NG 1TJIH 1T7XA 4LIQH 1ZHLB 4LDLB 1G7MB 3O6LH 3RP1A 4BK4A 3BQUB 3EOTH 1G1CA 4LAJH 4AL8L 1HHKA 1MAKA 3OR7A 3RL2A 3EO0A 1B9ZA 4LOUD 4D94A 3P4OA 2EYTB 1A6AA 1J5OH 1A7QH 4X9GA 4OGYH 3RGHA 5HSFA 4EVNA 5D9SB 2VKWA 5HGGS 2EH7H 1S9VA 3NN8B 3LB6C 3U0TB 4OIBA 1S78C 4F8TA 5E08H 5DK0A 2BMKB 4JHBA 2AKRB 1TZGH 2C3VB 3ZTNH 1KTRL 2VLMD 2CKNA 1RI8A 5IB1A 1I3VA 3WIFA 1CGVA 4G6KL 2NY5L 1D6VH 3J7HA 3FB8A 4G42B 2NY2B 2QADB 5CD3A 5F7DB 5KSBE 2HG5A 1KF9B 2B2XH 3IRZA 4P23B 1UXSB 3MJ9H 4GT7A 4OBSA 1A7RH 5ECJE 3TH3T 1WFTA 4D9QE 3VFMA 2OL3A 2VE6A 2O5XH 3MRRA 2FNBA 4MD4A 4CU7A 2DL2A 1VFUA 1B6DA 1RZ8B 3ZMRA 2AV1B 4F58L 4OZGB 3V4UH 3OKNB 5EUKB 4D0BA 1U93B 3JWDH 5FYJU 1OGAA 5C1MB 3HTLX 5EO1A 3OAYK 5CIPA 5T1KB 4WFHE 5SWSD 5HYSA 4C4KT 2J7LA 4LNRB 1DL7H 1W0WB 3ARBD 3V8OA 1HXYA 1QFUH 1UADC 2GTZA 4J12A 3X12A 5D2LE 5F88A 3WL9A 4NQSB 3RTQA 1TCRA 2VN7A 2H1PL 4BK5A 5CGYD 5D93C 2VQ1B 4GS7C 4R0LC 4YQXH 4HWBL 1INDL 2ARJQ 4UINL 3OJDB 4GRWE 5KVGL 4S1DC 5CINH 4P0DA 2HLFC 1Q9LA 4L4VD 2OTUA 2CH8A 1AXIB 3HKFA 1MQKL 3ESVF 3SO5A 2VR5A 3QCTH 3MZGB 5FCUL 2HKHL 1YPZF 1AO7E 4YXLH 3CFEA 5TDNA 2ZUYA 3FB6A 1TDQA 2D3VA 3S37L 2CLVB 4FABL 1FO0B 3TT1L 3LIZH 5HI3D 5DMKB 1YEGH 3RA7L 2HN7A 1CIDA 3AROA 3CXDL 2VC2H 4PJIF 1SM3H 1IC1A 1RUAH 4JZNA 4QXUH 1KSRA 5EIIB 1JWSA 2UZXB 1AP2B 1FLRL 3SDDA 3T65A 2B1HH 3OHXB 4ERSL 2DQGL 4D0DA 1CIUA 4OM0L 5D6CA 4Y4FA 3O8XC 5JO5B 4F7PA 1NEZB 1L7TL 5DD3H 2Q1EA 2VDLH 5FYLL 3TBVA 5D2LB 3QQ4B 2HLFD 5EPMB 1O5DT 2C7UB 3A6CL 1GXEA 5D7IA 2ZZUT 1IC7L 2V5MA 5D6DC 3TBYB 3DUUA 1ACZA 4UTAH 2HFTA 4UT7H 3S5LA 1IGFH 5TJWK 5JXED 1VB9A 4GRWB 1CXHA 3BEWA 1T7YA 1MWAH 5HHXL 3ARZA 5JQHC 1WV7T 3P77B 2XY2A 1QFWL 3P73B 4I3RL 4IOFD 4XAWH 5F9WB 4MQ7A 5K59E 2WM0A 1DBKH 1I9JH 1FL5B 4PS4L 3BXNA 3FO1A 1D5IH 3MRCB 4AMKL 1P4BH 3Q6FB 4OQTA 4WU7B 3RIFF 4RGNB 1NGXB 2JCCB 4GH7B 2LU3A 1MCLA 1MI5D 3B5HA 4XAKE 5C0JA 1AO7B 3LV3B 4PJDA 3AAZA 3O6FD 3WMSA 3DYPA 2DQEL 4FQ2L 4WW2A 3LKSB 4E5XA 5HD8C 3FT2B 1VA9A 3U30C 3PWVB 3O3EA 1CDGA 5J9PA 1RHFA 1B4JL 3VMNA 2EH8L 2X1XR 4WI4A 5A2LH 1LO2L 4PJGF 1EO5A 2DI8A 4ELMA 2C26A 3H8NA 4CBPA 3TVMD 1YJDC 3RPIB 4BELD 4RWYL 5ILTH 3QHZH 1NLDH 2EZ0D 5DJAA 3HRPA 4FFVC 4S10A 5DQ9A 2HVJB 4ZFOL 2Y5EA 4YR6B 2VO5A 1TENA 1RJZA 5CWSA 1IQDB 5D1QA 4BQ9A 3QEGH 5KVFH 1JGLH 4Y4KC 1KJ3H 1T5WB 4AEIH 1EVTC 3TZVD 5B8CA 4QHKJ 4XPAL 1MRCH 3BPNB 3DO3A 3JTTB 3CFCH 4LP5A 4P2RD 1IL1A 3WIHA 3LN9A 4HBCH 4O58H 5J4MA 3D39B 4LGPB 5KVDH 1MRFH 3GMOB 4EOWH 3LRHA 1OP3H 4PGDB 5BRZD 1F8TH 4Z95H 3DRQB 4K71B 4Z7OF 2OMNA 1CZ8L 4JM2C 4HWZB 2PO6C 3DYMA 1XAUA 3U4EA 2DD8L 3GMNB 4LRIC 4TVSa 4WI5A 5TE7H 1OP5K 1U8IB 3QUXB 2E9WA 4NUGH 5EFIA 5JA8B 3SDCC 1CGWA 4Z78A 2CKBH 2D7MA 4V2CB 1Z5LA 4R2GB 3BHBA 5LCVH 1ZHKB 1EMTL 4GKNB 2XV6B 4CVXA 1YEHL 1EZVX 4TTDC 3VH8G 2F54A 5A43C 1S9KC 3FQTA 1EH9A 4JFXA 4LSVL 3VWKA 4FTVD 1EO7A 2NYYD 2ICEB 1JV5B 1GJIA 3PWPA 2C3HA 4ESKA 2YMXL 1ZEAH 1KBGH 1OSZA 1Q72L 3MXVH 2W0FB 3OB0K 1VFBB 2NW2A 4PRPA 5CGTA 1CGUA 3G08A 3C6SB 3MV8D 1JCKA 3E1F1 4OFKA 4FQXA 2CMRH 3SN6N 4HAGA 3SGKC 3WXVH 3WYRA 5CJBA 4F7EA 1ZLVK 4H1LH 3ZHLA 5F6IC 1S7SB 5H94B 4J7RA 3BJLA 1CFSB 4PIRF 5T1MB 2G2RB 1BFOA 4XBPA 2WQRA 5CJOH 4HGWA 4J1UA 2VDNL 4LVOB 2FGZA 2AABH 4PGBB 4DK6A 4GXUN 3UTOA 3LQMA 2YPVL 2DOCA 1K4CB 3O11A 4LRNL 2IQ9H 2VOTA 6CGTA 3WO3B 4E0RB 4DUVA 4WV1A 4GAYA 5EBMB 2JJTA 4WEBL 4PV8B 2XTJD 1G7PB 1ZWIB 4ONGH 3HI6L 5KZCD 4K7PH 3VGEA 4G7VL 1OSPH 1G9NC 1QRNA 3RVWC 3CPLB 2FD6L 2IH1A 1F42A 4JFPB 4K8RC 1HSAB 3GMMA 1E4KC 4POZC 2E9IA 2EDEA 4LLDB 1WQVT 1EXUB 4QHLB 1LNUB 4JANA 2KUTA 3EDJA 3P11H 3ZYJA 1Z9SA 2AK1H 2YSSA 2G5BB 3NCYP 5IK3A 4KRLB 1QNZL 1VADB 3CFDB 1S9XA 3OR7B 1UYWH 4Y5VC 1CTNA 1BMGA 4TSBH 1GVIA 1AKJD 1GC1H 1B90A 3NCFB 4P4RB 1I9IL 4GBXA 3DSFH 4EVNB 4KKCD 3SY0B 1TJGL 3VFRA 5F1NA 4R97B 3UTTB 1BIIB 4G5ZL 4O00A 4K94H 3N50A 3SHSA 5FO7A 1AR2A 2AV7A 3MUGB 5GZND 3G04B 4UBDD 4XCNA 1YNTB 3NA9H 4PJFF 3TNMB 2YWYA 2HG5B 1T66C 4PJEA 4JPWH 4DQOH 4HIJA 1GAFL 4JZJA 1IM3A 3K8MA 4R7NB 4POZD 4JEGB 2VZVA 3R4DA 3LS4H 4P3CH 1OF2A 1HSBB 1MCDA 2AXHA 5L7XL 5CSBA 4PP1D 3QULB 3B8YA 4PRNA 5FM5M 1DQDL 3AREB 1G6RL 5IGXL 3GIVB 1DQTA 4LCWE 1MAJA 3RWDA 3V5KA 1UACH 1BBJA 3MLRL 4MJ5A 3ULUF 3QUZC 3B9KC 3X12B 4MA8H 5F88B 1G7QA 3IGAA 5EOTB 1FV1A 3QH3A 1D9KB 3RTQB 3U6RB 2EDFA 1BF2A 2J8UF 1TCRB 4EDXA 4IRJA 3MRKA 3CFKA 4D9RD 2LVEA 5KANG 5KJRL 5IKCA 3F7VB 1BEYL 4GG6E 5F96L 1ZVSA 2A83B 1NBYB 2WBJC 1J12A 1SVZA 2BSRB 1KOAA 5IW1B 4U2YA 2Q8BH 3IAGC 3BH9B 4DTGL 5E8DL 1HOCA 3FFCD 3TIDA 1NPUA 1QA9A 2Z35A 3OZ9L 5DMJB 4OUOA 3RWGA 4LLAA 3D0VA 2Y72A 4P2OB 2AJSH 3L1OL 4RMWA 1MAML 3MV7B 1HNGA 4CMHC 4IM8A 3VD5A 4QRPE 4G8GD 2XPGB 3CVIL 3HC0B 4M7LH 3U48A 1R5VA 4RIRA 1D5MA 3GSNL 4LPWA 1PY9A 1WISA 4V1DA 3AVEA 3P0VL 2PNDA 4H8WC 2VUYA 3MRIB 1NMBL 5E0QA 4H5SA 3SDXF 5FB8B 2X4NA 4XCFH 4XWGH 1DBMH 2GFBA 1E6JH 2FIKB 3ZSSA 2I60L 3S5LB 2DICA 1F4HA 3ZE0E 3U36A 4R3SA 1YEDA 5FV1L 4GG6B 1Q0XH 3LEYL 4KI5F 4EEEA 3FO1B 4OLVH 4OFYA 1F3DH 3LDBC 5I66A 3C9NA 2XKNB 3FRUA 4J3VA 5JIPA 3W9EB 5K9KB 1CXFA 2ZSWA 3K46A 4UIMB 2OS7A 3ARGC 3CJJA 4XP5L 3SKMA 4UV4H 3T2OA 4X6DF 4L8DA 3RIAF 4RX4D 5AZEH 1RZKH 3VE0A 2P7TA 4PR5A 2ZNXA 4N5ED 5DD6B 4GRMA 5HYJE 2Y6SC 3MC0A 1M7XA 2BY3A 4G6ML 3C60B 4ZNEE 4OZIA 3IETB 3HFML 3C8DA 4JGUA 3BPCA 4QRPB 1P1ZA 4NZUH 4C4KO 2ZUVA 1FNSH 3T0VA 1YJDL 4NM4H 5FKAA 4CADB 4EQ3A 3WXWL 1QLRB 5DZLA 1UWGL 4NZRL 3T4AA 1NSNL 5KAQG 2OL3H 3GGWA 5DJAB 1I1YA 5DQ9B 3QNZB 3TO4C 5KSAC 4NN5B 3UZQA 1IGJB 4WWID 5GGUA 5F93C 4LU5L 1DEDA 2C3GA 3MFFA 3UP1A 2BY2A 2FYYB 4GW4B 4HIEA 3HUJE 1CICD 5D7JD 5B8CB 2IGFH 2VLRD 5T3XH 3GO1L 1JZ8A 1DUYB 1IL1B 3DGGA 4YZFE 2EXYD 3ARGD 2WINA 3ZT7A 1X4ZA 1I1AD 2HJLB 1J1OH 1LK2A 2NCMA 3MRHA 3KWWB 3LQZB 3RVXD 2Y6SD 4U0RB 1BOGA 5T3ZH 4JLRA 4F37F 3K81A 3Q6GL 4QOKB 2DMBA 2EDJA 3I75B 5I75B 4JRYE 4M7KL 4CJ1A 1EZVY 2FL5B 5DLML 4HJ0C 2CQVA 2VXQH 1Z5LB 3RWHB 2W91A 1T1WA 3NCEB 5DJ8A 3B83A 3HC4L 2R0KH 3LZFH 4JKLA 5I1GH 3MV9E 3DHJA 2FLRT 4Y16C 1PD6A 3BUTA 1M4KA 4JFXB 1QO3A 3P9WB 3MLVH 1IGIH 2AJZA 4C56D 3PGFL 4ZS7L 3B2UC 2R56H 3DYOA 1A6PA 3H7BB 4JQVA 1CT8A 3LKNA 1DVFB 3PWPB 4DKEH 4QKXB 3EGSB 3QFJA 1J11A 5ACLA 1TZHA 1SEBA 4ZO9A 2ESVE 5HDOA 1RK0B 3B6SA 3E2HC 2CK0L 3KPSD 3NZ8A 3G08B 4UQ2B 3EYQC 3L7EA 5J8OA 3IYLW 4XVJH 1OQXA 2EIZB 4HCRL 5C0CA 4Z7UF 3MROA 3ZDYE 2CDFA 4UIKH 4YWGH 1TFHA 4HFUH 2V2TA 2X4SB 2XNAB 5LGKA 1HQRB 1BVKB 1N6QH 3HPLA 3DV4B 4G80A 4KI1A 4HGWB 4J1UB 4KQ4H 4PJ8A 1MREH 1FC1A 4Y2DD 1DQLL 1H0DA 2YPKA 1QYGH 3D85A 3IDMA 3I50H 1CVRA 5DC4B 4G9FD 4FQCL 2EO1A 3FOMB 4DW2L 1NCAL 3FTGB 4KDTA 4TULH 3VD4A 1F3JB 2DMCA 3ULVH 3WE6B 1G9NL 3B2VH 1K6QH 4AEHH 3QXAB 2W1NA 1MLCB 4DN3H 4QEGA 4K8RL 4XPGH 3GNMH 1F90H 2H32A 4D0CA 5HDBE 3MV9B 5CMAA 3PXJA 4UILL 1QSFE 3AS2A 2CUMA 1FYTE 4L3EA 3KLSA 1KCSL 4JANB 1KJ2H 2GY7B 2NY4C 2YSSB 3OB0H 4NGHH 2CDEA 4JN2A 1KULA 4H26B 1DN2A 1RZJH 3GB7B 3WFCH 3QDJA 1BQHA 2NTSP 3HI5H 1XIWA 4M5YL 3QZWG 2ESVB 1QBLL 2P5WE 1I3GL 1XZ0A 2G9HA 1NKRA 2F5BH 2EKJA 1P2CA 3BN3B 4JKPL 4PJ7A 5CUSH 4HLZH 5EU4B 1OOAA 2BFVH 5JUEH 1I8LA 5E99H 2X4QB 2F53E 4XH2B 1KB5B 4JKMA 3VFRB 1WT5A 1EFXA 3S8WA 7FABH 5ACZB 3HZMB 5FO9A 4S1SH 5EWIH 1UM5L 4FG6D 5CLWA 3BP7A 4YNYB 4WI2A 1VPOL 4GKSB 4NFCA 1M05B 2OR9L 1AHWA 5GISH 5DWUH 3FZUC 1HEZB 3LKOB 4MD5A 3D3VD 5IMMA 4PRBB 5I6XC 4XMKL 1IEHA 3F6IA 3TA3A 1UWEL 3O2DL 5FA4B 4P4KC 4I0KA 3VXMA 5C86A 4Q9QL 1IGCH 3KYMA 1T03L 5IW3A 4BSWA 1OF2B 5T33L 2J88L 2R1WB 4IRSB 4X8JA 3P30H 1AIFA 3LOWA 4KHXL 2CGRL 3GSOA 5LAXB 3GDBA 3MLUH 4WWKB 2BNRA 4G8FA 1RZ7L 5ABDE 1QSFB 1FYTB 3CC5A 1S5IH 4PGEB 3TWCH 1CDHA 1OTSD 3QI9D 4UT9L 2VISB 1G7QB 2G60L 4XMLH 3F65A 4MWFA 3D1MC 3QH3B 3HE7D 4QCIA 3RI5F 3SE9L 2R2EB 4EDXB 1OCWL 3CFKB 3L5XH 2P5WB 4HUWB 4AG4H 2HT2C 2VL5A 2H6PA 1SHMA 2H26A 2Z31D 1KXQE 3CX2A 5GGSA 2FJHA 2EDQA 3ARDD 2DBLH 5E6IB 4K23L 3X11B 5IKCB 1VGEL 1DDHB 5H35A 2BOBA 1MJ7H 3OXRA 3KLAB 2Y7QA 3U1SL 3MRBA 4APQA 5I1JL 3VW3H 3K2MC 4Z76A 3SO3C 1DSFL 5C09E 5IVXE 1BVLA 3C5ZA 4WCYH 2AXFA 5ADOH 1WWCA 5CP7B 2R23A 3P9MA 3RX7A 5D7SL 1FORH 3MJ7A 3MTRA 1P7QD 4OCSH 2FATL 3AB0B 4CVZB 2X2YA 2D2OA 4YGVA 1ED3A 2YD4A 1AGFB 3AXLB 3QIUD 4GO6B 2Z35B 4OI9A 4HLJA 3RWGB 1RUPH 5E94B 2IJ0C 4XX1G 2IPTL 1YPZA 1FZOA 5E4IA 3QJHA 1S7TB 4G6AD 1TVBA 2DTSA 2ZP0T 1T21B 5KS9F 3ZE1E 3VFOA 2HH0H 1VENA 4HUNB 3OWEA 4P23C 4PRHE 2HAZA 1N0LA 3CXHK 4XBGA 1IZJA 2MWCA 5F3HA 4OD2B 2VXVL 3VRJA 4IMKC 4V1DB 3BQUD 4H8WL 2R8SH 3U7YL 1I3RA 3WO4B 4JRWA 5DK2A 4LLMB 4OKVA 3VXRA 3OPZL 4Z0XA 4YHYC 4MAYC 2AERT 1FP5A 4MHHG 3O6ML 4UOW0 4KZDH 4M6NH 3HZVA 5DYOA 2R29L 4W4NA 2EDBA 2WLYA 2PF6A 2ZUTA 1UB5B 1R24A 3QUYC 2IFFL 4DVBA 4OT1L 3BP5A 3U46A 3DROA 3QR2A 4R3SB 5D71L 3DJ9A 3EDKA 4HJGB 2DAVA 3TO2B 2YR3A 4YGAB 5I8EA 5FGCB 1BAFL 2ZSVA 3W9DA 5C09B 3WS6C 3VD7A 3RU8H 2VABA 4FQ1L 2NY2D 3SGDH 4CN4A 5A40E 4JFYA 1A5FH 5DFVC 4P23D 3RVTC 4L8DB 4F57L 5IQ7L 2NR6D 3PV7A 4OSUH 4HUUB 1S3KH 2XZZA 3MYJA 3X3FL 2P48B 3H9SE 3QIBC 4M7JH 4I0PC 4I0CC 2VITB 4YDJA 3IDXH 4OB5H 3IFNH 3VGFA 2A73B 1A7NH 4PRHB 1VGKB 5T1KD 4F7CB 2YKLH 3BP4A 4JY4B 2PR4H 5GS1A 4OF6A 3T4AB 4LHUB 4PJGA 4KRPC 3PUCA 1I1YB 4HWEL 3EYVB 4V2BA 1E4WL 2QBWA 4X0KA 1YN7A 4ORGA 4M3JA 1ACYH 1QFPA 5DMIL 1CFNA 2APBA 1EUUA 4Y89A 3GMRA 4NWTH 4Y8DC 1UJ3B 2WUCH 5IBUB 1RUML 3DGGB 5GSRA 4R26H 5D1ZC 4XVUC 2I9TB 5EU7C 5JORB 2X1PA 3MRFA 4JHAL 1E6OH 3S88H 1P7KB 1AGBB 3CD4A 2R1XA 2NY0B 3MLZL 3PP3K 4JLRB 2FZ3B 2CIKA 1F3RB 2UZIH 1A3RH 2E6QA 2DKUA 3CXHJ 5D1XC 1IQWL 4MB4A 2X7LA 3V0WH 3L3HA 4LFHG 1IAOB 2H2PC 2CUHA 1JNHB 3FT3A 5C2BL 3E6FB 1D5ZA 1I7TA 1MIML 1A3LL 5C70A 3VFGL 4GLRH 5JOEA 3STLA 4GW5A 4UI2A 2XQBL 3DX7A 4XC3H 3WJJA 2LTQC 4JFEE 4L9LA 5HGBB 3BRFA 4J3UA 4H25A 1OAUH 3WFEL 3LKNB 1G0XA 3ZHKA 4WFHD 2IALB 4OZHA 3TIEA 1UCBL 3SJVB 1NL0L 4H0IA 4YXHH 5IHBA 1KCRL 3QFJB 4ODUA 3RNKA 1T22B 1CDUA 2VDRH 5SV4A 4RAUA 5A2FA 4F7MA 4OCYH 5F3BA 5ALCL 5D7KD 4XMPH 2A0LC 1ORSB 1QHPA 2QJDA 4XVUD 1HKLH 3DNKA 3UTZA 4OFDA 4HULB 2ZG1A 4EI5B 3MROB 3CMGA 1JP5A 3RIFK 2L7UA 5DXWA 4JRXE 1LO3H 3TBTA 1IT9L 1NBZA 4XI5C 1I1CA 3VI4F 4PLKD 1H9VA 1MWAB 2AI0L 1J1XH 4G80B 5CSZA 3SBWA 5IIEA 2JB6B 1J8HA 5ANME 4QYOA 3ZKND 1OW0A 4PGJA 3D85B 4OLEA 2HJKB 1G7HA 1CDJA 5JHLL 2FBOJ 1FZJB 4U1LB 5MEPB 4LCUB 2FH6A 1TCMA 3EOAB 4WO4B 4KV5F 4AM0B 2D7OA 1J1PL 5DVNA 1KN2H 4RGND 25C8H 4UB0H 5IMKA 1AO7D 3LEXB 4RAHA 2APXA 3TYFB 3NFSL 4WI8A 5D96B 4L3AA 2XOTA 1UM4L 1T89C 4R7DB 2ITDA 3AM8A 1XT5A 3MRLB 2V17H 3C5SA 1F4YH 4HMCA 4P46A 5IROC 1X5LA 4UDUB 2I5YL 4Y5XC 1PQZA 1R5IA 3KPPB 4JFEB 3PQYA 1HHIA 5TFSL 2E6PA 2PYEA 3MBEA 3DMMA 1IAIL 1XGYL 1BX2B 3QDJB 5HHPA 2NZ9D 2WAHA 1XIWB 4QHUA 1I9RL 1JJUA 1XZ0B 2NX5A 4PJ7B 3MREA 4EQ2A 5FYJD 3GI8L 3NACL 1KGCE 4X83A 5I76B 4JRXB 43C9B 4HFWB 3UJIH 1A7PH 1WZ1H 3BN9C 3S35X 4NQDA 1EGJA 4QWWC 1HI6B 5DEFA 1V3MA 1S7QA 4PJCF 4QRUA 3SKNA 1Y6NR 5BV7H 3D39D 3IT8D 4YBQC 1NCBH 3QYCA 2NY1B 2Z4QB 3FCTA 1H3WM 2ZCHL 5IBTH 5GSVB 5IMMB 1LE5A 1C5CL 1R3JB 4U1HA 5AYUH 1OARL 3I2CL 4KJPC 5FHBH 3D2UA 4NJAH 4Q6IA 5IB4A 5J12C 3QCVH 3TA3B 3TT3H 3BX7C 4DGIL 5I73C 3B5GA 2AEPH 3MPCA 2W92A 4TSCL 2L7JA 3QUXD 4ZD3H 4NN6B 1XF3A 1AIFB 5MI0B 3GI9L 4R2GD 2PN5A 3QA3A 4WUKL 5E24E 5D5MA 4EBQL 2VXUH 4KRNA 5DVOA 3GKZA 4ETQB 3TF7C 3DARA 5FAAA 4JVUA 5AEAA 3VU2A 5IQ9B 2ZCLH 1YQVL 1KCUH 5FGBC 3CMOH 2FHBA 3CK0H 3D25A 1BZ9A 2YK1H 4KAQH 4PLOB 2XWBA 4FFWC 4WHYG 4MWFB 3FOLA 4HUVB 1L7IH 4OLXL 3UBXG 3A6OA 4AYFA 4QWWD 3MA7A 4RZCA 2IBZX 4P2QA 3CCHB 5EU5B 2VL5B 4JO3H 5GGSB 2J2ZA 1RV6X 2I9LA 5GRVL 3DECA 2DWEA 1RIHH 2P49B 3K2UH 1IRAY 2I26N 5EO9B 2UUDK 4XT1C 3S4SB 4WJ5A 3SKJH 2JK5B 4HG4K 5A1AA 2CRIA 5LBSH 1HQ4B 4QGTA 3V8CA 3IFOB 2QSTA 3C2AL 1HDMA 5I1DB 2EIDA 4BQ6A 1IGYB 5AYQA 4WU5A 3EJYD 3EZ8A 1WCQA 4NUJA 1YC7A 1XGRB 1JGVH 1BQSA 3MJ7B 4HWBA 3AY4C 4YGVB 5FK9A 1F13A 4UTBL 3ZDZE 5BZWB 1GGIH 4PUBL 5D2NC 3BO8B 4BFIB 1N59A 3QO0B 3WLBA 5CBAA 4KTEL 3CSPA 4KMLB 2EC9U 2OP4L 5F9AC 3PABA 4G3YL 1U2CA 3BFOA 4DN4H 1DP0A 3VG0H 1KIQA 4KC3B 1U36A 3VRJB 4Q9RH 3AC0A 1BFSA 3M8OL 3T0EE 5C0BE 4PB0L 3BE1L 5D4QA 3VXRB 2K7QA 1YZZA 4Z0XB 2D31A 3NIDE 1PVHA 2H32H 1BD2A 3HN3A 4ZUVB 1L6XA 4KJWC 2GAZB 3MCKB 3SQOH 1AGDB 5EBGA 1MFEL 1R24B 1QQDA 3OKEB 1NGPH 2IAMB 5DHVB 2Z9TA 4KK9D 2QKIA 3MO1A 3UTTD 3BSZL 4NKIL 1XCTB 2DM4A 4PJXB 5MHSE 1JVKA 3VXOB 3BYYA 3X14A 5HGAA 5EN2A 3W9DB 2W60B 3UTPD 3MFGB 1ERNA 4UAOC 1CYGA 1DQJB 1N0XH 1XGTB 2VZ3A 3DVIA 4LSTL 4OFPA 3SDAC 3HG1E 2WUBL 1W8NA 3O9WB 3KJ4C 5C0IA 3F7QA 4GQ9H 4IMLB 2EDYA 4U1KA 5DDHA 4M48L 3TCLA 3ILPB 3ARED 4NBZB 1U8NA 3CUPA 4YDVA 1ETZA 5GHWL 2YA0A 2R9HC 2FJFB 4ZFZA 1Q9KA 3CZFB 1LEKB 2MNUA 4KJWD 3SGJC 3QO1B 4YXKH 2HYMA 4H88H 5C92A 3T0EB 2BY1A 5C0BB 1AD9A 2H9GB 1QEWB 4XVTL 3RNQA 3REWA 1D9KD 1YNLL 3VWJB 3MNVB 3W2DH 1NAMB 4KUZH 2GJZB 3QXVA 4YUEL 4HIXH 3EO9L 4HS8H 2PCPA 1WITA 3ILQD 4C83A 1CLYH 3UO1H 4F7TA 5I0DA 3CDFA 3PGDB 4U1MB 2YA2A 1FYHB 4R4BB 3N9GH 1AH1A 5HHOA 5FYKH 2HT4C 2W0PA 3DUSB 2P43B 4EN3A 5JTWA 3OKDA 3B9EA 2GJ6E 1TQCC 1BM3H 2X4OA 4HS6A 1MJUH 2FB4H 3CVHB 2X7LB 1GGYA 1MUJA 1WAAE 2ZG2A 4NQXB 5CCKL 2VSDA 5HPOA 4P2OD 1I7TB 2R4RL 1RULH 3MV7D 4YHNA 4M6MH 3DX6A 1UA6L 4GW5B 2SEBB 5TE6H 3E6HB 5F8RC 3VD9A 2WMPA 4JFZL 3EYOB 4XP9L 4OIIL 4H25B 5F6HJ 1HE7A 1AFVL 2B4CC 4JJ5B 4O5LH 3O41A 1X7QA 3EFFB 1TZIB 3V5DA 4PJ9A 2R0WL 3G6DL 1KPVA 1AY1L 2DYPB 4BZ2H 5C0RH 4JREC 5BS0A 1ZHBA 5L0QB 1DLFH 3UTZB 1Y18B 3KYNA 5I16A 1LO5B 5BVPL 4N1EA 4U3HA 4NQEA 4ODTL 1LQSR 1JNNH 3TBTB 1WIOA 4OLUL 4YE4H 1I85C 3THML 5DJ6B 1U2HA 1S9WA 4Z7UA 3PL6B 1MVFA 3GSQB 5DD5H 3WV0A 3CFIC 3JV6B 4NN5C 1UB6B 3ARRA 1YEFH 1NLBL 5MEQA 1S7RA 1RSFA 2EKSA 1AQDA 3BEVA 5B38A 1YMMA 4GSDH 5BMFH 2XQYG 3V6ZB 4I2XB 4MCYA 1VEMA 2GJ6B 3EDEA 4TNWK 2QSCH 3HAEB 1YN6A 4HUXB 1L0XA 3DETC 1UGNA 3EJZC 2ED7A 1I1RA 3BKMH 5BCAA 2VNCA 1R3KA 5I1EL 4RGMC 3OG6B 2BSED 3C60D 5GGTL 2HVKA 3UTQB 5GS0D 3P4NA 2VL4A 5BVJA 3FQUB 4QRPD 5DRXB 4ZXBC 1T83C 1R5IB 5EA0H 5TPWH 4RA0C 5IFAL 1BREA 4HSQA 1C5BH 3VFVB 1C16A 3DMMB 4NKQB 2O61A 1LP9B 1PKOA 3MJ8B 2ICWJ 2L0DA 4OLWL 1U3JA 4JDZA 1JMZA 1MJ8L 1U3ZA 3P9LA 4KHTL 5C0GB 4B7LA 1IC4L 4ZUTB 4BH8A 3QNYB 1CLZH 5ESQB 4XTRD 4L1DA 1HIMH 4KJYA 4OTXH 5B3NA 3EYSH 1B88A 7CGTA 3HC3H 1E4XL 2DQHH 5IVNA 4AIZB 4NQDB 5SWSA 1RVFL 1KYOJ 1AE6H 4S2SA 2F58H 3WS3B 3MLSH 1IGML 3ARBA 5BJTB 4XXCA 4GXVH 5F7UA 3ULVE 4NPYA 3D2UB 3R1GL 4GLRI 1YY8B 1U58B 3HRZA 1AGEB 1JGEB 2EDTA 4QOKD 4OGZA 3N85L 2I27N 4L29A 2YN3A 4N9GB 2R2HA 4YHKL 5ETUA 3NH7H 4HJJH 5FUZH 4CMMB 4Q0XL 2NNAA 2YEZB 2DQUL 2X44D 4P5TB 1L0YA 4L4VA 3S34H 1T0PB 5FUOL 2CLRA 3LVEA 4RA3A 4K9EH 4FZ8L 1PX3A 4NKDA 5IESH 4PTTA 2IBZY 4PJDE 1DVFD 2QQKH 3PWPD 4Y4HC 3D25B 2FGWL 4XP6L 1TNNA 3TPKA 5GZOC 5IB2A 3FOLB 1QD0A 3HNSH 2WIIA 1WLHA 5C2UB 1U91A 4QY8A 3QWOB 3EUUA 4YX2L 5H2BB 1A6WH 4QHNA 2WWKT 4NKOA 1RZFH 3VG9C 2FRGP 1A9EA 2QHLA 5JPNB 2WZPD 1IGTB 2OQJB 5FDYA 1XGPA 4MX7A 2F19L 2KZ1B 2VH5L 4W81A 4WJ5B 3K74B 1T2QH 4NC1C 3OKKA 2BSSB 1FGVH 5E8OB 5I74C 5HI5D 3BP6B 4YDKL 1U8MA 2HRLA 3QDGE 3OKMA 2KPNA 4UUJA 5DMGC 3MNWA 1INEH 1P4IH 3IDNA 5FK9B 3UDWA 1ZA6A 1EHLH 1S7VA 4PRIE 1AJ7H 4HH9B 3BZEA 4J8RA 2JJUA 1N59B 4EJ1C 5IHZB 2HRPL 3WLBB 5JXEA 1CFQA 1YUHB 3OGCB 3CFJA 4NSKA 3MV9D 1KELL 1RFDH 2RFXA 1KIQB 2XA8H 5IT2H 2H8PB 1SQ2N 2VZUA 4G8IA 5F89B 1WBXA 3TJHD 12E8H 3DX9B 5BQ7B 4JHWL 5GRZA 3RDTC 5JQ6L 1OLZA 5D70L 1N5YH 1KEML 1MI5A 1NFIA 4XP4L 3QPXL 2ESVD 4N0UE 5D8JH 4OZGF 1C7TA 3O6FA 3NBNA 3L9RB 1P4LA 3ES6A 5AUMB 3BWAB 3GSNA 3D9AH 1HINH 3GBNH 1EHNA 2FX8H 1K2DA 1U42A 4MNHA 4PP2A 4ALAL 4X7SH 1JHLH 1FNEA 3BVNB 1H3PH 4NZJA 3S36L 1EAPB 1GGTA 5DJYA 1MLBB 1ND0A 3PP4L 4C55A 4P9MH 1MHCA 1GCFA 5A16A 1XCQB 2NY3B 4Q2ZA 1UC6A 4OV5B 3TVMA 1SVCP 4PRPE 3QDGB 1WC7B 3I85A 3OAUL 1JK8B 3HMXH 3BD3A 4FQQB 1WBZA 5GRJL 3N1PC 4JQIH 1UH4A 1EAJA 2WW8A 4GAJL 2V9QA 2BNUB 2IADA 4YBLC 1D5XA 5GJSL 4PRIB 5JPMA 3WFHA 5CKAA 4TRPH 4IRSD 3TZVA 1EGJH 3MOAL 1L0QA 4GW1A 3TYGL 4UDTA 1QLFA 3LD8C 4KY1L 1MFDL 4JFFE 3MBXL 1K4DA 4WWKD 4MJ6B 4LP4A 1QSFD 3MR9B 5C0ND 1FYTD 5BRZA 3DO7A 4O51A 4I48A 3NMEA 1IAMA 4L5FH 15C8H 1ORQA 4LCYA 1G9MC 1QRNE 4YHOH 4HXAH 2P47B 3REVA 1JN6A 3FFDA 3F5WA 3PDGA 3BKJL 1FG2A 2P5WD 4JQXA 3HE6B 1NDGA 5IJKA 5DJDA 3PHQA 3V5HA 1CFVL 3BGFB 2W9EH 5E6ID 3U0WH 2PCPB 1CG9A 5HGDA 3GSWA 4MQXD 3L3JA 2C4FT 3TBWA 4FTVA 1AI1L 2WBKA 5CHNA 1XF4A 4ZFOB 2IG2L 3BZ4B 2GK2A 2R2CA 3SDYL 1MCFA 4YC2B 4F58H 1KPUB 1BOYA 3ULUH 2EYRB 3AMKA 5E70A 5DHYB 4WI6A 2CPCA 1HILA 1ZTXL 3QHTC 4L3CA 1YC8A 5F7FA 5L9DL 4XCEA 1ES0B 3MV8A 1OAZH 1GHFL 4HAFA 3SE4C 2Q76A 2ARJA 3WEXB 5DMYA 1UKTA 3VGAB 3MRMA 4K3GA 2YUVA 4EUPG 1FH5L 2PTVA 1A6TB 2PO6A 2E8ZA 2IQAA 4LLYB 1PG7W 3PJSB 4OI8A 3Q3GA 5IOPA 4ZS6C 3STZA 1UXWB 5F7NC 4JFFB 2ATPB 2B4CL 2JCCF 4TNVK 1QLEL 4YEFA 1KTKE 1A1NA 2EEDA 4ZYKB 4V1DD 4W6XB 2RCSL 3DSNA 1L6ZA 2ADFH 3JWDC 2I07B 4JY5L 1R5WB 1I7ZA 2A6KB 1KV3A 3INUL 2F8XC 4ENEC 1ZHBB 4DUXA 3KYNB 1YEKL 4NJ9L 5DRZA 1CE6B 2X1OA 2ZKHH 2Z92A 3NIFF 3VXTB 3VDAA 3HR5B 1A14L 3TPUB 1KJVA 4EDWH 1GZQA 3FO2B 5JOFB 2LQRA 2E7MA 4E41E 5B22A 5ICXA 4CNIA 4MNQE 4YHLH 3HHRB 4S1RH 1MFBL 5C09D 3BEVB 1YMMB 3ECBA 1A4JA 1AKJA 4ZS6D 4G8EA 3UJTH 3X3GL 5B39A 1Q1JL 2D7NA 4LLWA 4TQEH 4ERSH 4YHZH 3CLFH 2B0SH 4U6XA 1SMOA 4N5UA 4DZBA 2XIDA 4JM4H 4OKDA 4PRAB 1P84K 1P9MA 1FAKT 3GM0A 1CE1H 2ZJSH 4LAQH 5K59F 3JV5A 2W38A 3SCMB 4X6CF 4LSPH 1R6VA 4Z18A 1JI2A 3VH8B 3FQWA 4PRHD 5DUML 1BZ7A 3GMLB 1OB1A 4U7SA 5L2KB 1O7VA 3HI1B 1EJOH 4N0FA 4E42B 1K8DA 1E4KA 4DGYH 5I9QC 3S6CA 4LHUD 3D69B 3DI3B 4KXZH 1KPRA 1VFAB 3H2WA 4X4ME 1Y0LA 1I1FA 5DVLA 3L5WA 4Y0GA 9CGTA 3DVNB 4KJYB 3CDCA 4KGLA 1OHQA 2N7AA 3I3BA 4OFVA 2NXYB 4WHTA 3BIKA 1FVDB 1I7UB 2QSVA 1TTUA 5F7KC 1A02N 2BVTA 2DQEH 4MNQB 4XNUL 4MXVE 2DQCH 3EOYG 1AXSA 3QAZC 2PW1B 3IKCA 4LSQH 2NY0D 4LSUL 1Q0YH 1WTGT 4NPYB 4PJCA 4EUPA 3QCUH 5KG9A 4Z7QE 1QP1A 4M03A 4JZOA 4YK4C 5KSVB 1MH5A 4PJ5E 2QQNL 1ADQL 1AC0A 1BGXH 3L3KA 2JJWA 1GPOH 1QSEE 4AIXA 5F44A 4ZFGH 5TF1H 4JO4L 3V7AG 2Y06H 1GIGL 3WHXA 3OSKA 5I71C 1EUTA 4M02A 3W11C 3BDBA 3N1GC 4EXKA 1PG7X 4MZ2A 1NFDA 1N8ZB 4MNGA 4NKDB 2DB8A 2PW2B 4PTTB 4LKCA 4S0SD 3V0VB 4N0CD 2ADJB 1HHHB 3SJVD 2BOCB 5EBWA 1ZT4A 4EI6B 3FFCA 4X5WA 5H8DA 3LCYA 2X4PB 4LARH 4HK3N 1G6RB 4FNLL 1MCEA 4NQTA 3PWNA 1A9EB 3PE9A 1DUZA 3RUGA 3B43A 4F15C 2BJMH 5IJVA 3IFLL 5CJQH 4EI5D 1W72L 4G8GA 5A3IC 3JVGC 2MOVA 5DFTA 1FJ1B 2COQA 2ADGB 1TPXC 4Z7VA 2R1YA 1KB5L 4JGJA 5D93B 2R0ZH 2D03H 3D85D 4GS7B 4R0LB 3HZKA 2FSEA 1P84J 1II4E 2ZUUA 1CXIA 4X6BA 4XXDA 5L88L 1NC4B 1DJSA 2NXZC 4N0YH 4WO4D 1K5NA 2GITB 5DR5L 5C9JB 3ROOB 3S9DB 2WBJA 1C08A 3P3YA 3D18B 4PJ5B 5T1LA 5L6YH 4PJBE 3RWFB 2DLFH 2CLZA 3BZEB 2OK0H 1NFKA 1QSEB 5F72S 1FFPA 4ONHA 1UZ8A 4LF3B 3D87B 5DEGB 5J6HA 1EEZB 1KFAH 1MHPL 1CU4L 4I5BA 3K7UA 3UTSB 2YD6A 4O02H 1CBVH 4YFDB 2RFXB 3BUYA 3KR3H 3VD3A 1MOEA 5FKPB 2IF7A 2HLAA 1NGYA 5CP3A 2FX7L 1WBXB 4MLIA 2ZPKH 4JFED 4HT1L 5IVZA 5EO0A 4JG1H 1Z3GL 1A1MA 1CK0L 1HCFX 1NFIB 2ZCKL 5SWQA 4ODXA 4WY7L 4IBLT 4FP8H 4X99B 2VDNH 4PJHE 3T0XA 4Q9BA 1XIWD 4XCYB 1WF5A 3LKPA 2BVYA 4RX4A 1CF8L 1X5FA 1P4LB 3MZTA 3G5YA 2OSLA 3GSNB 3HCVB 4GAGH 4DVRL 3O8XB 4W6WB 2C1OA 4JDTL 3RVUD 4LHJB 4ZQKA 1FE8H 4LSRL 1ND0B 4JRXD 2KQMA 5K9JL 2DN7A 2PTUA 4WW1B 1J0YA 3GKWL 4L8CA 5J1AA 2M1KA 4UU9A 3A6BH 1N26A 4ZPVB 1WWAX 3IFPA 1YYML 2NY1D 5C7XH 4IDJH 1MJJA 1BFTA 3WUZA 1HH6B 1RU9L 1DBJH 2UVEA 3T0WA 3TA3D 4L8SA 4X6EB 3K80A 2D7QA 4DKFL 2HP4A 4OJFH 4KMQA 4JPKH 4PJBB 4JFQB 4LCIH 1CICA 5D7JA 3RRQA 1F58H 4I18C 3T2QA 2VLRA 1QLFB 3EHBD 4GUPB 2HFGL 4DCQB 1KLGB 5C0FA 1FIGL 1BQUA 3KPQB 3ARGA 5DJCA 1XR8B 4GMTH 1F00I 4I48B 2GCYB 1J7VR 3M1BB 4LCYB 3U30B 1YEJL 4OUUB 4W4OA 3V4VL 5IF0A 1TJIL 2AXGA 2VLKB 3O6LL 4B50A 2WWKO 3WNKA 3L95B 4NO3A 4PJHB 3VCLA 3EOTL 5IB5A 5MENA 4X80H 5HI4C 3F58H 3T77A 1RQ5A 3SKOA 1DE4A 2BK8A 1UZ6E 3KPNB 3O0RH 4L3EE 3TJEL 4Y5YC 4H0HB 3DX8A 3OAZK 2AQ1A 1J5OL 5K33A 1A7QL 5AAWA 5JA9A 1LILA 1KGCD 1GC1C 4OZFA 1KEGH 1KN4H 4C56A 2EDOA 4OGYL 4MA1C 2P8PA 4Q6YA 4Y4KB 2AQ2A 5IFJB 2EH7L 4HPYL 2A2QT 2HTKD 3GJFA 5IBLD 2ED9A 3RWEA 1HH9B 4IIQC 5E08L 2IAMC 4K94C 5D7IF 1TZGL 1AGCA 4QHKI 3VXPA 2Q87A 1H5BC 3KPSA 4XCEB 4MMXC 3QIWC 4P5KA 2ARJB 5JNYB 2VIRB 2B2XL 5F1IA 1G1YA 5TDPB 3MJ9L 1CL7I 4JM2B 1A7RL 2PO6B 4U4BA 2V2XB 2DMKA 2CIIB 2O5XL 4Y2DA 2GHWB 3SDCB 1A4KA 5DFWH 3IJSA 4RFNC 3V4UL 4G9FA 1JRHH 1TITA 5HHQB 4R9HA 3JWDL 1MFCH 5IWLC 4Y16A 4PY8J 4I77H 3NIGF 4MLSA 1DQQB 1I7ZB 2HFFA 4WW2F 3VI3F 1DL7L 4YLQT 1OT2A 5CJ8A 3VXRD 5DS8B 1FZKA 3WNOA 3GUTA 1QFUL 3HZYB 5EBLA 2BNRE 5E7FA 1L4IA 3R0MA 3RQ3A 3L3DB 3EW3B 1WVZA 2FJGA 1X5KA 2IAMD 3RHWF 4ELMF 3T0EC 4UQ3A 1MFAH 4YDLC 2HTLD 3L1OH 4YQXL 3VWJC 5FYKE 2DLHA 4YHIA 3BMWA 3EO1A 5E9DB 2VSCA 5CINL 5F6IB 1IARB 1A4JB 5AG9A 2MMXA 5K9OB 4U6HB 2YD1A 4WDIB 1ZK9A 3QCTL 3MSPA 1FBIH 4WTZG 2V7HB 3P0VH 3UPRA 1RJCA 2Q6WA 3ZE0F 3C6LC 3O9WD 4F8QA 2XFXB 4LPTA 4YXLL 1RHHB 1QRKA 2N7BA 3ARFC 2UWEE 3T4YA 5E8PB 3K8KA 4BZYA 1YEGL 3NPSC 3F62A 1CDBA 2J5LC 4KKBD 4MJ2A 2VC2L 5KSUA 3D3VA 1RAMA 3PF2A 4RFEA 3VFUA 1SM3L 2FLBT 1RUAL 4N0FB 6FABH 1YPZE 2IPKA 4QXUL 1MRDH 4JFHE 5FA3A 4QXTB 1OM3H 4LKXB 3T0ED 2XACC 2B1HL 5C0BD 3HS0B 3QUMA 3VWJD 4JFOB 5JHDE 5DD3L 1C12A 2VDLL 4IJ3C 4YFLI 4GXUM 4Y5VB 4PJIE 5ICYB 4OF8A 3G5XA 1H15B 1LE9B 1SY6A 3PIQA 4GRLC 3Q2CA 5INCB 1FC2D 3WUWA 4A6YA 4UTAL 3MRNB 3HNTH 4UT7L 5MHSD 3OTTA 1IGFL 3QI9A 5B4MD 1MWAL 5DD1H 4HPOH 1NBQA 3HE7A 5HJ3B 1JHTA 4XAWL 5SV3A 4P57A 4CN6A 4N8VG 1KACB 4LCCA 1DBKL 1I9JL 3PDOB 1FNAA 4IOIB 2Z31A 4HXBH 3LN5B 4HV8B 1QBBA 3H3PH 1C1EH 1P4BL 3WN5A 1M7IB 4NQCE 5E4EC 3BD5A 1KENL 4FXKB 1WFNA 2FDBP 3QPQC 4OLZH 3DUHA 1K8IB 2BSTA 3HNVH 4OF7A 2HT3D 2UWEB 1PZ5B 2VDOH 2ZOLB 2IMNA 3VFWB 2NZIA 3LKRB 1X5GA 3VFTA 4XPHH 3TBSA 1O7SA 4M7ZC 1J18A 2DQTL 1JWMB 1NCTA 4MVBC 1KIPB 3IJYA 2A77H 5IV2B 1P7QA 3QDHA 2FHFA 3QIUA 4PRDA 5C0AE 4ZAKB 1BECA 2C4FU 1W0YT 1T0MA 2EXWC 4O2CB 2DYPD 3PWNB 3C09C 5ILTL 3QHZL 3BW9B 3RUGB 4G43B 1NLDL 3QUZB 3B9KB 2DLGA 2M26A 2NW3B 3TCXA 2Z93B 4PJIB 4LLVB 3EYUH 2ADIB 1NGWB 5FF6A 3O2WH 3QEGL 1OTTD 5KVFL 1JGLL 4Z7VB 3PL6D 1KJ3L 5E1AA 1ZHLA 4AEIL 1G7MA 2DQFB 3F8UB 4HDIB 3BQUA 3IDGB 1MRCL 3BJ91 4WTZA 3T2NH 1PGRB 4KUCD 2ZUQC 3CFCL 4HBCL 4M1GH 4XNYH 5KVDL 2VKXA 1MRFL 4EOWL 2WBJB 2EYTA 3QDME 4DWHA 5T1LB 4Z95L 4A2LA 3MV01 2GJ6D 4RSVA 5DC0A 1JF1B 3GRWH 3DVFA 5D9SA 2GEEA 4NQCB 5J6HB 2EDWA 4XX1E 2DKMA 3NN8A 2CKBL 3U0TA 5ICZB 3KPLB 5LCVL 4K55A 5KW9H 2BMKA 2EXWD 2AKRA 2C3VA 3T1WA 2YA1A 4PJEF 3S3SA 2HLAB 3O2VH 4CMHB 5IVZB 2O26U 3DLQR 2OYPA 5I1HH 4G42A 2P5EA 5F7DA 5SWQB 1QZ1A 1S5HB 2GJJA 5C6WH 4OZ4B 4P23A 1OTUC 5I30H 3H0TB 1UXSA 3ROLB 5C0AB 3H7LA 5AWNH 1Q38A 1KXTB 3DBXB 5FHAH 1ZEAL 4PJAE 4FQCH 4PGCA 1KBGL 3MXVL 1RZ8A 3SE3A 5I8KH 1A3QA 2MKLC 2AV1A 3RZCC 4OZGA 5EUKA 1M71B 3K0WA 5CEZH 1U93A 2CMRL 1M6OB 4WI3A 3WXVL 2OJEB 5T1KA 4NQDD 5F7HA 5INDB 4L8CB 4LNRA 2C1PB 4KMTH 1W0WA 2GSGB 4ZSOE 1E27A 3IFPB 5DUPH 2VAAB 4KU1A 5CJOL 4UILH 2FX9H 2AABL 3OB8A 4RFOH 3NFNB 4Z5RB 4NQSA 1CGSH 3SDDC 5JW4R 2X4UB 1DN0B 2IQ9L 1XMWA 3IDUA 3QDMB 4OQ1A 4Y4FC 1J8HE 2FWOB 2JIXB 4JHZA 3LDBB 2LVCA 2VQ1A 3WS6A 2IANB 1FNFA 1PSKH 4X5XB 4ONGL 3OJDA 1T2JA 1OTUD 4K7PL 1HXMB 1R3HB 3ULVC 3DI2B 3OJ2C 3U4AA 1OSPL 2NMSA 5IP4A 4P5TD 3RJDA 1RJLB 4EUPH 4P2YA 3T8XB 2JLLA 1FNGB 1UM5H 3P11L 4OD3L 2AK1L 1BIHA 4R8WH 3OR6B 5MENB 2BP3A 1A1OB 4OAWB 1MF2H 3Q5YA 4ZODA 1UYWL 1FO0A 5DO2C 4PJAB 4TSBL 5DMKA 3Q0HA 2RQ8A 1GC1L 5GGVL 1RZJC 3A67H 3DX8B 35C8H 5IM7A 3TO4B 5KSAB 4OIAA 4S1QH 3DSFL 3C5JB 4NOFA 4WW2C 5EIIA 3MX0A 1IEBB 1INQA 1AP2A 2YHGA 4O9HH 4K94L 3OHXA 2OX5A 5JO5A 3GM8A 3QXDB 3VXNA 5HYFA 1NEZA 4RQQB 1AGCB 4XGZB 5GGSY 5D2LA 1A0QH 3P2TA 2GIYA 3DTXB 4D3CH 3QQ4A 1NCDH 5EIQA 3IVKB 3PNWB 1J9CT 5EPMA 4O2EB 3NA9L 4XPBH 3WFZA 1EVUA 4JPWL 4DQOL 3GSUB 4LDEB 3TBYA 5J3HC 1BF8A 5D1XA 3LS4L 4P3CL 5D1QC 3JXAA 2CDGB 1G84A 1WWWX 3P77A 3P73A 3P4MB 4FFYL 5EORH 1FL5A 3G6JB 4PJFE 3SGEI 1A6ZB 2EDDA 4Y16B 1U92B 1DBBH 3MRCA 3RY6C 4WU7A 3Q6FA 3RKDD 4OGXH 4EZMA 1NGXA 2JCCA 2HFFB 1AO7A 4N90E 3OAZH 3NVQA 1UACL 4RGOH 1OP3K 3MCLL 3LV3A 3NA4A 3ZE1F 4DOHB 4MA8L 3FMGH 2MCPH 5A2IH 2WWMC 8CGTA 2XXCB 1WIPA 3LKSA 3L3OB 3FT2A 4XNZC 4KK6C 2AJ3B 3TN0B 5CP3H 3E2HB 2EE3A 2X42A 5FYLD 1T80A 2E9JA 2A9MH 4H20H 2NY3D 3ULUE 3HE6C 3S37X 2A6IB 3IJHB 2HFEB 3VWKC 4HIHB 3QDGD 4PLJC 1FZMB 4JG0H 5ISZE 2J8UE 2HVJA 4YR6A 1RUKH 4QF1A 2HWZH 2VZOA 1R3LB 4W70A 1T04B 2IBGA 3QQ9C 5TQ0H 1IQDA 4PRID 3IU3B 2Q8BL 4YC2C 1PLGH 1T5WA 5JLZB 1HYSD 1QFOA 4LLUB 5SWZE 1T7WA 4P5MA 3OPZH 3JTTA 4QRRE 4FQXC 1GZPB 1G7IB 2AJSL 2YPLB 5EU6E 2R29H 3LRSA 3GMOA 3KJ6H 1RY7B 3MLTB 4RFEB 3VFUB 1S7UB 3CH1B 4PGDA 1FDLH 3DRQA 3F7YA 4NRXA 3K1DA 4PJFB 1NMCC 5JZ7C 1CXKA 5FA3B 5CILH 1MCPH 4HWZA 4IHOB 4BQBA 3GMNA 5SX4I 5DZOA 3OF6D 1U8IA 3QUXA 2NY4B 5GGTA 4K3DH 2EICA 4NT6B 4WV1C 3ARVA 4TYUA 5DA4A 4PG2C 1ZHKA 4J2XA 2MKWA 4GKNA 3HE6D 4AT6B 4PLJD 5J13C 4Y88A 3IS1X 4G6JH 2VDMH 2LU7A 5FO8A 1JPFB 3PIQB 3LRGA 5IEHB 3D0LB 4XCFL 1DBML 4XWGL 4YIQB 3QWQB 1J0HA 4JY6B 1JV5A 1E6JL 5C0DB 2FEDD 1FFOB 1NGQL 5ID1B 4WHCA 4BM7A 1TETH 5IFHH 2DQJH 3U9PH 2P42B 1T7ZA 1KNOB 3LQAH 4P57B 2W0FA 3L6FB 5HYSG 4M62H 1Q9WB 1VFBA 1B0WA 4OLVL 1MCIA 3FO0H 3C6SA 3SDXE 5BOPA 1Z6JT 2YC1B 3GSXB 5I6XB 4POYA 4NRYB 8FABB 4GBXC 3QDAA 2W9DH 4UV4L 3T04D 5IMLB 4P4KB 1VCAA 5SWZB 1CFSA 5AZEL 1RZKL 5T1MA 3MMEB 2G2RA 4AENB 4QRRB 3FQXA 3GJFH 4PGBA 1QKZH 2FBJH 4JFFD 4Q7DA 5EU6B 1NGZB 3VFPB 3FAXA 1ZLSH 3MLPA 4E0RA 4NZUL 4X7DC 1FNSL 4NM4L 1G7PA 2ICWB 5HYEA 4X6DE 5E03A 1ZWIA 3KPRE 3O45B 5BO1H 1NCCH 4M5ZH 3KNBB 1IZKA 3U0PB 4JZJC 4AH2A 1G9MH 4JFPA 4NYLB 1HSAA 3BWUC 3H42H 3KPOB 4PBVC 4LMQE 2VJXA 4LLDA 2ICCA 1EXUA 4QHLA 3RKPA 1LNUA 2HKFH 5E1AB 4UZGA 1A3LH 2IGFL 2R69H 4DK3A 2G5BA 1UCTA 2JJSA 5EZJA 5T3XL 1VADA 3CFDA 4PJ7F 4M6OH 2VDKH 4QRTB 1KJMB 2H2SC 1YMMD 4P4RA 2NXYC 1FIEA 1J1OL 3SO3B 3GBMH 3V52H 3QEQE 5T3ZL 3SDXB 1VDGA 1N6VA 3SY0A 4U0QB 3UTTA 3S3JA 1BIIA 1LEIB 2BDNL 5BW7A 3AY4A 3L3GA 3JZ7A 1GOGA 2VXQL 1KCVH 4HS3B 1S7WB 4YPGB 1Z9LA 3WDIA 1U8QA 2W9LA 2DQIH 3MUGA 2R0KL 3G04A 3LZFL 3SCMD 5I1GL 1YNTA 4J6RH 2P5EB 2DL9A 3MLVL 3QSKB 3TNMA 4WUUE 4NC2B 3S5LG 1IGIL 4XVSH 4BUHA 3I3DA 3FHQA 3O4LB 5L2KD 1JYVA 2AJXH 3SPVA 1LO4H 4R7NA 2R56L 4HC1A 4PFEA 4DKEL 4X6DB 1A7BA 3KPRB 5DJZB 2X1WL 2LV4A 4PGCB 5JR1H 2D4DA 1HSBA 3UBXB 3QULA 2Z0BA 5EUOE 3AREA 2QQQA 2CO7B 5L2JB 4YHYB 4U1GC 4XCCH 4MAYB 3GIVA 1N4XH 4XVJL 2NXYD 4KKLC 3O4OC 1UM4H 4UIKL 4YWGL 2W0LA 4HFUL 4X4YB 5AD0A 3QUYB 4MNQD 4DFIA 4HLZG 1N6QL 1E27B 1ZKAA 4KQ4L 5FFLA 1MREL 1QYGL 3QUMH 5EOTA 3LB6D 1D9KA 3I50L 1S78D 4M93B