5KSBA

T15-dq8.5-glia-gamma1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
181
structure length
181
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWSLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksbA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksbA01
4E41B 5SWSB 3E2HB 4FQCH 3BI9X 4RRPA 5GGUB 3ARDC 3L3GA 4M00A 2N1KA 5B4MD 2X89D 3L5WB 2ERJC 3L3JA 1FGVH 3S37X 1I1AD 2HMID 4KRLB 1X5FA 2IG2H 7CGTA 4XI5C 4JFEB 3QZWA 5E6IA 2VH5H 1K4DA 1OT1A 3GJEA 5SWZA 2BZDA 2R9HD 5D6CB 3RIFF 3E3QC 4MXWH 3TCLB 3P11H 3SY0A 4IOFD 2F54D 4JREB 4HF5H 4OZIF 4NNXB 4WWKC 5KN5A 2QADB 4QHLA 2R8SH 3NACH 2W9LA 1R3HA 2FIKB 5DYOB 4Y5YB 4QF1A 5D9SA 4HH8A 3EFFA 5JR1L 2J6EA 2ZUSA 4GAFB 2ZOKB 3QPQC 4BK5A 3RNKA 4L8CB 2EDDA 5IJVA 3TIDA 4OZHA 1TNNA 1AFVL 5F1IB 2F8XC 4BJLA 4DGYH 4OT1H 1T22B 1HWHB 5EU4A 3WHE0 4PRHB 2ESVB 5L7XL 1FVEB 1L7TL 3QUZB 1Q94B 4FS0A 1YN6A 2IGFH 3FN0L 1OF2A 1FGNL 1KULA 2HLFD 4ORZC 4JAMB 4ODHL 5CBEB 3GSOB 4L5FH 4S11A 4YPGB 1F4XL 3KNBB 5CKAA 3QEHB 1MCDA 4HH9B 4UOJA 4DZBA 5IESL 5B8CA 4QRQA 1WAAA 5C0ND 2NY5H 5EO9B 4WJ5B 5GGTL 1MCFA 3O6FD 4FZ8L 3WNLA 4EBQL 5EH1A 4LCWA 1I9JL 1T20B 2C4FT 1ZA3B 5D93C 2YC1A 2Y23A 4BH8A 3FQTB 4L3ED 4NT6A 5DRNA 4FFYL 5C0CE 4DWHA 5HYJB 2JELH 5KJRL 2ITDA 2BJMH 1B9ZA 2O5ZH 4XNMA 4BH7A 5H35B 4U05A 4O5LL 3WO4B 5EU3B 4OCWL 3P77A 4DCQB 1MVFA 1A6TA 4HIIB 3RWDA 4EKXA 5IMLB 3HI1B 3SDYH 2PTTA 1A1OB 1PAMA 2FSEB 3DV6A 4MAYD 5JDJA 2F58H 4YXLL 1IGYA 2GTZB 2YSSA 3DX8A 4C56D 2JJVA 1QEWA 2CLZA 1UENA 2CRZA 3EO9L 2YA0A 3O3DA 5D6DC 1NUGA 2YMXL 3T4AA 4Y19B 1J0HA 4ZYKB 3BESR 3OXSB 4I3RL 3Q6FB 4BZYA 4F7PA 3V7AG 3VXRA 3ZO0A 2H2SD 1JYNA 4PJHA 1QSZA 2EC9U 1RZKL 1NMAH 5GRZA 2FX8H 3VWJB 1OTSD 1T80A 1R5VB 3DVGB 1NC4A 1MCLA 2ZSVA 3OKMA 3RUGE 3QPXL 4KRMB 1WVZA 1QPPA 4Z7UF 1CK0L 5E2UH 1N8ZA 3GMRB 1FN4B 3RGVC 3TO4A 3OBAA 3QG7H 5BZDB 1A6PA 3QXAA 4KK8D 4XBEL 1XGQA 3AM8C 1T1ZA 3BZDA 4ELKB 1N64H 4UILH 4MQSB 5T1LD 2PF6A 2XQYK 3PP4H 5GRYA 1OHQA 5HDQH 3GSRB 5DD0H 3KR3L 3AS1A 1NANI 4ODVL 3HI6H 4EI6B 1N3NA 1LHZA 1DVFA 4J7RA 4PJDF 3VXMB 1NCBL 2DD8L 2XZCH 5LG1A 4MD4B 5GISL 1NFIB 2A0LD 5FYLH 5LWYL 1IARB 1YEEH 2X4TA 1KIUA 5DMJB 1XF2A 1BM3H 5D72H 3HUJB 2A83B 2AK4A 4HIJB 2HG5B 5ID0A 2HFGH 4M1DH 1Y6KR 2VXUL 4U6YA 1INEL 4K2UH 4Y4HB 4PV8A 3UTSD 1Z9LA 3O6KL 1FZKA 1A9EA 1BFTA 2APBA 1C5BH 5C7XL 1M71A 2LFGA 4O58H 5DJ2A 3KXFA 5HJ3A 1F11A 2EYTB 3DVFA 5HHVL 5J1TC 1NGPH 3SKJH 4OLWH 5CSZB 5IVXF 5L8JB 4J23A 2EE9A 3LQAC 1BP3B 3LRSA 1RZGB 3D18B 4KVCL 3CLFH 1CDGA 1KXTB 4U1GC 3IJHB 4X4YA 3P3YA 4PJFF 5IEHA 2OXGA 4JDVA 1LO4L 2IMNA 4Y89A 4G6KL 5K9JH 4IRJD 2FZ3A 3HZVA 1MJJB 5IR1B 3MUGB 4ZPVB 5IB1A 2VLJD 4G80A 4EN3B 1OB1B 1OSPL 5D7JA 4GG8A 4G8IA 1L0XA 5T1DL 1JPST 3SGEI 4QRPD 4JZJB 1WBXB 3V5KA 4HKXA 1AGDB 4X6DE 3LPWA 1W72L 4G8FB 1DN0B 1ZT4B 1EHXA 4MNQB 2H3NA 2YK1L 4Y1AA 4R90L 5D1ZB 1IVLA 2PYED 4HZAA 5HGHB 3CH1A 1F3RB 1KPRB 4LSPH 3PHOB 4GKNB 1NH6A 5E03A 4Q0XL 3TH3T 3QQ3B 4O9HH 3NCCB 4E42B 2Q76B 3WD5L 4ZUSB 4CRPA 2KPNA 1QFWH 5EIIB 4NM8H 1CT8B 4PS4H 3O6MH 4KHXH 3MCKB 2R2HA 2NY2D 2FLBT 2VB5A 2IFGA 5I30L 3WJJC 3RX7A 4P59L 3V0AC 5EG6C 4G8GE 2PTVA 3RU8H 3RZWA 3D85B 2D7TH 3WFEH 2E9IA 3T0EA 2VKXA 4LK4A 3OX8A 4E0RA 3KS0H 5ACMA 3KPPA 4OZGA 3RX8A 4U1SB 4ZQKB 3MC0A 2Q86A 3WIHA 1I9IL 5TQ0L 4Z0XA 4GG6B 4KROD 5F97E 1D9KB 5ETUB 3S4SA 4HXAL 4OF7A 4LCIL 1DFBH 5AWNH 4ZUUA 3FO9A 4LSDA 4MJIB 5INDB 2FBOJ 2KKQA 2NMSA 4FQCL 4MHHI 1YEHL 3ROOB 3ULUC 1FGVL 1JJUA 4OLZH 3Q5TA 5E5MA 1RHHB 4KRNA 5B3NA 2IG2L 4BSWB 3FQXA 3EYQC 1CDCA 3ARTA 4YXKH 5J11C 1YEGL 4MXWL 3AY4C 4IOIB 3P11L 1HH6B 1ZSDB 1CGXA 3ARGB 4HF5L 2PETA 5DMGC 4GBXC 2R8SL 3NACL 5CINH 3L5JA 3IDYB 4XPFL 1CGTA 3CZJA 4FFWD 4KJYA 5JDSA 2A6JB 2P42B 4HHAA 1FFNB 4WFFE 4XZUB 5CP7A 4AM0B 3L6FA 4XP4H 5A3ID 3OB0K 3C5ZC 3I3DA 1KJ3H 3ZLQC 2R0LH 4MCYA 5FGRA 4KH2A 3HC0A 4DGYL 4UV4H 4OT1L 3D39A 3U36B 1JV5B 4PJ8A 1FV1B 2YD5A 2IAND 3MXWL 3NN8A 3P4OB 3WLWC 4MLSA 5DK2B 1KPVA 2ID5A 4R26H 5IK3B 4PRDB 3OGOE 1U8IB 5EU6B 4IIQB 3WHXB 1EHNA 1NQBA 1ACZA 4L5FL 3TH4T 5GJSL 5IM7A 3C5SB 3VXTB 4MVBC 5F44A 3RDTC 4TVPH 2VIRB 4U1IB 1JYXA 4OZIB 3RGHA 4MD0A 1Y18B 2IQAB 3PWPB 3MO1B 5EN2B 3V6OC 3QG6A 3VXUB 2VZVA 1FFPA 4X7CC 5D7LE 3V52L 3ZMRA 4OFIA 1W0WB 1EIBA 2AV1A 3MA9H 2EDKA 3HB3C 4OCRH 2QEJA 4RFNB 1XGTB 1YZZA 1A7QH 4OQTL 2JELL 4KI1A 1KF9B 3P9MA 2BJML 1QVOA 2GQHA 4R6UA 1ZHKB 4GS7B 12E8H 5E9DA 1OARH 4O4YH 2J8OA 1GGCH 1XR9B 2ZSWB 4XMPH 2OM5A 3AAZA 3O4LE 4YDLC 2BOCB 4NRZA 4ACPA 2H6PA 2AAVA 1F8TL 1TXKA 3ZKMC 1J0JA 1KACB 1MCEA 2DQTH 2VLRB 3OAZK 4K7FB 1VFAA 3NZ8A 3AMKA 5HHNA 1DEEB 1XF1A 3T08A 3CCHA 4Z7VF 1S9XB 4FXGB 2WIIB 4KJQC 3ALXA 1CFQB 3CDFA 8FABA 1FE8H 3PWNB 4L8DB 5BRZE 1U91A 4DK6A 2ADIA 1ETZB 1KN4H 1KCSL 3DGGB 1T6VN 4H1LG 4J4PC 4P2RA 3GIVA 3NAAL 4L4VE 3BQUB 4NBYB 3MJ8B 1RUKH 2FD6H 4PD4K 5E2UL 2HJKA 2Z93B 1IKFL 2FX7H 3UJJH 1PYWB 4Z95L 3QG7L 4GOSA 2AJ3A 3O9WD 4GLRH 4Y2DD 3SDDC 5I76A 4NQED 3MBED 2R4RH 4X5XB 4KKCD 3PP4L 2JJTC 5HDQL 1S7QB 5DD0L 2BOBB 3NZHH 4M3KB 2AQ3A 3U6RA 3UPRA 3QRFM 1ZOXA 4F7EA 1J1PH 5EOTB 3TFKD 1INDL 4JO3H 4KKBD 3KJ6H 1FZOA 1TVBA 3V7AE 3REVA 1G7IA 3V6FB 1A02N 2XZCL 1I4FA 1LEGA 2I25N 4LCCC 4LIQE 3LEVH 3MJGX 5KZCD 3QRGH 5FYLL 5IVZA 2E6JA 3D2UA 4M9PA 1YEEL 3VGDA 1RIUH 3TESA 1BM3L 2HJLB 1FL3B 3GJFB 5C8JB 3GHEL 2ADGB 4KTEH 2X70B 3C09B 2A1WH 3QZWG 4K2UL 1IM3B 4KTYA 1YUHB 4PREA 5EOCH 1JRHH 1MFDH 2CDFA 5EZIH 1EMTL 3N1GC 1UM6L 3G6JA 3H0TB 4UTBH 4PJ5D 4O58L 4UT7L 5DTFB 5DQDL 3CFBA 1I8LA 1SYSA 1NGPL 1NLDL 2AXJA 4OLWL 3SKMA 2J6EL 5F8RC 1TZHA 4RX4D 1MAJA 4X98A 2C1OA 3AS3A 1FAKT 3PL6A 4F15C 2NY1B 3NIDF 1WZLA 1I1CA 4HW6A 5JOEA 3CLFL 1YNTB 4WFGE 2VC2L 1RZKC 4OLXH 4U1MA 5C08E 1KJ2L 5L88H 2P7TA 2OYPA 1UVQA 3O3BA 3KYNB 1TCMA 3LCYA 5D1QD 5K9JL 1JNLH 4MXQD 1OD7A 5HSFA 1YMMD 4I3SL 5CKGA 5DHXB 3TWCH 7FABH 5DMIH 2KZWA 1CWVA 1RPQA 4I3GA 2IAMA 1RUPH 4TOYH 4WTXA 1U9KA 1C16A 1IAIM 5HHME 4UUJA 4OD2B 5HYEA 2NY4C 4DFHA 4L4JA 5KSVB 3G08B 4HWBA 3BUYA 4IBLT 2AKRA 5CHNB 1QSEA 4XP6H 4QOKE 3GJFH 3QQ4B 4LSPL 2Z9TA 5C2UB 3BDYH 3BO8A 3UTTD 5IVXB 4O9HL 3IDMA 2FL5A 5KSAB 4X8JA 4W6XB 5IFHL 1AR2A 2VKWA 1QFWL 4KXZI 4PS4L 3O6ML 4KHXL 4OQ1A 1SBSL 4ETQB 3DMMD 4JKLA 5IG7A 4XCYA 5KOVC 3TF7C 3RU8L 3EYSL 2D7TL 5DEZA 3B6SB 1A22B 1IQDB 3MGOB 4OFVA 1FNLA 1IGTB 3C2AH 3DRTB 3R0MA 5I74B 1ORSA 3Q1SH 4K9EC 1YDPA 4Y16D 1U93B 4U1NB 3P9WB 4GO6B 8CGTA 2DI9A 3L9RB 4JFDE 3VFTB 1DFBL 1EH9A 5ISZD 5AWNL 1OGAA 2CDGA 4QRSA 2OP4L 2R1YA 4NQTA 4YFLF 4P4KC 1DQJB 2CK0L 5JW4N 3ARWA 3O81A 3QEGH 1DQDH 4HIHA 2JIXD 4OLZL 2GAZA 4PRIB 3C8KA 2BVYA 3IDUA 3LH2H 2BDNH 5DHYA 2HKFH 2H2PC 1YNLH 3B2UC 4A2MA 3MRRA 4GW1A 5D7IB 4XCEB 5JHDE 1NGWA 4XXCC 5I15H 4YXKL 2DQFA 3FMGL 2WWKT 4EI5D 1NCAH 2A74A 2ORBH 3VH8G 1VACA 3VWKA 1AR1C 3BZEB 1BFVH 5CINL 4LASH 1QOKA 2XN9A 4PJ9A 1LWRA 5DR5H 3TA3A 1KSRA 2DLGA 2VL5A 4Z0BH 3T0XA 2H32A 4X6DF 1CICC 4WO4C 5CBAA 4OIAA 1KJ3L 5DJ6B 1WBZA 4AEFA 1KB9J 2R0LL 1KB5A 1GGIH 3CMOL 3TBTB 4UV4L 2VAJA 3Q5YA 2YEZA 5CEYA 5SV4A 3VE0B 5AG9A 1PG7H 1H5BB 3C60A 1MLBA 2EKSA 4LDLB 4V1DA 1P84K 5KS9E 1V3JA 2V2TA 3WFHB 2W60A 4NO2B 5IB3B 3GSNB 1FL5B 2JJSA 3HNSH 5CWSB 2BNUA 4UU9A 3MZTA 3MRBA 4JRXA 4RGNB 3W82A 4H0HB 2X09A 2XZQL 1IGFL 2ZUVA 4LVOC 5CSBA 1H3WM 4L3AA 1RFDH 4TVPL 1AC0A 5E8NA 1B4JH 1A6ZB 3HZKB 1I7TB 3TBWA 3LDBC 1NFDF 1CDBA 3UTPD 2ZNXA 1AIFA 2P5WE 4LLYB 5C0FB 1HHHB 2BNRB 4MA3A 1U3HC 3MA9L 3QNZA 3WNKA 2DDQL 2P8LA 2VDQH 4NO5A 5IMKA 4G3YL 3FONB 3SHSA 2LU4A 3DV4A 1RD6A 2GJ6B 5DK0B 3RWCB 4FMFA 5DD3H 1FL6B 1J8KA 2G9HA 4Y5XC 3LKNA 12E8L 3NCJH 1OARL 2WLYA 3QDMD 4O4YL 4ZUTA 3R06B 5IGXH 3DVNB 1GGCL 4NRXA 4QRTA 3FO1B 1OSZA 3C6SB 1UB5A 4Q9BA 2ATKB 2Q7NA 4UDTA 5IHBA 3QIWD 1D5BA 2DQTL 1AO7E 5C07E 4AK1A 5HD8D 1AGCA 1WCBB 2Z8WC 1LVEA 3CGTA 2W1NA 1XF4B 3WKNA 2P45B 3KS0J 3HC3L 3BPCA 3M07A 5TF1H 1FE8L 1FLRL 3GEWB 4NQCB 4TUJB 1KN4L 5SX4H 5JLZB 3O3AA 3GSNH 3QEUA 3ZL4L 3MA7A 4C54A 5CGYC 1OGTB 3IDGB 4WGVB 1Q8MA 1VKXA 5JXEC 5E8OA 2QQKH 3NCEB 2AEWA 3GRWA 4NNYB 3OKLA 2NQCA 3D3VB 5JPMA 3FZUC 2D2OA 3M8OL 3KPRA 2FX7L 3UJJL 2WM0A 3O2VH 2NW2A 4KHTL 3ULVC 3D25B 2VXQL 2XTLA 1QHPA 3EYOA 3QJHA 1FAIH 3CFJA 1CR9L 1LGVA 4ZFOA 4WU7A 3HRZA 5C0JA 4H8WL 3F7RA 3VXSA 3P73A 4R0LC 1SY6L 1J1PL 4HKJA 3OJDA 4JO3L 4PJ7E 3QUMH 1T1WA 4Z7VB 1LE9A 1HOCB 4R2GB 3BKCL 4OTXL 3MRMB 4MXVE 5KVEH 5L9DL 1LD9A 4XHJD 3EYFB 1A1MA 3QRGL 4KRPD 4XVUC 3QDJB 3WIIL 3I9GH 1RIUL 3QEQA 1PKQE 3EHBC 5FA3B 5EUOE 3TYGH 4FQHA 4JFHE 4KTEL 3M17A 2ENSA 4L3EA 4PJCF 1MSPA 2HN7B 2A1WL 5IBTH 2NY6D 4U1KA 1YEDA 1A7NH 5LAXA 3R1GH 3WUWA 2X44D 1JRHL 2EIZB 3BISA 4HC1A 4LCYA 4MX7B 1G7HA 2XWJB 1T2XA 3FFCD 4NN5B 1UCBH 2H8PB 4DN4L 5TH2B 5IMMB 3VI4F 4HK0A 1FRGL 2Z4QA 3EDJA 1MCOH 2AJSH 3ZE2E 1FYHB 3HS0A 4LHUB 5K9OA 3MLUH 3MREB 3U83A 5FKPA 1Z0MA 3SGJC 3PDOA 4DN3L 4Y4FC 3WIFA 1EGJH 1OAYH 2I27N 1Q9WB 4TN9A 4HJGB 1I1AB 5DA4A 1T3FB 4JRYE 5HI5C 2HFFB 4HUWB 5J12B 1V3MA 3JUYA 4U6VH 5CFHA 1NDMA 4XT1C 3U4EA 1E6OL 1JPGA 4X83A 4OLXL 1AXSA 5AYQA 3JTSA 3D9AH 4HUXA 2H9GB 4L29B 3IFOB 5L88L 1NCUA 5HY9B 3U2SB 3ARBB 5DRZB 5GSRB 5C71A 3B9KB 3DYMA 5T5FH 3IFLL 1EBAA 3QI9C 4JFYB 1JNLL 1GPOH 4NSKA 5FYJE 3CDGA 1N6QH 3AXLB 1DUZA 4HLZG 3PDGA 3QUXC 4TOYL 1I8MB 4F7TA 4E41A 3A67H 1F97A 5GGUA 3BH8A 1XGPB 2EDXA 4KKLC 2EYSA 3U0WH 5IVNA 2VAAA 4KUZL 4YNYB 3VGGA 4WWKD 4XP6L 4JFPB 5EU7C 4JFEA 2A9MH 4NUJA 3BPOC 4OZHE 3BDYL 4L8SC 5T1LA 4N1CA 3RQ3A 4M61B 1D5ZA 3DLQR 3DX6A 5JW3H 1RVFH 4TSCH 3H9SD 5DUBB 3QPQD 1U8NB 3PWVA 3G04A 4Y5YA 4JLRA 2DM2A 1XFPA 1QR4A 4P46A 4LSVH 1H8OA 2Y5TA 4HFUH 5I8KH 3QUYA 3D69A 3O6FB 1WWCA 4M93C 1WAAE 2AEIT 3N50A 4YH6A 1PX3A 2DYPA 5F1IA 3NA9H 3Q1SL 2DKUA 1A6WH 1OP5H 5F9JB 1CL7I 3HPJB 1V8HA 1U95B 4Z77B 4HJ0C 4LCWE 3QUZA 4AENB 4OUOA 3CFKB 4XC3H 4HGWB 5IQ9B 3VWJC 4JHWH 4M1GH 5BZWB 4JAMA 5EWIH 4WWID 5CBEA 4QTHA 2WBJA 2CK2A 4NN6C 4TPRH 5F6HJ 1IEHA 1HEZB 1DDHA 3PWUA 5BXFA 5GZNC 3QEGL 4S2SB 1JI2A 1X7QA 1X9QA 2BVPA 3VCLA 1XF5A 4MAYB 1MIEH 1YNLL 4C56B 3MLZL 2FJGA 2XIDA 5I15L 5AUMB 1PVHA 2DTMH 3ARUA 2CR3A 4PJEE 2EDYA 2IADB 3BOVA 3V0VA 1AGEB 3W11C 1G1YA 2KL6A 1BFVL 2A6DB 4LASL 3I6KB 3BIKA 1S7TA 2LTQC 5DR5L 1MNUL 1PX4A 5CMAA 5LXGH 1T0NA 4LEOA 1OWWA 3EYVA 2ITCB 3BYTA 5E00B 4RIRB 4DCQA 3VXRE 3MV01 3HE7A 3HI1A 1FJ1B 2KBGA 4XBPB 4LNRB 1NPUA 4JVWA 3LKOA 4OJFH 3HAEA 5FDYA 1KLFA 4Q9CA 4U3XA 4JFFB 3SQOH 4D0DB 1FG2A 1PG7L 4EZMA 4NUGH 5ID1B 5C0BB 2WQ8A 4DEPC 2EEBA 4XPAH 4CBPA 1QBLH 2R1XA 1FFRA 4MJ5B 2LU3A 4M6NH 3HNSL 1HZHL 1HINL 4PLKD 1P7KA 3KDMA 4ZYKA 3ZHDA 3VFVB 2V7HA 2XXCB 5C0CD 3Q6FA 2QKIB 3CVHA 4MLIA 4RAHA 1XCTB 4B50A 4PGZA 1B4JL 6FABH 2VSDA 3GMQB 5F3HB 3FOMB 3L5IA 4PBXA 3WJLC 2B39A 3DVGA 3NGBB 1M1SA 3TCXA 2EDEA 1ORQA 3QXDB 3IGAA 2WWKO 1BF2A 3TN0D 4I4WB 3FHAA 2BHYA 4OF3A 4CL7A 3GIZH 5BZDA 4GW5A 2VDQL 4DTGL 1JPTH 3CC5B 2D4FA 4GXUN 4UIKH 2P8MB 2X9XA 3BD4A 3EIFA 3UTSB 3WEXA 1D7FA 5DD3L 3DI3B 3NCJL 4J6RL 3RWGA 1KTKE 5D4QA 5JIHA 5IGXL 2Y36H 2EXWD 1BJMA 3KPOB 2VABB 3R8QA 4Z78A 1UJ3C 3MUJA 2Y7QB 4MD4A 3TO4C 1T03L 1B0GB 5FDWB 5TE4L 2DKSA 2OZ4H 5D1ZC 5FYKE 5BJTB 4G43B 4LP5A 5F8QC 4K71C 3QR2A 2GYSA 3MV9D 5HYSA 1U41A 4ZUVB 4JZNB 3B9DA 3IYLW 1ZT1A 1EFXD 5TE6H 5TF1L 4ODXB 2HG5A 2JKXA 1NFDB 3U0PB 4NZTH 1FZMB 3BPLC 1WJ3A 3GSNL 5ACLA 2ARWA 3L95A 1Q9OB 3O11A 1BVLA 4IRJB 1RULH 2QQKL 2V5MA 4Z7OE 3JZ7A 4JPKH 5D8JL 4ENED 2NZ9C 5ALBL 1XCQA 3O2VL 2IC2A 5DEGB 4MNGE 4HGKC 4LVNC 4QRPB 4YZFF 3QJFA 3FO2B 3D18A 1FAIL 4UI2A 2O61B 4X5WB 4YDIH 4N0UE 3BP5A 2C3VB 4NZRH 4OD3H 1A6VH 4WI4A 4X9FA 1T5WB 3IJHA 4KI5F 3ALPA 4ONHB 3TO2B 1BQSA 2YPVH 4JFZH 1OAXL 3ZKXB 4APQB 2APXA 1AI1L 3E6FA 4OIBA 4LCUB 3QUML 1G9EA 4YHNB 2WSKA 3GSUB 5I1DB 5GS1A 1T5XA 1MFCL 2IEPA 5DK3A 4MMZC 2HT2C 3MV8E 1PDKA 3EOAA 4EN3A 2JCCF 5J4MA 2X40A 3QFDB 2NY2B 4JFXB 4LMQE 1C5DB 1WFOA 3I9GL 4RAUA 1UFUA 3FO0H 3W5NA 1ZMYA 1F3DH 4AIZA 1WBXA 1E28A 3TYGL 5FOBA 1MFEH 3RWIA 2X9YA 4M8QB 1WEJH 3REWB 5HHOA 5IBTL 4G8FA 4WGWB 4LARH 1A7NL 3T0EE 1QRNA 1S9WA 4NPYA 1BVKA 5HGHA 1KPRA 5C09E 2E7BA 2NTFA 1T04A 4W6YB 3IT8D 1HYRC 4P9HH 3VD3A 1Q38A 5E4EB 2Q76A 5D7JC 2BP3A 3NFNB 1G7JA 4NQXB 4FQXB 1WT5C 1MCOL 4AIOA 5C0RL 5HHXL 1WFNA 4FXKA 3QFJA 2Q8BL 4GRMB 5B3JE 2WW8A 5J6HB 3ESVF 4UV7L 5EA0H 1EGJL 3LRGA 3BEWB 3RVWD 1SJEB 3ZYOA 2LVCA 2E7HA 4I0PD 3AC0A 4OF5A 1QYGH 1TZIB 4HBQA 3MLRH 5JHLL 4DKEH 4ZQKA 1VGKA 4GG6A 3RBGA 1S7VB 4HAGA 1XIWB 1BBJB 1KTLB 2WP3T 5H37G 1QFUH 5ETUA 5T5FL 1I7RB 4JM2D 3W81A 1GPOL 5DUMH 4YGVB 4BSVB 1SJXA 1U8LB 1ULVA 1MQ8A 3WUZA 2QR0A 4NKIL 4PJCB 2MOVA 3S36X 1E4JA 1AXTH 2GTWB 3A67L 2EDOA 1MF2H 3AS0A 4H5SB 4FP8L 5DDHB 4J2XA 2G60H 4PJAF 2IF7A 2EH7H 5CILL 1MI5D 1MUJB 4H8WC 1KCLA 2JJWA 1JPSH 1CE6B 5GGSB 4EUPB 4JY5H 4Y2DA 2A9ML 2IANB 2E5EA 3MYZA 2M26A 3MBEA 2HFEA 1J8HE 1T83A 3BW9B 3SN6N 2Z92A 3BD3A 3DRQA 5JW3L 1MRDL 1RVFL 2W0FB 4TSCL 4I13B 4NCC1 4AQ1B 1AJ7L 3C5ZD 3RVXD 4IDJL 4JHBA 3PUCA 3ULSB 2COQA 1K4CA 4GKSB 2HAZA 2XKNB 1FFNA 3MQIA 4HFUL 1X5XA 4XZUA 4AM0A 2VNCA 4WV1B 1CFTB 4DKFH 4S1SH 3DBXB 5GS0D 1GAFH 3NA9L 1A6WL 1AE6L 1JGEB 5CGMA 2YPLE 4N8VA 2NXZB 4F80A 5J56B 2X4NA 5HHQB 5DK2A 1EXUB 3D0VA 5IK3A 5L6YH 1EFQA 2OCFD 2VWEC 3ALWA 4PTUA 3ZE2F 3X12A 4JHWL 4Z7WB 4CGTA 4M1GL 5EWIL 4UMGA 5FGCB 3HMXA 2XXMB 4U1LA 3D87B 1ZGLM 1VADA 2VMFA 4TQEH 4TPRL 3SCMB 3T65A 3S88H 1E27B 4IHOB 5K33A 4EXPX 3GSQB 1P4BL 1S9VB 4U1IA 3GRWL 1MIEL 4DAGH 1XGUB 5L2KE 1RZJC 1WICA 5C0AD 3MO1A 5EN2A 4NNPH 2OSLB 4PG2A 2L7UA 5BVJA 2DTML 4BFIA 4WFEE 5I9QC 1HYSC 4LLDA 4EUPH 1MIML 4M5YL 4Q74A 5KVDH 4PV9B 1RZIB 3ARED 3DWTA 4WEBL 3FHQA 3MRPB 1N5YH 5TFSH 1OP9A 1SJHB 1YMMA 1UH3A 3ZKMD 3MGTB 1BOYA 3HNVL 2A38A 2ZUXA 5DT1L 1UB6A 3ARVA 3LN5B 4MAUH 5FIEA 5FYJU 5I1LB 2YPKB 3TBYB 4NFDA 3UBXI 1MCIA 4P2RE 4QXTB 4HWEL 4OJFL 3CZFB 4DVBB 1C5CH 3IJSB 3SQOL 4K7FA 2A6KA 4NQDD 4YDVB 2OL3B 4LEXH 3O9WB 3OXRB 1KCKA 5D7LD 1MQKH 3EOTH 5GRVK 4K94L 4KK6D 1S9XA 2YBRB 4NQEB 1J0YA 1I9RH 4J4PD 5CEXA 3MOAL 3IDNA 3MRDB 2WIIA 3BMWA 2PO6D 5EPMA 1PQZB 4HIXL 1FDLH 3T2NH 5F96H 2WNGA 5DQJB 1A6UH 2O5XH 1FC2D 1SQ2N 6FABL 2KH2B 1W0YT 1JTOA 1YC8A 4GAGL 2XTJD 3BQUA 1WC7B 2WWMC 3MROA 4LSQH 3MJ8A 4NZJA 2FJFA 5KZCB 3IETB 5CZXD 1F90H 1IAII 3FB6A 2Z93A 4NKMB 3GIZL 1BQHB 1JPTL 3CXDH 4MDIB 5AAMA 1M6OB 2F53D 2AEPL 2VE6B 3RVUD 2AJYL 3BWAB 3Q2CA 4XH2A 4AEIH 5E8DL 3W0WE 3CNKA 2CUMA 5SWQB 3QXTA 4Y4KA 5GS3A 2Y36L 2R0WH 4QRUB 3VI3F 4PJ5B 43C9B 2AJXH 1IT9L 2VDOH 5JXAH 1MJ7H 2VSCA 4M4RA 3PGFH 3IJYA 2JIXA 4L4VD 1I9EA 4XCNB 5E6ZA 5E08H 2OZ4L 1OP3K 4LPTA 1JE6A 4IOSD 3SDXE 2P8PB 1PZ5A 1S7WB 3ZSTA 4R3SB 1ADQH 1FL3A 3GJFA 3C6LD 4K7PX 5T1MA 4AMKH 1BD2A 5CP3H 5HYQB 2ADJB 1FP5A 2OL3H 3W9DB 3VFOB 4J3WA 1X6LA 3BZFB 1YUHA 1IGJA 4HT1L 4Z7UA 2OTWB 1EO7A 4K7PH 4WTZG 5HBBA 1RULL 2H26A 3H0TA 3OAYK 4MZ2A 2J1KA 4JPKL 3STZB 3JWDH 1HHIB 3Q5OA 4GRLD 4C57C 3MLTA 5MENE 1TTFA 2AERT 2NX5D 1NLBL 4QXGH 5ESQB 5CZKA 4PJDA 3MLXH 1A6VL 4OD3L 4ZSOB 2YPVL 1JN6A 5TPWH 4G8EB 1MEXH 4ESKA 1LNUA 1NBZA 2M8XA 3X3GH 4N0CD 1ZV5A 4HQQH 4JHAL 1WUNT 3ARFA 2AI0L 5JW4R 4M43H 4OGAD 5D2LA 3UYRH 5C3TA 3L3OA 3DMMB 4OD2A 4FMKA 4LOUD 4RMSA 3C8DA 1LEIA 4XMLH 3VGAC 4EDWH 5DEFA 2APTA 2PXYD 1I8IA 1ONQB 4XPTH 5CHNA 5I17B 4KU1A 5MEPB 3TV3H 1X4ZA 4Y16B 1N0XH 4LARL 2NNAA 3GHBH 1CLCA 2R4SH 1L0YA 5LGJA 3PIQA 2VXTH 5C08D 4P9HL 1BIIB 5CEZH 5JW4M 1MHCB 3VRJB 3QDMA 4RDQG 2GY7B 4PTTA 1LP9E 1LK3H 5C2BH 2Y25A 4GAYB 2ZCKH 3IFPA 4PJFA 3HFMH 4ETQA 5EA0L 5C0DA 1A2YB 3O8XD 4N0YH 5HHMD 4KY1H 3QSKB 3MGOA 3B5TA 3U0TB 1YMHB 3MLRL 3HC4H 4M9OA 4NDMA 3HAEG 4I0CC 5FYKU 5K9QG 1NAMA 1U93A 4PP2B 1QFUL 5D7KD 1OM3H 4Z7OF 3J7HA 2JCCB 4QOKD 5IW1B 3W39B 3VFTA 2OI9C 4LBEB 2VOTA 4L4TA 5DUML 1N59B 4O2EA 1WIPA 3LKRA 3NIGF 1NCTA 4RSVA 4I2XE 5TDOB 2GK2A 4X6CE 3B3IB 2AXGA 1K8DB 2H2PD 4LSUH 5JOFA 3RZCD 3EJYC 2XG4A 1MF2L 3IS0X 4PJGE 1PBYA 1YQVH 2EH7L 4GAJH 5IROC 4CNIA 1YECL 1S78C 4PJBF 1JPSL 1FNHA 1YN7B 5JOPD 4ISVB 4PRPB 1ED3B 1FPTL 1WZMA 3UPAA 1RUAH 5F1NB 5F1SA 3MRHA 4WHTB 3W2DH 4OCYH 1DUYA 3N85H 1P7QA 4R4ND 4Q2ZA 3PP3K 1FNGB 3BSZH 4JFDD 4YAQA 3L1OH 3F7YA 4RAVB 1UA6H 5GRVL 2EZ0D 2V2WA 1I3VA 1M7DB 4D0CA 1UKTA 4DKFL 4CADB 2MMXA 5D5MA 1JL8A 1G7QA 1GAFL 2GUOB 4RISH 3MUY1 1QNZL 5DVOA 4QTIL 5AZEH 1BQLL 2LU7A 3OKOA 4RWYH 4G42B 3TEUA 2W65A 2WP3O 3VE0A 1F6AB 1IM9D 1H5BA 4NKDB 4PJ9C 4ERSH 5JHDD 4QRRD 2VISA 5ESAA 5D1XD 3TA3C 5I1AB 3P0VH 1TTUA 4PPTA 3VXNB 3WFHA 4PJAB 1UXSB 1WTGT 4QHNB 1R5WB 4NN7B 2I60H 3V2AR 5DFVD 3S88L 4XBGB 3HE6A 3TVMD 4FTVE 1I7TA 2X4UA 1RJYB 2P5EA 4NC1C 3C60C 2BXZA 3JTTA 1MCKA 1GOGA 3F58L 5BS0B 2ZKHH 2ICEA 4NNPL 4ZOBA 3K81A 3UZVB 4P2QE 3WDJA 1D3CA 2BNRA 1SYVA 2EE3A 3BGFC 5M94B 2HKHH 3HI5L 3LB6C 4HZLA 3U30B 2JJSC 2LVEA 3G5YB 3TT3H 1F3DJ 1FYTB 1ZHBB 5AEAA 5A16B 5KVDL 1ZVHA 2EH8L 1G0DA 3K4AA 5IEKA 1C08A 3IF1A 3K80A 4F33B 3GSXB 1T7ZA 1IBGL 3FONA 3MRCA 4ZPTA 4R2GC 4S1DD 2C3HA 1OAQH 1PEWA 2EO9A 4POYA 1IC4H 2NW3A 4C4KT 2YA1A 2AJVL 1CLYH 3MYJA 2DIAA 3DSFL 4PJIE 3QDGA 5EIVA 2WAHA 3P4MA 4MAUL 3KPMA 4OUUB 4PBVC 4OFPA 1UZ8B 1YEKL 4JN2A 5GS2D 2BSTB 1C5CL 1A4KB 3IU4L 1XR8B 4N8PA 2PW2A 1WCBA 5FHBL 2Q8AH 4LEXL 1K6QH 2FR4B 4P5MA 2EDLA 1I9RL 1NAKH 3QULB 1HHKA 1CTNA 4BQ6A 3NFPA 1B88A 4HV8A 5MP6H 3T2NL 5F96L 1A3RH 5ANMB 3T2QA 1BEYH 2FECI 3BDBA 3X3FH 5F3BA 1FVCB 4HIEB 2WV3A 4U7SA 3S6CA 4P2YA 1OGTA 3IVKA 1I1AC 3IDGA 3QP3A 2HMIC 5J12C 3ULVD 1LK2B 2HH0H 3IDIA 4NNYA 4LSQL 5INCB 1F90L 4QHUA 4F9PA 4N9GA 3RHWF 4YEFA 5I16B 5J6GA 2OMBA 3ULUF 1AO7D 3TT1H 5C07D 4IOFC 4KC3B 4UB0L 3SE3A 2UV3A 3CXDL 1TTGA 3SEPA 1J12A 2OJZH 5A43C 2AS5M 4PRAB 4PJXF 3OMZA 4NBZB 1PLGH 1LO5B 3QWQB 2DQHL 3OR7A 2SEBB 3AU1B 4AIXA 3CPLB 2B0SH 4WDIB 2NCMA 5F88A 1CD9B 4QHKI 4XVUD 2AJXL 1II4E 2BY2A 4XX1E 2FO1A 1MJ7L 4NJAL 1ND0A 1HOCA 2H41A 2YWYA 3CXHJ 3PGFL 1F45A 3AMLA 4GQ9H 4EEEA 2GW5A 3FB8B 5E08L 4RMRA 4MA7H 2L7JA 5GGRB 1G7LA 5E7BA 4BELD 3TZVA 1M05B 1REIA 1ZHLB 4OM1L 3RL2B 1EK3A 1X5AA 4HEPG 3ES6A 5I1JL 4XGZA 2J8UE 2HLFC 4AMKL 4HCRH 2OL3L 3QAZB 5CJ8A 3S5LA 3LKPB 3H9YA 3IKCB 3I75B 5C0NC 3CFDB 5ADPL 1VEMA 1I85C 1ZT7B 3ARDB 2APVA 1GZQA 4HX1B 5LCVH 1S9KC 4Y4FD 5ESVB 2X1WL 1IRAY 2XOTA 5IMMA 3EDDA 4MDJB 3DARA 2JB6B 2NZIA 4K94C 1MFBH 2XZAH 1T0MB 1QKZH 2DTSA 4LHUA 4ZD3H 2CO7B 1W0VB 4QXGL 5ACZB 3WLBA 4HJGA 1WTLA 4E41E 2R2BB 5SWSE 1DN2A 4TTGA 3WMSA 4WWKB 3SDAD 4K3EH 5FB8A 2FJHB 5TPWL 1NGYB 4L29A 3IFOA 2E7LC 3X3GL 4JFEE 4NQVB 3H9SB 4G9FB 4HUMB 2VDNH 4GKZB 2BRRH 3Q6GH 3OJ2C 3UYOD 2WUCH 5F7MC 3ISWA 4M43L 3K4ZA 5CUSH 3F7QA 2EDRA 3MJ9H 2B2XH 3TC9A 2PKDA 2YD9A 3B4NA 1HNGA 4QCIB 4EDWL 2FATH 2AJZB 2PTUA 4JRYD 4XPTL 3VFNA 1J88A 3TV3L 1R24A 4LDOB 4UQ3A 1S7UB 1N0XL 4YIQA 5A2FA 1T89C 4G6FD 3GHBL 4MMXC 1KCUL 2R4SL 2H2SC 3MLWH 2GK0B 3NH7L 1ES0A 4M61A 3C08H 4ORGB 5CEZL 1E4WH 2OXHA 4RFEA 1IGMH 1KGCD 1CFSB 3QUKA 4PRHE 2ESVE 1NCDH 5DUBA 1LK3L 1A5FH 5E6ID 1IKNC 5FKAB 3SBWC 3OG6B 1S7XA 5FGSA 3VD5A 4B0MM 2VLLA 2ZCKL 1JPFA 4OB5L 3X13A 5FYJD 1JNNH 1YY8B 1EUUA 3HFML 4DKAA 3VU2A 4KK8C 4MSWB 1NGXA 3MUHL 4TSBH 5DD6B 3RUGA 1KLUB 3OR6B 5F89B 4NO0A 4BFGA 5I8CB 5T3ZH 3SGDH 2RHEA 3IDXL 2OK0L 3HPJA 1UM4L 4FQQA 1AGFB 4G6MH 3O3EA 1A3LH 1OT2A 4BQ9A 4AENA 3CFKA 4XPHH 5GZND 5IQ9A 3MJ7A 4P46C 3K7UA 3LY6A 1AXIB 3U7AA 3QUYC 4GSDH 4ODTH 3BPNC 2A0LC 1RIVL 2NPLX 2H45A 3JV6A 4LSUL 5HYJE 1YQVL 4GAJL 1OY3B 4H88H 4JQXA 4PUBL 5ADOL 5HGBA 3HTLX 3MX0A 4S2SA 1EEZA 2FEDD 4LGRB 4OFKA 4NHUB 4M4PA 1U8JB 2CIIB 1RUAL 1BX2A 3SKNA 3PQYB 5IFJA 4LLMB 2HRPL 3JXAA 5FYLE 3X14B 2FRGP 3VXPB 5A2KH 5HPMB 1B4RA 3CVIL 2WBJC 1ZVSB 3W2DL 3H9ZA 4JPIB 3N85L 2IFFL 4YE4H 3K2UH 4LCWD 4G7VH 5GRWA 2VDPH 4OLUH 1A7RH 2RBLA 4NP4L 2Z31A 4YR6B 4Y19E 3MNVA 3RGVB 4RISL 2EIDA 5AZEL 5HDBF 4ZO9A 2KDGA 3RVTD 4RWYL 4HFWA 2ED9A 4XBPA 3ARYA 5DHVA 4AH2B 1KTDB 3TN0B 4JFFA 1KEML 3AB0C 4ERSL 5C0BA 2ATPB 1F6LL 1PD6A 2CXGA 1QSFB 3KPLA 3P0VL 4LFHD 3FRUB 3ZE1E 1WFUA 4EQ2A 4PJBB 2V7NB 2VQ1B 1HWGB 2YN5A 1B0RB 1JGLH 3I3EA 1K8IA 1JF1B 1QA9B 2I60L 4H0GA 2NY7L 3V6ZA 3T1WA 4Y88A 5DC9B 1XCTA 5I6XC 2F5BL 5B39B 3DETD 3GMQA 3FOMA 2I9TA 3VXRD 1ZA6A 1KN2H 2B1HL 3GK8H 1DQLL 1LDPL 3VXME 1ITCA 3S35X 4I4WA 3MV9B 4WCYH 1MCPH 4IRSD 4HUUA 3TT3L 1HN1A 1ZEAH 4X6DA 3TNMA 1NC4D 1EFXB 1C8PA 2MCG1 2VZ3A 5DJ0B 4PJGF 2PCPA 1KIQB 4XWGH 1OAQL 1EEUA 5L8LB 2VXSH 3DJ9A 1KJMB 1H3TA 3KLAB 3HUJE 1CLYL 3QO1A 1ZLVK 5IT2H 2UZIH 3PWJA 4FQ2H 2V9TA 4DUWA 3FOLA 3WFDL 4CUCA 1A64A 1U3ZA 1Q9KB 1T1YB 1QBBA 3T4YA 1NEZA 2R0KL 3RTQA 1UXWA 3GMMB 1TETH 4KROC 3CFCH 2YRZA 2Q8AL 1DVFD 4G8GA 5CD5D 5IB5A 3BKJL 1FNEA 2BERA 1TVHB 2E6PA 2VR9A 2X4QB 3KPNB 4M6OL 4JY4B 1NAKL 3B83A 4KKAD 4ODXA 1QO3B 5MP6L 1CTOA 2DM4A 1A3RL 1MFAH 4X0KB 4BZ2H 1BEYL 2GSGB 3X3FL 5T5NF 4Y5VA 1DE4A 5SX5H 1U8OB 2AK4D 5IWLC 1I75A 1KG0A 5TGBB 1ZHNA 3FT2B 1QFHA 1MHHA 4LRIC 1S7SB 3ZE0E 3BP4B 1HK6A 4YHIA 5FYKD 1VFUA 1ROWA 1A7OH 3DURB 1QLEL 3FO2A 2OJZL 5TDNA 4X5WA 3V4VL 2C3VA 1PLGL 4FFWC 4FQ1L 4C4KO 2J5LC 1TVDA 4H25B 1OW0C 4XTRC 1RZ8B 5A3IC 3LEXB 2B0SL 2E27L 4APQA 1BOGB 4MNQE 2X42A 5GJTH 4M62H 5I1DA 2UYLA 4LLUB 4QT5B 4FNLH 5EC2B 2V5TA 3MBXL 5D7SH 3VFMB 1T4KB 3RNQA 3SE9H 2RB8A 3VJ6B 4L8BB 4MA7L 3LQAH 3P0YL 3LIZL 4MCZA 4KDTA 2XPGB 1BBDH 4M03A 5F7WC 3FT4A 5DSCB 4C83A 1J05B 1FO0A 1UQSA 3KWWB 2EYRB 5DURB 4PJIF 2WINB 3AREA 1BPVA 1EEQA 1IGCH 3BE1H 4XC1L 3QIBA 1F4WH 5IB2A 5DJYA 3GM0A 5LCVL 1P2CB 1S5HB 3EFDH 4GG6E 3FQUA 5DJDA 1G0XA 3MNWA 5JPNB 4Y1AD 5K59E 1IC7H 2V5YA 4X99B 3UBXB 3QT2A 4Z5RB 4FQXA 2VLKB 5GGVL 1L0QA 5GPRA 5IW3A 4PJXB 1NCCL 3GMLB 4NJ9H 3WSQH 3JV5A 2IH1A 4XVJL 5J11B 4MJIE 4TVPE 3X11A 1MI5B 5JNYB 4FQPA 2D0FA 3BEWA 5L8KB 1OWRM 1K5NA 1M4KA 5D71L 4GBXB 1Z3GL 4K3EL 4JPWH 5D7LA 4C58B 2R2EA 3O0RH 2KQNA 3VFGH 1X4YA 1S7VA 1J1XH 1XIWA 3OJMB 1BBJA 1DTUA 1FCCA 1I7ZA 1KTLA 3JV4A 2FCBA 3BEVB 2ZJSH 3T0ED 1JWMB 3C5ZB 3PJSB 1T2QL 4N5EC 3Q6GL 4BSVA 2WUCL 1BVZA 1QD0A 5GGSY 3F5WA 4K55A 3MJ9L 2B2XL 4W4OC 1IEAB 3MRGB 3VRLF 3O4LA 5DDHA 5LGHH 3WDIA 2L0DA 5HHPA 1MUJA 5HGAA 2FATL 3NFSL 1VCAA 5ELIA 1UM5H 1BF8A 3V5HA 4YHZH 5J06A 4TVSa 4PLOB 5FAAA 2MNUA 3T3PF 3MLWL 2D7MA 3PV6A 3LZFH 3C08L 2X7LA 3KPQA 1U8HB 4AZ8A 1IC5H 2CKNA 4PGDB 4BK4A 5J9PA 5JUEL 1YPZF 4X6FB 4JPVH 5EZLB 4ZAKA 1NCDL 5BRZA 1QUNA 4U0RC 4FQJH 3SDCA 4MQXD 3O2DH 4GKSA 5EU6E 3FAXA 4KQ4L 3ULUH 3ROLA 4PRBB 1OAKH 1CFTA 1ZANH 5D2NB 3O9WC 4JR9H 4WW2A 5CJOH 1BJ1H 1M7IB 1MAKA 2D7NA 4HS3B 5CJQL 4LLVB 4Y2DC 2HLAB 4TSBL 5C0GB 3MRNA 3MBEC 5C0AB 1T83C 4KKCC 4KGLA 1UADC 4J1UB 1WWAX 4KJWC 1YC7A 3AFLA 4KMTH 4OZIE 2WIMA 1A3LL 4JDZA 3PWPE 5GGQL 3ULVF 1EXUA 3TFKC 4DKDC 1J0ZA 1K3IA 4KKBC 4XPHL 3GI9L 3VXUE 3STBA 1I8KB 2AGJH 2FO4B 3CSPA 1X5HA 5DMKB 4PJ8D 3UMTA 4GSDL 2DN7A 4ODTL 3IU3A 4QWWD 4YDLB 4OGXH 4PGBB 5I1GL 2VLME 4H88L 2D03H 5JMOC 5JORA 4GRLA 1VERA 4PB0L 1V7NH 5T1KB 2DM7A 1BGXH 5I75C 1XGUA 1P9MA 3RI5K 3QNXA 2Z35A 5GS0H 4LPCA 4NQDB 5CJBA 5T3XD 3L3KA 2YPLD 4LMQI 4ZFGH 1CVSC 1RZIA 2VLRE 4JCMA 4YE4L 1JZ5A 5DD1H 1CXFA 2VDPL 4OLUL 3ZT6A 2PO6B 1IL1B 3QXUA 1CF8H 3HG1B 4YBHA 3S34H 3GB7A 1SJHA 4HDIA 3SE4A 3SPVB 2CLVB 1CG9A 5C0EA 3QWOB 4EQ3A 3HZMB 2XTJB 1EEYA 3QHZH 3SDDB 3GBMH 2CKBA 3UTOA 3BAEH 2VWEE 4CW1A 2A77H 4GRWF 5ENWA 4JO4H 1DL7L 4D0BB 1TZGH 2ZUTA 2PXYA 5LKNA 1FC1A 3OXRA 3QWRA 5D1QC 2BCKB 1UEYA 4WFED 4MXQC 1TCRA 3J8F7 4TUKL 2F53B 3F12A 3UC0H 5C08A 3S5LG 1JGLL 4G9DA 1PQZA 2AP2A 4LCCB 4LSSH 2WWMD 3H7BA 4X80H 4XMKH 1TQCC 2GITB 3VG0L 3DPBA 1J1OH 4NC2B 3QCUH 1KN2L 3GK8L 3IETA 4DGIL 1QP1A 4P2RD 3MV7B 4PG9B 4LHUG 4CMMA 4WCYL 4OD1H 5FUZH 1MCPL 5JR1H 1ZEAL 1OQXA 1BHGA 5H94A 5HGGS 1IE5A 3C6LB 2EICA 4QOKA 4XWGL 1Y0LA 2VE6A 1NKRA 4LPVA 3MRLB 4GUPA 2EDHA 3HZYA 4FQ2L 4KPHH 5DWUH 1GZPB 1YYLL 4EDXB 3GUTB 1XF3A 4NO3B 3RWFB 5BCAA 4OZ4A 1U8PA 4F15B 1WBYB 3TBSA 3K8LA 3MRJB 1RJZA 5B38B 4N0RA 1TETL 2RJMA 1EBPA 1NBYA 1DQMH 4UNTA 2XQBH 2NX5B 4ZXBA 4XXDB 1CXLA 3MRKA 5IF0B 3OAUL 1DQQA 5F9DC 5JMRA 5GGTH 4Y4KC 2ADJA 1DBJH 1MFAL 3EBAA 3FT3A 3DUUA 2PR4L 3D2UD 2YD7A 3KPSB 3W0WD 1U8QB 2OTWA 4P0DA 1KNOA 4WI8A 1T7WA 4B5EA 1QZ1A 2P48B 4HPYL 5F21B 4FFYH 1XAUA 2WQRA 2GFBA 4EI5C 3BP6B 1KOAA 1VA9A 4O5LH 1A7OL 1U92A 4D9QD 4OCWH 3WS3B 2BVOA 4A2LA 4DGVH 4JANA 3QA3A 4JRWA 3JV0A 3G5ZB 3BZ4A 3PL6D 5CD3B 2ZUUA 5E4IA 3EO9H 1AD9A 4KDVA 4F7MB 4FNLL 4OBSA 5KSBB 1JNHB 5BQ7B 5D7SL 3TVMA 1TNMA 5FK9B 1FZJB 5IVXE 1KLGB 1CZ8H 3P9LA 4RMUA 1UWXK 4X8XA 4Q58C 3MRFB 1BBDL 1QRKA 3DX9A 4LLQB 4X7TB 2NY0D 1NEUA 1RZKH 4AJ0A 5FO8B 1HCFX 2IWGA 2VYRE 5JQ6H 1AY1H 1IAOB 1L9NA 2IAMD 5I17A 1VPOL 4UZGA 1IGCL 3STLA 3TGXA 1KENH 2Q1EA 2GJZA 1K2DA 4HJJH 3ARFC 3FB7A 4O51B 3H6JA 4HG4J 4NCC2 1QSED 5C9JB 5HXMA 4XBEH 1IC7L 2MHAB 1HILB 5E8PA 4GH7B 3T0AA 5DC0A 5E1AA 3RZCB 4NJ9L 3KVQA 3WSQL 4QGTA 1GGUA 3ZYIA 2BMKB 1S9YB 1U8KB 1S8DB 1YY9D 3QNYB 4K23L 5CAYB 3S96A 3SO3C 4P57A 2P5WA 2UZXB 1EAPA 2ZOLB 2CH8A 4JPWL 2GT9B 2DI8A 3O0RL 4PY7A 3DO7A 4PRIE 5GISH 1J1XL 4I18A 4MQTB 4GT7A 4QHMA 2A6IB 4WO4B 4LLWB 2DICA 3W39A 5D7IE 2PYFA 5LWYH 4GMTL 4PJHF 2BVUA 4U3CA 1MLCA 5TDOA 3QIWC 4R7DA 1AQDB 4B7IA 1SM3H 2CJUH 1LDSA 2CIKA 2ZG1A 3VMNA 1A1NB 1INEH 4Q9RL 1YA5A 4XVSH 5LGHL 4IMLB 3DUSB 3UX9B 4K9EH 4M8VA 5C7XH 1ZVYA 1AO7A 2ZCHH 5I71C 1IM9B 5L2JB 3KJ4B 4ZO8A 5HHVH 1ZLUK 4QRRB 4WFHE 4LVOB 5JW5B 3CX5J 2ZPKH 4JPVL 5CZVL 4PFEA 4TYUA 2AXFB 1HDMA 4FQJL 1HXYA 4N1EA 3LDBB 2EDFA 1CXIA 5FUCC 3O2DL 3U9PH 1NCWH 5T33H 3GDBA 1UT9A 3VFWB 5H2BB 1ZANL 1TJHH 3VWKD 4L3CB 4CADA 1U3HB 5E5RB 4MD5B 1HQRB 1CGSH 4PJ9D 4RGNE 3S3PA 2GUOA 1GYAA 1T1XA 1IAKB 4IS6A 3TYFB 2K9UA 4YHPB 5K9KB 1PG7W 4IMKC 4KMTL 1N6VA 4WVRA 4UDUA 4Y5XB 2YUXA 4P5TA 5I1AA 2BNRE 4WNQA 2AGJL 4R7NB 3PHSA 1DEDA 3FKUS 3U9UA 2APWA 4Y8DC 2R23A 4OGXL 4XHJC 3GMPB 1SEBB 3RPIB 4KRPC 4PJ7A 4V1DD 2YK1H 1A3QA 4R90H 3WO3B 1U58A 1Z9MA 2GJ6E 2D7PA 3HR5B 1H0DA 4H1LA 1V7NL 3JUZA 4Q0XH 4Z76A 1LE5A 1UWEH 1RJYA 1YPZB 5FO7B 1FH5L 4JRXD 3PXHA 2NY6C 2DQDL 4CN4A 5GS0L 3MFFA 1ZLWH 3T77B 1P1ZB 4U49A 2XNAB 2IBGA 5IKCB 3LEYH 5C0IA 2J88H 5EUOA 1FVDB 4ZFGL 1WITA 2B20A 5I30H 4KUCF 5DD1L 1DLHA 3EO0A 4P59H 4P4RB 2FB4L 2Y06H 1AHWA 1CF8L 3PHQB 3LQZA 2OTUB 4MQ7B 3RWEA 1BLNA 3QIUA 3V4PL 5J13C 5A2LH 5J1AB 4RNRB 4NQCE 3B9EA 3BXNB 3P4NB 5F71A 3QO0A 4HXAH 1SMOA 1ZWIB 4LCIH 4EVNA 1B6DA 1UZ8A 1MJUL 2XA8L 1DLFL 3QAZC 3BAEL 3T8XB 1HSBA 3RL1A 2BSTA 1J86A 2FX9H 1TZGL 4HCRA 4P2QD 5EC1B 1L9MA 3D3VE 1YEHH 4R0LB 3SKOB 4G6JL 4LKCB 5GGVY 5IP4A 3BGMA 4OKDA 35C8H 3B43A 3UC0L 2NY3D 1OAZH 2E9BA 5E2TL 4LSSL 5GXBB 2O26U 5ERWA 4X80L 5ANMA 5I8EB 4HUVB 1IZJA 4NC1E 4Q6IA 3PNWB 5DJXA 3N1PC 1R3JA 4XMKL 2E6QA 4HIEA 1YEGH 4F9LA 1E4XH 1J1OL 4ODWB 3T3MF 5KSUA 4KKNA 1KUMA 3QCUL 2DWDA 4POZC 2B4CL 4XPFH 4Z7VE 4K8RD 5FUZL 4OD1L 4WHYH 3UTQB 3H9HB 5GS2H 3I02B 4U1HB 5F9OH 3OKKB 2DWEA 3QDJE 4PRAA 4W6WB 3KPRD 4PGJA 1GC1C 3ARXA 4PRNA 1KIRB 4KK9D 2ZZUT 3WFZA 1IAMA 4MNHA 4GRWB 1EX0A 1TJGL 5GGRY 4KPHL 3MXWH 4WDIA 5C1MB 5DWUL 3MLVH 2RFXA 32C2B 3Q3GA 4Y4FB 3QXWA 1ZLWK 1KYOJ 2AK1L 2OS7A 1CQYA 4OF8A 3VW3H 2DMBA 3VXSD 3ULVH 2X05A 1HI6B 1DQML 1BJ1J 5GJSH 2XQBL 1AD0B 1ZHLA 2D31A 2GJJA 2IPKA 4ZS7L 4I48B 4LAJH 4EXKA 1X44A 3QI9B 3SDAB 1DBJL 2BHZA 4EUPG 3WN5B 3M1BB 1NMCC 3QEQD 3QUXB 3CSYB 2YD4A 2CUIA 3D6GA 4X6EB 3V0WH 1I1RA 3V52H 5KVMC 1ZT7A 3ARDA 3MGAA 4F37K 5DRXB 4HPOH 3KYOA 3S3SA 3RWJA 4QGYA 3RIAK 1N6UA 4OQTH 4B53A 3SQBA 3PABA 2F8OA 4RFOH 4J8RB 2NXYC 2EDBA 4I77H 3OV6A 3BPOB 4QYOB 2FHBA 4L8SB 1TQBC 3FAWA 4NC0B 1PY9A 3SO5A 3DX7A 2R2BA 1QG3A 4DGVL 3NCBB 2HJFB 4JKMA 3L3GB 3GM8A 1R3LA 4G6FB 1D6EA 1RK1A 4PJEA 1NGYA 3L3JB 1F8TH 5BW7C 4JZOA 4S1QH 2F9BT 3V79C 4JKKA 4G9FA 4WUKH 4ZDHA 4F8TA 3QZWB 3PV7A 1K4DB 3GJEB 5SWZB 5DJAA 4GRWH 4M93B 3LKSA 1CZ8L 2ICWA 3SY0B 1VFBB 1KCSH 5KN5B 4QHLB 3NIDE 4WU5B 3G5VA 3RP1A 4JJ5B 4PLJD 4MA8H 1R3HB 4QF1B 3FQRA 4PLKC 1X4XA 4IRSA 3NAAH 5D9SB 3EFFB 5JQ6L 1AY1L 1OPGL 1FFOA 4E41D 2ZWLT 1TFHA 1RV6X 1KENL 4NN6B 3RNKB 2ZUWA 4M1CD 3OF6A 2AV7A 4XNYH 4XNUH 1ZGLA 4HJJL 4ORGA 4EOWH 1IKFH 3TIDB 2HVJA 4ALAH 1SEQH 5A2IH 4KQ3L 4Z95H 1HHGA 4AL8L 3VH8A 5EU4B 3VFUA 4JFED 3FQNB 4R4BA 1KJ2B 3OGCA 4S1RL 4QXUH 3TN0C 2DLHA 3CUPB 1OF2B 1OTTC 3G6AB 1MWAA 4WI2A 4CVXA 2QADD 4HUNB 3NCYS 3DHJA 4O2FA 5GSVB 3KLHD 1INDH 1DBAL 4JQIH 2QBWA 4CU7A 4P46D 4QRQB 1FLTX 2LTQB 2XKSA 3QUYD 5AD0A 2AQ2A 1P69B 2EXWC 3BKML 4C56E 2DYPD 2YC1B 3GHEH 2X9WA 2OQJA 2ESVD 1SM3L 2CJUL 4FQLL 4BH8B 4AT6A 1DBBL 3QUZD 4NT6B 5EBWA 5DRNB 4XVSL 4DEPB 2VXVL 2GY5A 3VXOA 4K9EL 1EMTH 2WBJD 1UM6H 4WUUB 4BH7B 2ZCHL 2ZP0T 4NHUA 4UT7H 1U8JA 2DOCA 5IFAL 1B0WA 4JHZA 4N0FA 3P77B 5DQDH 3EYUH 3DXAB 5I2IA 3L3DA 5MEQB 5ECJE 5EIQA 1NLDH 3PGCA 4LLMA 5HPMA 2ZPKL 1BQHG 1ZVSA 2J6EH 3DV6B 1G6RA 4JPIA 4JFFE 2A2QT 3DX8B 5FM4A 5C0BE 1Z2KA 3OHXA 2I07B 3U9PL 2ENYA 1QEWB 4ENEC 4JQXC 1NCWL 4B41A 3DYOA 5T33L 3BHBB 4YR6A 3O3DB 2VC2H 3KYAA 1RURH 3F7VA 1TJHL 5IBLD 4UT9H 1KJ2H 3T4AB 3RGVA 1CGSL 5C92A 5HYJD 2VQTA 1N2RA 4F7PB 5HGDB 4I3SH 3TM6A 4PJHB 3H8NA 4MNGA 2IPUG 2GSIA 2ATPA 1N7MH 3HE7D 4N0UA 1CDHA 3OKMB 3UZEA 4YUEL 4NBXB 2EDWA 4Y0GA 1J0IA 2MPAH 4PJBA 4WENB 2VQ1A 1B90A 1JMZA 1B0RA 1D6VH 1UJ3B 3CDCA 1JWUA 3MCLH 3OB0H 2BX5A 3TO4B 3QXAB 1XGQB 3BH9B 4BYHA 1BIHA 1T1ZB 3I6LD 3KHOA 2YKLL 4K71B 3UTSE 3QHTC 3THML 3MV8A 5EB9A 1UWEL 1RY7B 3JVGA 5D7IF 1N3NB 5F9AC 4BM7A 5IFHH 3C9NA 1DVFB 1G7MB 4KV5F 3LEYL 2J88L 3BPLB 4TTDC 1A9BA 5DC4B 4F8QA 4P3CL 1SBSH 3OJVC 1QLRB 4PYHA 3G5XA 4R96A 4JN1L 5DJ0A 2Y06L 4LKXA 1IQWH 3D1MC 1KIQA 3EYSH 5EZJA 2YD1A 5C09A 4YJZL 3L3HA 3UXFA 4X5LA 1XF2B 2Q6WB 3CDYA 3UJIH 1NFDE 1WSST 2AK4B 5ID0B 3RVWC 4ONGL 3MLYH 3WL9B 4LVNB 2E9WA 1A4JA 4U6YB 4I0PC 1OQOA 4PV8B 4HXBH 1FZKB 1A9EB 3ZHLA 2FX9L 2OP4H 3IXTA 4IRZL 1M71B 5GHWL 1DBMH 2CK0H 5DJ2B 3KXFB 5JIIA 5HJ3B 4JM2C 1MRFL 1G1CA 3D0LB 3KPNA 2DMCA 35C8L 2HRLA 1OAZL 4JM4H 2EIBA 3S9DB 4QRPE 4PP1C 5I1CH 1NJ9B 3LRSB 3UTZA 3OB8A 3RTQC 3FMGH 1E4XL 1O0VA 5F6IC 4X4YB 1CGUA 2I26N 5IEHB 1KPUA 3OAZH 4Y4HD 5TDPA 3HHRB 2HT3C 4HAFA 3W9EA 3GSWA 1X5ZA 4CJ0A 4JDVB 1CLZH 1EHAA 3P40A 4BFEA 4UIMA 5F7FA 1T7VA 4XTRD 3FQWB 2FZ3B 3HZVB 5DI8A 5GIRB 2FIRT 4PGCA 5F9OL 3RVXC 4G80B 1UG9A 4Y5VC 5D7JB 1ZKAA 5DVLA 4A6YA 2XWTA 4GG8B 1J8HA 3CMOH 4G8IB 5M95B 5JQHC 2YXMA 4OV5B 1KT2A 3V5KB 3LOWA 4HKXB 1GL4B 5IMOA 3MLVL 1JHTA 4H26B 5GS0C 3BRDA 3FTGB 3MTRA 1AP2A 2H3NB 3ILPA 4Y1AB 5K9QI 5I66A 3VW3L 3CH1B 3IFNH 4KK5D 4O02L 4J3UA 3VJ6A 3ULVL 3HRPA 4L8BA 5FXCH 2XPGA 3EGSA 2P24B 4FABH 1I3GL 2XZQH 5J1SC 1IGFH 1VEPA 2WZPD 4LHJB 4YHLL 2YPLA 3KWWA 3QH3B 4EN3D 1G9NL 4QLRA 2R2HB 1FNSH 1I3UA 4UOW1 5JTWA 2RGSA 3RWHB 2R1WB 3V0WL 2CDEA 5D2NC 3OX8B 5E95B 4E0RB 4N8CL 4OZGB 5HHOD 4HPOL 2Q86B 1BWMA 4Z0XB 2DDQH 4MNQD 3O6LL 4KDTC 4TSAL 4G3YH 4X99A 1QRND 3S4SB 4RFOL 3GMLA 4I77L 3MR9A 4ZUUB 3FO9B 1I7UA 4PJCE 3AREC 5L2KA 5EBMA 1HSAB 1RJLA 3K46A 1WFTA 4GBXA 1A7PH 4N5ED 1B2WH 1F4HA 3QFJD 5IW6B 4G5ZL 1Q0XH 1KEGH 2W59A 1BWWA 4S1QL 5E5MB 2B4CC 3BEVA 4CN6A 3FQXB 2IANE 4WUKL 3VI4E 3GMOA 4Q6YA 4QHKJ 3HCVA 3HC3H 1D9KD 4RBPH 4UNVA 1FLRH 1AKJB 4Z9KB 5IOPB 1MREL 2DQCL 2W92A 4KK6C 2ZUQC 3LPGA 4MA8L 2V9RA 3ZL4H 4KJYB 5JDSB 2PO6C 1LMKA 4HHAB 5DLMH 3RY5A 5F7UA 3L6FB 1ZE3C 5FOJA 1RAMA 3T1FA 1CGWA 2VDLH 1QFWI 3MRQA 4JY6A 4XNUL 4XNYL 3GO1L 3M8OH 4EOWL 1YYMH 4MCYB 5HYFA 4ALAL 3RDTA 1SEQL 4PGDA 3HC0B 3C87A 4KHTH 4X6FA 3D39B 3LD8C 2XTJC 4PJ8B 1JK8A 3NN8B 2VXQH 3DGCR 5CZXC 3IXAA 4NM4L 1KPVB 1CR9H 1G9ML 4QXUL 5EO1A 4Z7WE 4KJWD 4H8WH 4PRBA 3WIHH 3ARGD 3B5GA 5FGCE 5C3LD 4JB9L 5I9QB 1M7IA 4HS3A 4UQ2A 1SY6H 2FYYA 3CH8A 5C0GA 5IM7B 4JQIL 3RVUC 2YD2A 1KCVH 2CRIA 3BKCH 4C55A 1IMHC 4OTXH 2BVTA 4ZAKC 2C3GA 5L9DH 2UVEA 3SDCC 4R4FL 1X5JA 4XNXL 3ZDYF 4MD0B 1EV2E 4XAWH 3WIIH 1NGZA 1W8OA 1XEDA 3W0WA 5B22A 4WW2C 2FDBP 2AV1B 5I8OL 2OR9H 3DIFA 5IHUH 4MWFA 5FYJL 2DBLH 4HWZB 3P9MB 3C6LC 3VRIB 5T1KA 4E9LA 3GSVB 5E9DB 4DN4H 3SDXA 1YJDL 3EYUL 1RJCA 1FRGH 4U6XA 1D5XA 2F19H 3QCTH 5BOPA 3I2CL 4HMCA 4RBPK 2E7CA 4NRZB 4DN3H 2H6PB 3PWPD 3VG9C 3INUL 4PGEA 1P4LB 1VFAB 4ZFZA 3NZ8B 3L3IA 5HHNB 3HG1A 3T09A 4GRLC 1E6OH 5CIPA 3CCHB 4NQEE 1RURL 2P44B 4UT9L 3SPVA 1P9MC 2Q3ZA 4KTDH 3E6HA 5EZOL 1RZJH 3C5JA 1TPXC 8FABB 2VLMD 4X7DC 1Q0YH 3IFLH 2ADIB 1NL0H 3V95A 1AH1A 1U6AH 4OGZA 5MENA 2MCPL 4DUXA 1MCQA 3GIVB 2JJTA 4BFBD 3WFCL 5GGTA 1KELH 3OL2A 1RZFL 1J5OL 1N7ML 4N0CC 2HTLD 2F74A 5T3XH 2HJKB 2MPAL 4KUZH 1D6VL 3HPLA 3MCLL 4OGAC 2AJ3B 2DQIH 3T0WA 2JK5B 5I76B 5J8OA 2C1PA 3AROA 4LOUC 3EOBB 5D70H 1RIHL 1F4YL 4X7EC 4ODSH 1ZAGA 3FL7A 2PXYC 1T21A 1QQDA 3U7YH 3U6RB 4PJ5E 4F7EB 1FZOB 3MV7A 1TVBB 3REVB 1JGDA 1G7IB 2EC9T 3SJVB 3OG4B 2XYCA 1LEGB 3WXVH 2KQMA 2Z91A 3BQUD 4CDGC 4HUKB 4X6BA 2YUZA 1IQWL 1W2KT 2BSED 2G5BA 2C4FU 5DZNA 3BIAX 2WK2A 2RQ8A 1ZLSH 4O2CA 3UJIL 3UO1L 3O8XC 1N5AA 5CEZE 3EW3B 1LP9A 3MLYL 1HH9A 1KTRL 4QO1A 4EDXA 1NC2A 1F58H 3VMOA 2X4PB 4TNVK 1O7SA 3PE9A 3S97C 4HXBL 1WBYA 2CQVA 2VTFA 4PREB 4Y4KD 2CDFB 3IAQA 3G6JB 1DBML 1BAFL 5F70A 4FZEH 1J10A 4M7LT 2NLJA 3LV3A 3CFBB 2H1PH 4JM4L 3SKMB 1BFSA 4GKOA 5BV7B 5EU5B 4CVZB 1TZHB 3RZCC 5I1CL 3O41B 4X98B 1X5GA 1LO2L 2C1OB 2OBGA 3MLZH 3HLAA 3PL6B 1D5MA 3KPSA 4ZSOE 1BD2D 3FCTA 4I2XA 4GLRI 4X6CA 2G5RA 5J3HC 4U1MB 4MJ6B 3ARPA 3WFBH 3VGAB 4ZXBC 2QJDA 2P7TB 1UVQB 4PJGA 4U4BA 1CLZL 3O3BB 2V5SA 1H3GA 1JF5A 3LSOA 5DXWA 3I50L 1EJ6A 1MNUH 4TUOA 1JHLH 2IALA 4RMWA 1EJOH 3L7EA 1PG7X 4YO0A 4R4NC 2P43B 3WS3A 1C16B 5ICXA 2EZ0C 1T66D 3DROA 1SBBA 5DJZA 3G5ZA 5KAQF 2YZ8A 2NY1D 5CD3A 2AKRB 2EDQA 1QSEB 1YEFH 4HBCL 1PJ9A 1RHFA 5BQ7A 3O2WH 3IFNL 2DKMA 1HZHH 1HINH 1KLGA 3GMNB 3BO8B 1BJ8A 3KJ4C 2DIJA 3IDMB 4YZFE 2FL5B 4L9LA 2EDNA 4FABL 3MRFA 1MOEA 4X8JB 5D1XC 3BVNA 1JRHI 2C7UB 4X7TA 2OI9B 3ARFD 4KI5E 5FFLA 4JVPA 1ZGLP 1IAOA 4YK4C 1FNSL 2Q7YA 5FV1L 5DFVC 5IG7B 3U46A 4P4KA 1VB9A 1PFCA 3TVMC 3OZ9H 3TBVB 4CMHB 5BV7H 1G6RL 3DOSA 1ORSB 5MEOA 1YDPB 4DTGH 5IHZA 2MHAA 1HILA 2JCCE 1DR9A 4J3TA 5KG9A 1KCRH 5DFWH 1HXMB 4ODUA 2AQ1A 1I3RA 3QUMB 2ED8A 4FTVA 2I5YL 4XXCA 4YHML 5IV2A 4J6RH 4MS8D 2BMKA 1OGAB 1S9YA 2CDGB 2IH3A 3MRIB 3I6GA 2K7QA 3DTXA 4P2QA 3LKQA 1A7PL 2WANA 1KJVA 4S1DC 1GOFA 3VD9A 1B2WL 2GT9A 4F58L 1Q0XL 3OWEA 4K3GA 1KEGL 2BSSA 2BNQB 4HIHB 1T03H 2GAZB 2ICCA 4PRPE 5TE4H 4DVRH 1CICA 2A6IA 5DHYB 3TNNA 2X1PA 1W72A 2FHCA 5DFTA 4GW1B 2D9QB 2GCYA 3P2TA 2DQFB 4HWBH 4JFQA 4WW1B 1INQA 2A74B 4D94A 4PJIA 4ZUWA 1A1NA 2R29H 3FB5A 4L4TD 5B39G 3TPKA 3L5XH 2XN9B 4PJ9B 4LF3A 2I24N 2OR8A 3F6LA 5M7QA 2W0PA 4I18C 3TA3B 43CAB 4RGMB 5DLML 2VL5B 2H32B 2MTPA 3MOQA 5CBAB 1UZ6F 1WBZB 2C3XA 2VDLL 5D8JH 2EC8A 1CGYA 1YYML 1KB5B 3GBNL 5ALBH 1OL0A 2ARJA 3N1FC 3QYCA 3S3JA 4M3JA 1MY5A 5CEYB 2AXFA 4OCNC 3WS6C 4P2OA 5DQ9A 3PXJA 4ELMF 4ZG1A 1HIML 3C60B 5E94A 4KWUA 1I1FB 2EKSB 4V1DB 4PJAE 4UT6L 3WIHL 2V2TB 4RQQA 4W4NA 3BGFB 1OAXH 1P7QD 2W60B 5K93A 1UKQA 1G9NC 5I1HH 2BNUB 4UU9B 1AI1H 5I1EL 2N7AA 3IS1X 3MRBB 4JRXB 4NRYB 4P3WA 1H15A 1U8MA 4YHYC 1F42A 5DD5H 1MFCH 1KCVL 5EUKA 2VDML 5FECA 3QHFH 3TBWB 5E8EA 2X4OB 3ECBB 3QQ9D 3L7FA 5BS0E 4XAWL 4P23A 1UC6A 2C3WA 4WFHD 2IPTH 4R7NA 1NDGA 4MA3B 1FYTE 1I1YA 3QNZB 2OR9L 1SEBA 1QR1A 1JFQH 5IB4A 5IHUL 4NO5B 5IMKB 1OD9A 4PD4J 2DBLL 4HKZA 5AAWA 5I18H 3GGWA 2UWEF 4RGND 3LKNB 3QB7C 2E3VA 4F3FA 3HE6D 4NRXB 2J7LA 3T77A 5CLWA 4QRTB 2XNAA 3QCTL 2F19L 1FCGA 2J8UA 5C0RH 5HHXH 5FUCE 3LN4A 2H32H 2Q8BH 1OSZB 2P5ED 1UB5B 3D5OF 4UDTB 4UV7H 3N9GH 5HTSA 3EO1A 5FM5O 4X4XB 4XPGH 1D5BB 2NY3B 2IMMA 5ICYA 2DQUL 2BNRD 1KB5H 3FN9A 3V5DA 4QY8A 2OTUA 1MAML 1Y6MR 4XWOD 4NKOA 5JHLH 4OF0A 4C59B 3BPCB 4KTDL 5ITFB 1RZJL 5ANME 2F54B 1Q0YL 3TPUA 3SDAC 2GJ6D 1NL0L 1T0PB 2EEAA 1U6AL 3O3AB 5EBLA 3QEUB 3WN5C 3MA7B 3HNTH 3VGEA 4NKIH 3QDGD 3U7WL 1CGVA 1KELL 1UGNA 1VKXB 5E8OB 4F2MA 1AHWC 2J4WL 3CLEL 2LQRA 5SWSA 3FRPA 4LPUA 1G9MC 4FP8H 5JPMB 4Z7WF 1DP0A 3L5WA 5FA4B 4LQFH 5CILH 5T3XL 3KPRB 1IGIH 2CUHA 4QNPF 1Z9OA 4DJMA 2NW2B 4POZD 2DQIL 1B6UA 5I8EA 4FN0A 4S10A 2YD6A 3QJHB 3EYOB 4K3DL 5D6CA 3CFJB 5D70L 4ZFOB 3BN9D 1Z5LB 4ODSL 3TCLA 2EXYD 1MRDH 4WTZA 4N90E 4NNXA 1AJ7H 3UBXG 3U7YL 4Z6AT 3VXSB 5JA8B 4IDJH 2FIKA 5DYOA 3JWNC 1T1WB 4TRPH 1OAUL 3WXVL 4LPWA 4FRWA 2ZOKA 5C6TL 3UCRA 3D3VD 4L1HA 1LD9B 5E6IC 3MPCA 4L8CA 3OKKA 1NMBL 4XP5L 4F9LC 1MRCH 2B8OT 1TMCB 4X7SH 1ZLSL 1CBVL 1AE6H 3QEQB 5KVFH 1T22A 1MCRA 4PRHA 2ESVA 3M17B 1K3ZA 4L3EB 4XNZC 5TQ2H 1FVEA 3VDCA 1Q94A 1YJDC 1F58L 1YEDB 4HWUA 3RPKA 3WUWB 1UACH 3GSOA 4YPGA 5SX4I 3KNBA 1G7HB 3BMVA 3QEHA 4HH9A 4FZEL 3FFDB 2YUVA 4HK0B 1PSKL 5EO9A 2H1PL 4K8RH 2Z4QB 1P4BH 1SVZA 4WJ5A 4U2ZA 3E3QE 5K9OB 3GRWH 5T3ZE 5FKPB 3PDOB 1IZKA 4JKWA 3QDJD 3TZVD 3WIFB 3VI3E 2XY1A 2VDRL 1T20A 4I9WE 4NZDA 4BZ1L 1ZA3A 2NXYD 3AVEA 3ARRA 3FQTA 1MIMH 2FEDC 4M5YH 3WFBL 4HUXB 4WEBH 4ETYA 3TJHD 1NANH 5B8CC 5HYJA 3H9SE 4G9FE 2UUDK 4J8RA 5H35A 4NSKB 1JHLL 4QYOA 3ZTJH 3CDGB 1EJOL 3HNVH 5EU3A 3DI2B 5DT1H 5KVGH 1DUZB 4E5XB 4HIIA 5FF6B 4WY7H 4HS8H 1G7PB 4OSUL 1VFMA 4F7TB 4NYLB 1KBGH 5IMLA 2HJFA 1A1OA 3BH8B 3ZKND 4LHUD 2FSEA 2EYSB 4HWEH 2GTZA 4NHCL 2VAAB 1CDYA 2DJUA 5BO1L 1C12B 2BSRB 3OQ3B 3WHE1 1YEFL 2DB8A 4K94H 4XP9H 3RVTC 4NUJB 3O2WL 3MOAH 5T1LB 4GXVH 4Y19A 1D5ZB 3DX6B 3S37H 3ARBD 3OXSA 3BJ91 5LGKA 1VFBA 3B9KD 4HIXH 4M02A 4K3JL 3VA2C 4WU5A 3PWVB 4JJ5A 4HC1H 1F2QA 3G04B 5DJ8B 5JZ7C 2DL2A 4JLRB 3VWJA 4FG6D 4GAGH 4P46B 4OI7A 2Y5TB 2NR6D 1R5VA 4OI9A 3QUYB 3EJJX 3D69B 3KYKH 2W38A 3BPNB 2DF3A 2XG5A 2XACC 4YGAB 1JGVH 3OZ9L 3DETC 3GMRA 3RBSA 3BKYH 2QHRH 1FN4A 5BV7L 2DYPB 1OTTD 3SE8L 3FQNA 2MWCA 1KJ2A 4ELKA 1KCRL 4OF6A 2AEPH 2AJYH 3B9VA 3CUPA 3GSRA 4IRSC 5E8DH 3PWLB 3G6AA 4EI6A 1XGYH 4QTHB 2WBJB 2BY1A 4RMTA 5GSVA 4DW2L 5DVKA 1DDHB 3PWUB 1IT9H 3VXMA 5BXFB 2E7MA 1P84J 4ZS6D 4WI7A 1E0OB 1X7QB 4WEMB 1NFIA 2BVPB 1CFVH 3VCLB 3SGEH 4DVRL 5BVPH 1XF5B 4ZNEA 2VN4A 2P46B 4NO0D 2V6HA 2FJGB 3PQYE 3TH2T 2WUBH 1HHJB 3HUJA 2A83A 4HWBL 1EDQA 1JHKH 4HIJA 4M7KL 3NMEA 2R29L 3V0VB 1DVFC 4Y4HA 5CD5C 3AB0B 3L5XL 2CMRL 3L5HA 3KLDA 3BIKB 2XT1B 1S7TB 4HT1H 4KKAC 1CDUA 4WUUA 5CMAB 4Z18A 3T0VA 1T0NB 1KC5L 4LEOB 4ZNCD 1JTPA 3EYVB 2VLJB 2EYTA 3VFRB 3DXAA 1S7RB 5MEQA 3HE7B 3NIGE 5CSZA 4EIZC 5I6XB 3LKOB 3WYRA 3HAEB 1NLBH 5EORL 1RZGA 1FG2B 2I07A 3WJLA 4KJPD 1QSFE 5BOZG 1EHLH 3BHBA 1A14H 2PYEB 1QTYT 2R1XB 4PJBE 5FUOH 5I73B 5I1HL 1IILE 1P7KB 3KDMB 4YHKH 2V7HB 1CI5A 2A9NL 2Z31D 3CVHB 5GZOD 1Q9LB 5DD5L 1F02I 2ADFH 5HGDA 3U1SL 1MJJA 2D0GA 4JHAH 5B38G 3MUGA 5IR1A 2AI0H 4ZPVA 4CDHA 3QHFL 1OB1A 4LVHC 1EAJA 5FO9B 1A47A 2IPTL 3DO3A 4U2YA 1ORQB 1YQ2A 3MV9E 1AGBB 2HTKD 4JZJA 3IGAB 4P99A 4JFFD 1AGDA 1UJ3A 5C0BD 4JGUA 1DN0A 1JFQL 5CS7A 1ZT4A 4KMLB 4GW5B 4KROB 4MNQA 3BH9A 5D1ZA 2FLRT 3JSSA 3PHOA 2HWZH 4GKNA 4TTDD 1ITBB 3QQ3A 3WEXB 4E42A 5I18L 2VRAA 2JB5H 3RWGB 4ZUSA 5F9WC 3GKWL 4ELMB 1QLFB 5FM8A 1C1EL 1G7MA 5EIIA 4PYGA 1CT8A 1JIBA 2R0ZH 3MCKA 4Z78B 3N9GL 1QLRA 4XPGL 4FFZL 1S5IH 3D85A 1KB5L 1F00I 3NIFF 3X17A 1R5IB 2QSCH 4U1SA 1G0YR 5HYSB 3HAEH 9CGTA 1FSKC 3JVGC 2Q6WA 1ZT1B 3RVVD 1D9KA 2AVGA 1PEZA 3VDAA 5D2LF 3WL9A 2GKIA 2RCSH 3L95B 2YN3A 3O11B 1BVLB 3HNTL 2J5LB 4MJIA 3BYYA 5INDA 4PP1D 3CVHH 5IQ7H 2K3TA 3T0EC 5T5NG 4FXLA 1JI1A 3ROOA 2IQ9L 1BZ7B 3D0LA 3RTQD 4LQFL 1KV3A 1YECH 1IGIL 3U79A 2KUTA 2BVEA 1XCQB 1RHHA 4JO2H 4BSWA 4YBQD 4G8GD 2UWEB 2Y6SD 2HT3D 1FPTH 1NJ9A 4W68A 5E2VL 3QJFB 2JJUA 5F7DB 1XT5A 4OLVL 3BP5B 4IOIA 1HH6A 1ZSDA 3ARGA 1MCHA 1F4AA 1U42A 3E6FB 2A6JA 4TRPL 3K8KA 4J3SA 5GS1B 4ZTOH 1T5XB 3FQWA 5GIRA 2W9DL 2ILLA 1NGQL 3EOAB 4D9RE 4MQXC 1QNZH 4OBRA 4QTIH 1MRCL 4X7SL 1BQLH 3RAJL 2D4DA 1JCKA 4RAUB 5KVFL 1WT5A 4OV5A 3U36A 1JV5A 5ALCH 1OOAA 4AIZB 1FV1A 5KW9L 4G7YL 1E28B 1OTUD 5FOBB 2A73B 3P4OA 5TQ2L 3RWIB 5DGRA 5HHOB 4H26A 4PRDA 2CD0A 3FTGA 1U8IA 5EU6A 4JEGB 4IIQA 3WHXA 4YFLI 1QRNB 1S9WB 4NPYB 1BVKB 1UACL 3ULUE 2BVQB 5F7NC 2NTFB 1T04B 4JCLA 4APQD 2DAVA 2JLLA 1V3KA 1GH7A 3C5SA 3VXTA 2R56H 2P24A 2VLKE 1G7JB 4PJXE 2XI9A 5CGTA 4K8RL 4XVTL 4WFFD 2DLIA 2VIRA 4PJ8C 4FXKB 4QWWC 3QH3A 3QFJB 1MI5E 4OZIA 3O3UN 1Y18A 2IQAA 3PWPA 3F58H 3RWHA 3VXUA 2R1WA 5E6YA 3HI5H 1W0WA 4NGHH 2HP4A 2EH8H 1VGKB 2FH6A 1OP3H 5D5MF 1XGTA 1KB9K 1IBGH 4ZFOL 1SY6A 3QIBD 5FCSH 3V8OA 1ZHKA 3R8BB 2AJVH 2FBJH 3GI8L 2QR0B 3DSFH 2EEDA 1HSAA 3LQMA 5KVGL 4P5KB 4FQXD 1XR9A 2ZSWA 4HS8L 4WY7L 4G6AD 1KBGL 4U0RB 3T0DA 2VN7A 3MNZB 1JWSB 4L1DA 2BOCA 5IW6A 5F1OB 1YEKH 3F7PC 3W5MA 3G6DH 3OAYH 1LO3H 2AEQH 2VLRA 3IU4H 1MELA 1DEEA 3DSNA 5FHBH 1V5JA 4XP9L 4Y2DB 3G9VA 2VH5L 5ILTH 3OPZH 4OKVB 3MBEB 1RI8A 2HFEB 5JO5B 4FXGA 4GXVL 1XIWD 2Z92B 1CFQA 3DRQB 3S37L 3DYPA 3PWNA 4L8DA 3T2OA 1AKJA 5IOPA 1CXEA 3U4BH 1NCNA 4XX1G 1ETZA 5C6WH 5IVOA 1MFNA 3DGGA 4HC1L 3V6OE 1K4CB 4WHYG 5D2NE 4CN1A 3KYKL 2PW1B 5F1KC 1CXHA 3O4LD 3O4OC 4WHCA 4CU6A 5C0AE 1JGVL 3TLRA 3BKYL 2QHRL 2MQ0A 1PYWA 3K2MC 4UB0H 4N8VB 2YUWA 2X4NB 4ZOAA 4TNWK 5I75B 3D0VB 4ZODA 4X5XA 4J3VA 2CXKA 4PTUB 1S7QA 2BOBA 2IGFL 3X12B 2DQHH 4ZAKD 5BRZD 3NABH 4M7ZC 1A0QH 1XGYL 3SDCD 1EERB 4U1LB 4HEME 5EOTA 1VADB 3V6FA 3T65B 4NJAH 1XZ0B 2NY5L 2XQYG 3OSKA 1CFVL 5BVPL 1C7SA 3EUUA 3FRPG 4OFYD 4NQDE 4OM1H 5KTEH 2WUBL 5I1JH 2HJLA 5C8JA 1JHKL 4U33A 2IBZY 2NXZD 4BFIB 2ADGA 4BQ8A 5BVJB 2X70A 4LLDB 5F93C 2FHFA 2L4OA 1WGOA 5EDXA 1IM3A 1H8SA 3HG1E 5ADPH 4HWZA 5D1QB 5E24E 2O5ZL 1NUDA 3UAJD 3VRIA 3HKFA 1YMMB 4KXZH 3ARSA 3PG2A 3GSVA