5KSBB

T15-dq8.5-glia-gamma1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
189
structure length
179
Chain Sequence
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 179
sequence length 189
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksbB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksbB01
1HIML 3O41B 3RGVB 4CDGC 4HW6A 3S9DB 3H3PH 3ARBA 5GSVA 3JWDL 2NW3B 3O2VL 4A6YL 4EOWL 1WF5A 4MNQA 4XVTH 2R1WB 3FFDB 3VH8G 1HCFX 2YEZA 3KJ6H 1NC2D 4LCYA 5C3LD 1KELH 5F3BA 4RGMB 5IVOA 5AD0A 4CW1B 1R3HA 3BUTA 3JVGC 1QSEE 3NN8B 2COQA 4WEMB 4XC1L 5D2LF 4RBPH 5FYLL 4YQXH 2ARJQ 2X4NB 3L5HA 1T4KA 4P2QE 2UWEF 4HKXA 3RJQB 1MHPL 5E9DA 4HPYH 4KK6D 2BNRB 2EIZA 5T1DH 1D5ZB 2ILLA 1NGZB 2H8PB 2I9LB 2R9HD 3A6BH 5C0DA 3PWVA 5HYSG 3O6KH 1U9KA 5EUOE 4G5ZL 4PY7B 3V0VB 1CGYA 1C5BL 4OI7A 4YHKL 2JELH 4I77H 1GRWA 5GGSA 4JRWA 3GB7A 5DJCB 2XKNB 3QO1A 4MHHI 2VR9A 4M1DH 1HH6A 3LSOB 4RX4A 3D2UB 5KVGH 1F3DH 4X5LA 4MS8C 4GXVL 3TA3C 1DBJL 2EE2A 4AZ8A 1XGTB 1JTTA 5GSRA 4CVXA 4OZIA 3LEXA 2Z31D 3C60A 4Q0XL 1NGXA 1TVHA 5I76B 2PXYC 5DURB 3VFSB 4V2CB 2GIYA 4KROC 1A7QH 4QOKD 2Q6WA 1JGLL 2FJFB 5D7LD 2YD4A 2VLRE 2GUOB 4MXQC 5F3HB 1FFPA 3SDCB 3NCJH 1WT5A 4JRYA 2HN7A 2V7HB 1BF2A 2PW2B 3IXTA 4RAHA 3SKNA 3ZSTA 1X7QB 1LEGB 1FFOB 1UM5H 4ORGA 1XGRB 4AH2B 3CK0L 3K8LA 1LDSA 1FC1A 4PJ7B 1Y6NR 2QBWA 4X8JB 3UO1H 1FL3B 3PP3K 3QNZA 4OCYL 3VFOA 4QNPE 1CDCA 2FO4A 3QWOA 4MNQE 3EO9H 4P4RB 3GDBA 3WO4B 4LSRH 3ARBC 4LVNC 3QWQB 1IGIL 5DLMH 3ULUH 2AQ1A 4N1HB 1FFRA 4NKMB 1QTYT 1TXKA 3HE6D 3JV4A 5FDWA 3VFWB 3H3KA 2HJFA 3ZTNL 3RP1A 2ZNXA 4KQ4H 5E9DE 2FEEL 3ILPB 4GS7B 2B5IB 1FL5A 1XEDA 3H2WA 5FOBA 3O45B 2NXZC 5EZIL 3GMNB 2KPNA 4YNYA 2Y9RT 3VFVA 3BH9A 3HAEB 4K23L 4MXVE 4N5ED 4KQ3H 5BRZD 3TH3T 5JORB 3PWPD 5JXAL 2QSTA 2AJSH 2R0ZH 2HJLA 1GOGA 1MLCB 3AB0B 1U58B 1J10A 3S36X 1UKQA 4EI5A 2AW2A 5E8NA 4IJ3C 4KZDH 1MFDL 2Y06L 4G9FD 4MD5B 5ALCL 1MJ8H 4JM2C 1TVDA 4QYOB 4RAVB 2DOCA 5D2LB 5CZVH 3QQ4A 4OZIE 3RDTB 1W72L 1WITA 4G3YH 5BVPH 1MAML 3QUYC 4XX1E 2IADB 4Y19A 1D5IH 2AI0H 5ECJE 4QRPA 1EHXA 5I9QB 2EECA 1CCZA 4OGAD 5GZNC 3VE0B 3L1OL 1P1ZA 2Q76B 2AABH 4JRYE 5H94A 4ZFOL 5B39B 3MRNB 2HH0L 4HUUB 4Z78B 2SEBA 1N4XL 4GW4A 4J3WA 4NWUL 3Q6FB 4XPHL 2IPTH 2I60H 3CXHK 4F2MB 4F7PA 2CIKB 4NKOA 1FAKT 4PRBB 4OLZL 4YLQT 1WZ1L 1U8LA 4NKDB 4LP5A 5CD3B 2AV7A 2IAND 3HG1D 1WBYB 4C55A 3S8WA 5KSVA 1PQZA 3VRLF 4PV8B 5D5MF 1AP2B 3BPOC 1OTTD 3MRGA 4U2YA 4G42B 4LNRB 1ZV5A 4Y4FA 2OTWB 2OX5A 4I0CC 5D1XB 3RWCA 4P46C 3JZ7A 4WFHE 4PTUA 3HB3C 4YDKL 1NGYA 5D7KD 3RWIB 5IEKB 5ANMB 1M7IB 1I8MB 1W0VA 5DSCA 4GLRH 4JO2L 2YPLA 4LU5L 2EH7L 3ALWA 5EH1A 4MJ6B 4QHNB 2AXFA 5EOQL 3UYPA 4ZUVA 1OGAD 4KGLA 4LPWA 1Q9KA 5EWIL 3LCYA 4YHML 2AK4B 1E4XH 3MYJB 4L8SC 1MQKL 4MZ3A 3UTZB 2OTPA 3EZJB 3FOMB 4FXKB 4LL9A 3EOBA 5L2JA 3R0MA 1U91A 4XWGL 1CL7L 4KHTL 2NX5B 2AXJA 3MRBB 5C0RL 3MRFA 4YHPB 1UCTA 5IROA 4I3GA 4IDJL 5HHVL 5IWLC 4HWNA 2Y07L 3KPRD 1FVCA 5EZJA 3RIAK 5DWUH 4XCYA 4Q9QH 5EU3A 5T5FL 4Y19E 1G7JA 3IGAA 1KTKE 4QRPE 2ZOKA 4OCWH 5HHOD 3T4AA 4AJ0A 4ZFGL 1A4JB 1FDLL 3D0LA 1WV7T 5BV7C 2HJKB 3UC0L 3NA4A 1KJMA 3CLEH 4PJBA 5JIPA 5HD8D 1S9KC 3H9HA 3TT3H 5JW3L 5FHAL 3RFZC 1A7OL 1CG9A 2BVYA 4JFQB 2P5WB 5E08H 5FYJL 4P57A 1S7UA 2BNRD 4C59B 5L9DH 1OSPL 1I8KA 4U0RC 1LWRA 3VJ6B 1T89A 1MELA 3MGTB 1CICB 1RZ8B 4PFEA 1IGYB 1WWAX 1TCMA 5KJRL 3ZHKA 2Z8VC 5C0CD 3LDBC 1RQ5A 3WEXA 2H9GB 4XCCH 1DBBL 1INEH 1E6OH 1T66C 4DOHE 1LVEA 1VCAA 4X6EA 3OKYA 2JB6B 3F58L 3RVTC 4Y4FC 5IW6B 1P69B 1OAQL 2YPLE 3WFBL 4I5BA 1WBZA 1T04A 3OAYH 1JZ8A 2H2PC 1AGCB 4OAWB 1GZPB 1P2CB 5DD6B 5BS0D 4I18B 1N26A 5JHDD 1IC5H 5DURD 5FKAB 5C8JB 1RIHL 4YXHH 1R24B 3P4OA 1KIPA 3BZEB 43C9B 5D1ZA 2GTWB 3CDCA 2L7UA 2F19H 2BY1A 4IRZL 5D5MB 1XZ0B 3UYOD 4K3GA 2D0GA 3DX7A 3EAKA 3VXUA 1FFQA 2D03L 1XH3A 2ZG3A 5HHMD 4S1RL 1ZTXH 2DYPA 4UB0H 4YBLB 5ERWB 2Y36H 3B3IB 3IDGA 4OJFH 5DQ9A 2JKXA 1JF1B 1FBIH 3G5XB 2A77H 4YWGL 1FYHB 3ROLB 4WJ5B 1FFNB 1AR2A 3B2UC 3MLXH 4TSAH 1MEXH 4WV1A 3PV6A 3WFCL 3IAQA 3FT4B 3MBEC 4PJBE 3DWTA 5TF0A 4P9HL 4GRMA 1D5BB 1GAFL 3QEQA 2Q7NA 3ARGA 3EJYD 4J23A 3V52L 2HVJA 3EYVA 4DK6A 4JFYB 15C8H 4PR5B 3IU4L 3LN4A 4JFDD 1QOKA 5IM7A 2R8SL 1YDPB 2H2SD 3KPPB 3X11A 3VI3E 3GUTB 5CP3H 4OKVB 5MI0B 3S3SA 3GSNA 4P4KB 4ODTH 3WL9A 2AJ3A 1S78D 2FIKA 3AS3A 2HT3D 2APVA 4WFFE 2ADFH 5KANG 3ULVF 3SGEI 4PRHD 3S35H 3U4BL 3MREB 1A6WL 4G7YH 2VQ1B 2FCBA 4LRIA 4YHNB 1LEIA 2XN9A 4LLAA 2FJHB 4YHZH 2AJXH 4CAGA 1EGJH 3WIIH 5GGTA 3FAXA 4OZ4B 4PG2C 3RDTD 3ES6B 3D18A 4EI6B 3BDYH 2Q7YA 4D9RD 5DO2D 1I9IH 5E00A 2UVFA 3QUKB 3TO4B 1KEGL 3SDYH 1CLOL 4KY1L 3NIFE 4LLYA 2BOCA 3DV4A 2DLIA 4E5XB 3MV9A 5KG9A 5IEHB 1T5XB 3LVEA 1LO4H 4Q6IC 4IIQC 4PP2A 1MRDH 4UQ2A 2YRPA 4WW2C 1C7SA 1PG7L 5I15L 3GIZH 3N1FC 4Y89A 1D6VL 4Y5XC 2FL5B 3MJ8A 3VXUE 3U9UB 4YDJA 2J8UA 2E8ZA 3UTSB 2A6JA 2HTKC 3L5WA 3DHJA 1MCKA 5E56A 4RNRA 2WLZA 1YEIL 2P8PA 4NNXA 3QFJB 3WE6B 3C5JB 3GNML 4GAYB 4OZHF 4LLUA 3V79C 2CD0A 1G9MC 5C92A 1MREH 4ODWA 2VDPH 4MVBC 5DZLA 3QHZH 1JCKA 5LWYL 5IW3A 1S9WB 4Y2OA 1F5WA 5D1XD 4P2RA 5D7SL 3O6FC 4ZFZA 2GSIA 4Z7QF 1W2KT 4PLJC 5BXFB 4GRWH 3I6GA 2R2HA 1UM4H 2YUVA 1UWEH 4P5KA 4NPYB 2B4CL 5IESH 4U6XA 1ZLVH 1OY3B 1Q9LB 1IAIM 4MLIA 4PJXA 1A2YA 1FLRH 1N7MH 3D48R 1BQHG 1FYTD 4OD3L 4PRPA 4G43A 4Z9KB 3P30L 3GHEL 3ZHLA 1ZT4B 5J0BA 4R26L 5KSBA 4HIEB 1TNNA 1U92A 5BMFH 4XI5C 1TIUA 3HZMA 2NX5D 2XN9E 3VXPB 5GRXG 4MNGB 4DEPC 1AFVH 1KENL 1IILE 4WUUB 4MQTB 4RFEB 1U8QA 5DD0L 4P23B 1KB5B 2AK1L 5CP7A 3UDWA 1J0ZA 4HX1A 3HZVA 4G8GA 4QRSB 3BPLC 4JFEA 1ZE3C 1U93B 3PGDA 4MA8H 4NYLA 3PP4H 3WKMH 4Q2ZA 1QBMH 3PWNA 3U0WL 2J5LB 4XVJH 5JNYA 3VXOA 3OR6B 3MV9E 5CJOH 4N90E 3R0NA 2WK2A 4PRDA 5I1EL 5IP4A 1AQKL 1S8DA 2NY7H 4YDVB 1AO7B 1U2HA 3VFGH 2DI7A 3L3OA 5IFHL 3FKUS 4JB9H 3DECA 2BSRA 1M7DA 4OI9A 1QR1B 1QEWB 5DGRA 5GXBB 1MFBL 5D1QD 4XWOD 2NYYD 1Z2KA 2J8UE 4NQDB 3MUJA 4M5ZH 1T83A 1O7SA 1DQML 5K9KB 4GW1B 2W60B 3AU1B 4PJEA 5E1AB 3MC0A 4Y2DA 2HKHL 4DKEL 5L88H 3L5XH 3DVNA 3PGFH 1LD9B 3SBWA 1K8DB 4P2RE 2XWBA 1BEYH 1A47A 4K7PL 2OK0L 5BOZG 2K1MA 4L3CA 3WFHB 1UEYA 2JELL 2BSSB 2N7AA 4KMTH 3RA7L 4QHLB 3MO1A 3WNNA 3DYPA 1UJTA 4MD4B 1TJIH 4LHUD 3HCVB 4M1DL 4PJXE 4JPVL 4XPTH 1JGEB 5FYKE 5JPNA 4OUUB 4PRPE 3EYQC 5KVGL 1HQRB 1U8IA 4GW5A 5KSBE 4MCYA 1QPXA 3MV8A 4JZJA 4PRAA 4D3CL 1KG0A 1MJ7L 1CF8L 4WU5A 1A7QL 5E7BA 2GJZA 1NFIB 2VZVA 1RUML 3ZE1E 5J1TC 4G8GE 1CFBA 3C09C 3PL6B 4JFEE 5D2NB 3S34L 2BNUA 2XWJB 3MLTB 3QDJD 5F93C 3ARRA 1UM6H 2ATKA 3UDWC 2HFTA 4HFWB 1UM5L 4HAGA 4K9EH 4MDJA 2IQAA 2QR0B 1DQJB 2Q1EA 5FKPB 2XZCH 4K71B 3T0XA 2AEQL 3VXSE 1GGIH 4O51A 3ARDB 4GT7A 3FQTA 4LAJH 5E2UL 4IMKC 4A2MA 1IAIH 3ZE0F 3UPCA 2A74B 4QF1B 3CZJA 2QHRH 4WNQB 1EFXB 4YAQB 4JKPH 2Y5TB 4G6FB 2NY1C 4PJEE 5IMOA 2IAMD 3TJHC 1MFEH 4P4KD 3VFMB 2F54A 4KDVA 1UYWL 3BOVA 4FABL 1ES0B 5HHQB 4HBCH 4HEME 4W81A 3ULSA 3BJLA 4NZRL 1NBZA 1E0OB 2MHAA 3WS3A 4R4ND 2O5YL 2A6KA 1PZ5B 4LP4A 2HKFH 2AJSL 2R0ZL 2VLMD 4FNLH 4NZJA 2NY2C 4N1EA 1BZ9B 1CU4L 3TNMA 4OF7A 2FRGP 3RHWF 4HK0B 1T21A 1LO0L 3PQYB 2BSTB 5ESQA 3U9PH 5I1GL 3GKWH 2EDTA 2VDLL 4DJMA 5EU6D 3TO2A 3TO4D 2B20A 2X4SA 3MV8E 3GM8A 4I2XB 3TZVB 2HLFC 3TYFA 3U4EA 2ESVA 5ITBL 1E4KA 3LKRA 4N0CD 5CEYA 4JZOB 4TN9A 2UYLB 4OLEA 1A7BA 4QT5A 5MENB 4OQTH 2AI0L 5FUOH 3I9GH 4OLUH 5GGSY 3CFIC 3PWLA 1LO3H 4N9OB 4LLWA 5GS1C 5IVXF 1CBVH 3NH7L 4ODVL 1ZANH 4X6BA 4QGTA 1TZIA 4YHLH 1EEZB 2AABL 1MHEA 2ARWA 1I1AC 2CGRH 3TCLB 4NQTA 5AZEH 4U6HA 1ZA3A 2OL3B 3FN3A 1AHWA 2XNAA 4C83B 4L29A 4ZQKB 2DBLH 3INUH 4UQ3A 4DVRH 3FTGA 3VGAB 1X5JA 3KS0J 3QIWC 2QTEA 3MLUL 2X7LA 4AQ1B 3RWGA 4G80A 2OTUB 1XF2B 3HZYA 3TBSA 4XPAL 5D4QA 5M94B 2VWEC 2ARJB 3V7MA 4JM2F 3EJZC 3BZ4A 4TSCL 4GMSH 3DXAA 1J8HA 2VXSL 3L6FA 2RBLA 4GXUN 4I0PA 1P4IH 1YYLL 3THMH 3CFDB 3QO0B 1PFCA 3OGCB 4AIXA 4OZIF 2XG5A 3RVVC 1PJ9A 3JXAA 3FO9B 2JJUA 3FZUD 4QXTB 3I3DA 4H5SA 3CGTA 4Q9RL 3GEWB 5MHSE 1JZ3A 2CO7B 3RIFK 4KAQL 2R69H 4JGJA 1KLUB 5ICYA 4JJ5A 4HIIB 4P23D 5CJQH 5HI4D 5HGAB 1I4FA 1NGPL 4ELKA 3HUJF 4KKNA 5CEZH 4X9IA 3AREC 2BC4A 4LVEA 4FQIL 1RJYB 4PG9A 4F9LA 2EXWC 2V9QA 3TA3B 1SEBA 1EX0A 1EZVY 1XF3B 2ESVE 3LKSA 4WWID 5DUML 4H1LB 4PJGF 3RTQA 5FAAA 4HUXA 4LPCA 4Z76B 4QTIL 3P77A 4JDTH 1JUFB 1KPRB 4KROB 1E4KC 3TIEB 1GHFH 4MJ5B 5C0BA 3ULVD 1N6VA 2FNBA 4L5FH 1UXWB 3T0EA 4UV7L 2JIXA 4HIHB 2EE3A 5I16A 3HMXH 5CIPH 1VEOA 1UACL 1SJHB 1LEKB 1CDJA 1UXSA 2EXYD 2F8XC 4LSVH 3QNXA 2Z0BA 2IPKB 1ADQH 1I3RB 4O02L 3VRJA 3EJJX 3UZEA 1Y0LB 3K4AA 2R23A 1N59B 1QYGH 3KWWA 1UVQB 4F15B 3FQNB 2Z9TA 1BIHA 2YR3A 3WHXB 4YUEH 4HD9A 4PB9L 2H41A 2FATL 3K4DA 3QEHB 4HPOL 4PJCB 5DHVB 1WCBA 1ED3A 4LVNB 5E2VL 1KJ2L 5F9JB 3RWHA 2GJ6A 4NHUB 4MNQB 1MH5B 3UTTD 1T20A 2DQFB 2EYSB 3DXAE 1J8HE 2F5BH 3L5JA 4LSPH 4KRPC 5IVXB 3KPNA 2P8LA 1TJGH 2C1OB 4QHKJ 3MJ9L 4Q9CA 1JHLH 5I1HL 4JGUA 4I0PC 1YEEL 2NXZB 1FNHA 1RIUL 1BX2A 1OF2B 4RDQG 4LEXL 1MF2H 4IOIB 5F9AC 3K4ZA 1NSNL 4YXHL 5J6GA 3KYKL 4YR6A 2R2EB 1Q1JL 2OZ4H 2P43B 4WO4A 4ZXBC 3IFPB 2IGFH 4PGCA 3QHTC 2F19L 1A4KA 2AXHA 1KOAA 4K3DL 4NDMA 2P5EA 4UILL 4JM4L 1T0MB 4AM0A 3KPLA 4R97C 4JM2B 4YPGB 3TFKC 4UIMA 3EYUH 3QO1B 1HH6B 1ZTXL 5EO1A 1DBKH 3DTXA 1TZHA 3O3DA 4ENEC 3QG6A 3QUYB 5M7QA 5EBMB 1FBIL 4ERSL 3X12A 3V6BR 4XPGH 3MLXL 5HHXL 3RTQC 1KPVB 1NUGA 2DL2A 3T0EE 2XYCA 2DLFL 1QO3A 5JDSB 3QXTA 5ETUA 4FQQA 2IFGA 3O3EB 3KPQA 3T09A 3NBNA 2XZZA 5FM4A 4UT7H 1A7NL 2Z35B 3EHBC 5CJBA 1VFMA 1CFNA 3B8SA 3U6RB 3K80A 2PNDA 5GGVH 1FNEB 3N1GC 2C9AA 1LO5B 3MMEA 5T3XE 3HUJB 3PJSA 4NWTH 1DEDA 1NLDH 4QWWC 1DFBL 1I1YB 4F57L 5EULV 3MACH 4PGBA 1RJCA 2V17H 3FOLA 5ISZD 4QXGH 3I6LE 2GJ6E 4IRJC 4PJGB 1ZLUH 3LN5A 5KTEH 3BKCH 4P46B 3PQYD 1QLRB 5IQ9A 3JV4B 3WNOA 5GRJL 1JV5A 1OP5H 1N6QL 4UV4L 4TVPD 3WIIL 4MA7H 3QCVH 5FF6A 2NY4D 4OV6F 1FG2A 5ENWA 1SBSH 2HG5B 1KJ3H 1JHTB 1X5ZA 4HS8H 4NN6C 1F8TL 2EC9T 4JCLA 4L8SB 4NQEB 3W11C 4NO5B 3MR9B 3QUMA 4OD1L 1YN7B 4EN3D 3CVHA 5CINH 2PUQT 1A1OB 1NLBL 2LV4A 3F65A 3V6ZA 4WO4C 4JAMB 5A43C 1FN4A 2A38A 4XMLH 4DVBB 4DGIL 3RIAF 3STZB 3QA3B 1I1FA 3G6JA 2FBJH 3QEUA 1OGTB 3G5VB 5DQJA 4BSWA 1ODAA 3FRUA 2D7PA 1R3LA 3GSUA 4ZO6A 5IVNA 2UZIL 3BKMH 1BGXH 5D72L 1ZLSH 3HNTL 1PZUB 5IJVB 5IFAH 5BV7B 3CFCH 1W0WB 1QLFB 5SWSA 5T1MB 3BE1L 1FNAA 2P44B 3MLYH 4GKNA 4ONFL 4H8WC 3O6LH 4HS6A 4CADB 1ZHBA 2IH3B 3TPUA 2V5YA 1QSED 1S7XA 5J3HC 1A1NA 4HUMB 5IESL 1D5MB 4P2QD 1YECL 2X05A 2D31A 3TC9A 4KI5E 4U0RB 1N3NA 4XHJD 1RVFH 3GK8H 5I8CA 4NT6A 1N7ML 5JZ7D 3NIFF 5EIIB 1NL0H 2ITDA 4WW2F 1ZVSA 4LRNL 4O4YH 1YNTB 2DI8A 3O4OC 3LDBB 3RAJL 3QDMA 2EDEA 4WUKL 3KYOA 4U1MA 5D8JL 2FD6H 5DXWA 1YEHH 1EDQA 4XAKE 1A7PH 4X98B 3VH8A 1MFAH 1EMTL 1AFVL 2AS5M 3VD4A 3IT8D 2N4IA 4MS8D 2PN5A 4G9DB 2KZ1B 4I3SL 4CVZB 4PBXA 3SE9H 1IKFH 2PXYD 3PP4L 4IRSB 5IHZA 4AK1A 2E9IA 1JPGA 1K3ZA 1FZOB 1QBML 3UZQA 4M5YH 2X4TA 3Q48A 2BZDA 5TDNA 3OKKB 1H5BA 5T3ZE 2WBJC 1G9EA 3NIGE 5DRXB 4KKLC 1FNGA 3OF6A 4JFPB 1T1WB 3KJ4C 5DJDB 5C07A 1AIFA 3I02B 4MXQD 2RQ8A 5GS2D 4BZ1H 3VFGL 1DP0A 3CFEB 3Q1SH 4JB9L 3ECBB 2VLRD 3KVQA 2CKBL 5CEXB 4FFWD 2AGJH 4NP4H 3FB6A 3EYSH 5F72S 2HFFA 3KPSB 1K85A 3TPKA 4ZS7L 5IBTL 2CLVB 4D0DB 3H7BA 2B0SH 2GY5A 4XZUB 4HT1L 3W0WA 1DANU 3WFZA 3SPVA 4ETQB 1KJVA 2I9TA 2NLJA 3ARBD 5L88L 2ZJSH 1JBJA 5SWSE 4JREC 3QXDA 3MBEB 3DYOA 5DJYA 4NM4H 4MNQD 3SGJC 2BRRL 1BEYL 4HJGA 1KCLA 3CMOH 1HYSC 4OFVA 1IAKB 5HXMA 4UBDC 1CLZH 1FH5L 5C0EB 5F70A 2E9BA 3OXSA 4KMTL 3MCG1 2NY3C 1PSKL 1MCLA 1IMHC 1CR9H 3GMLB 1F2XK 1TJIL 4OIIL 4PJ8A 5E9DD 5EZLA 5JLZB 4XNUL 1EPFA 1NCUA 2EDKA 1IARB 2IMNA 3IS0X 2VITA 3DSFH 2CK0H 2IWGA 4NQSA 5E99H 5HJ3A 3QDME 3RRQA 3SHSA 2GK0A 1VHPA 1WQVT 4KJWC 4ZPTA 5INCB 5E8OB 2DWDA 3P9LA 3ARFA 4KK9D 3D9AH 3K7UA 4RX4D 2FX7L 2W59A 5T33H 4R4BA 3QUYD 2F53A 2NY5L 4JRXB 4WTZG 1JNNH 3UBXB 3C60D 4ALAH 1XCTB 5GZND 4RWYH 1MJUL 5C07E 3SEPA 4Q6IB 4XP6L 2WIIB 1KPUB 3Q5YA 4IIQB 1CGSH 5F6HI 3UXFA 4M8QA 1YC8A 2FWOA 1MFCH 2LAAA 4WW2B 5IK3B 4TSBL 1U2CA 4LPVA 1CE6B 1PYWB 1A8JH 4Y5XB 4G8EA 1JIBA 4TTDD 1BOYA 1J11A 1IQWL 5IMKB 3MJ7B 2QHRL 1D5XB 3U79A 2WUBH 3KLSA 4XNXL 1AGFA 2CJUH 1QHOA 4NQVA 3V5HA 4F8TA 3W0WE 2OYPA 5ESVA 2DJSA 2WSKA 1K2DB 2VYRE 1OP3K 3QPQC 5E2TL 1YJDC 3H3BC 1CXFA 1WWWX 4P46D 1FNLA 3O6FB 2VXQL 5IVZA 3HB3D 4HF5H 4D94A 4K94C 2DWEB 4MAYA 2VABA 3ZE1F 5CWSB 2FX9L 3T8XB 4N8CH 4WFHD 3HKFA 4YHYC 4Y5YA 6FABH 1YEFL 3ELAT 1LP9A 2VDRH 4R0LC 4ELMA 2PYEA 1PX4A 4KK5C 2NW2A 3GKWL 3UJIH 1HHGA 1LHZA 4LCCA 4A6YA 3E6FA 4WDIB 3HAEH 3GSXB 4YHIA 4MX7B 5DUPH 2FECL 4X9FA 1IGCH 2HAZA 3G04B 4P3DB 1FZJB 4LLMA 1MCNA 2YKLL 4Z77B 5JIKA 3E2HC 2BNQA 4R3SB 5ADPL 1G9NC 3I9GL 4XNYH 2DMBA 5DD3H 5GS0H 3ZDXF 4PP1C 5DJ0A 1IT9L 4EI5D 3ETBF 4JGMA 3WXWL 5D9SB 4TUJA 5DMKB 4FG6D 2YA1A 4PJEF 3C6LB 3BAEH 2LTQC 2F53E 4OFYA 1WZKA 2O5ZH 4WGWB 2KH2B 2Q8AL 3MGOB 4RMUA 4JFXA 1PKQB 1I9EA 1QLEL 1VFAB 4Y19D 1Z5LB 1P7KA 3VWKC 4QRPD 2G9HB 5E6ZA 4G8IA 5IQ7H 4F58L 3WD5L 4R7DB 5EOCL 2GEEA 3GBMH 3PHOA 1QSZA 4H25B 5KSUB 4R90L 5DDHB 3P9WB 4P5MA 4MNHA 4B0MM 3TGXA 3FO0H 1T2JA 4HMCA 3T65B 1Y6KR 3V0WL 1RZFH 3AAZA 4JY5H 2BVQB 3VI4E 3DURA 4LKCA 2FDBP 4Z8FL 1FVEB 1QBLL 3O3BA 4ISVB 5L2KA 1JNJA 3D69A 1QQDB 3SE4A 1EAPB 1T6VN 2ICWB 3L3HB 4HGWA 5I30H 5DUBA 5I1IH 5DR5L 1HOCB 3CXDL 5IHBA 4Y4FD 2EDBA 4D9QE 3ZT6A 4M1GL 3KYMB 1YN6A 2QV2A 3BPNC 3EDDA 2XG4A 1LP9E 3L7FB 5CJ8A 2H2PD 3PHQB 2PYEE 4ZD3H 3MA9H 4XTRC 2YBRB 3U7AA 3EDJA 1ZEAH 4N9GA 3NABL 4HDIB 4DZ8A 4M61B 5ID1A 4HG4J 1PG7X 1G7LA 3SKMB 3BP4A 3UX9B 3V4UH 3JWDC 5DEGA 1I9RH 2UZXB 1KN4H 5BVJA 3MLWH 1FO0B 1ZT1B 2BNQE 3K74B 5FYLE 1ZHLB 4CJ0A 1U41A 1U95A 2NXYD 1QFUH 4HKBA 3ME0A 2VZTA 5LXGH 2DQIH 3OG4B 4JPWL 3C09B 3CSPA 2VISB 2AXGB 2X4PB 3BP5B 5CS7A 5J56B 1EBAA 1HZHL 4LVOC 3H9SB 4OCXL 1A6ZB 2F74B 2VERN 3TBWB 4GBXA 5KVEL 5H2BA 3B2UD 1BJ1H 4Y4KA 4X9HA 3V8CA 1OQXA 3B5TA 1T1XA 3C5SB 3MBED 4QCIB 5JQHC 5KVDH 5JOFA 4IS6B 3RNQB 2ADIB 2G75A 3VXSB 3TIDA 2G60H 4XXCA 3TBYA 3B9VA 2WINB 3GFUA 4M6AA 1I8LA 1CE1H 3EO1B 4LSPL 3FB7A 4FQCL 4NNPL 5CD5C 4GKOA 1UWXK 1U8HA 3LEYH 1W72A 4U3HA 5KAQG 1TJGL 1S3KH 4B5EA 1FP5A 1AGBB 5D6DA 1NCDH 4MQSB 3QHFH 2J6EL 2FEDC 4XH2B 2ZCHL 2EO1A 4EUPA 4U1SA 2HRLA 5DRZB 5KW9H 1BD2A 4WFFD 5I19H 4ZFOA 3MRQA 4ODHL 4XP5L 4GH7B 3STLB 4OLXH 3KYAA 2NY2B 2NNAB 1E4WL 3RWEA 1JPFA 2Q86A 4J8RB 5EOTA 3TT1L 2VJXA 4E41A 1MWAL 3SO3B 1FE8L 3OL2A 2X4RB 4HXAH 3EYUL 2VC2H 1KXVC 5AUMB 5FGRA 1ZLWH 5GRVL 1OHQA 4OCMC 2WIMA 4UUJA 5TH2A 3VMOA 1OSZA 5CILL 4PJFA 5K33A 5MERA 2QQKL 2XTJB 2ZWLT 2F9BT 1VEMA 5AYQA 3IAPA 5D1ZD 5C9JA 4PRIB 3QJFB 1RMFL 1KG0B 4G6MH 4JN2A 5DI8B 1KTDA 3B9EA 5FK9A 3PF2A 5GS1B 3GMMB 3GO1H 1VGKB 3IDNB 4O9HH 2JLLA 4G8FB 2FIRT 3LD8C 4QO1A 1Q9WA 5GGQH 1I1AB 3L3GA 4MDIA 1KCSH 2QQQA 3VXUD 3O8XA 1JL8A 1H3GA 3PWUA 1DQQA 1RZKH 1BMGA 2DYPD 1RUKL 3FN0H 4LARL 3BI9X 3NACL 4L3EA 3SN6N 4K7PX 3IRZA 3G5YB 4AIZB 3RZCB 1KN2L 5HTSA 4MVBD 3T4YB 2ERJC 1V7MH 4LEOA 3QIWB 4Y4KC 4YIQB 1FZKB 4NUGH 4PLJD 2AVGA 1YNLL 2V17L 5F9DC 5LQBL 1U8KB 1RAMA 5CMAA 3ARGD 1S7RA 5KS9A 5KTEL 2AQ2A 3BKCL 4JKWA 4WHCA 3WBDA 1ND0B 1JPTH 2QADD 2XOTA 2AKRA 3D6GA 5GRUL 1O7VA 3LOWA 1HCVA 2I5YH 1YPZA 2APWA 1NCCH 2DIJA 3V5DA 1QD0A 2R2BB 1T0NA 4R8WL 4GG6F 3QI9B 1MCFA 2XICA 4MA7L 3U7YL 5IMMA 2ADJA 1SVCP 5E2WH 3RL1A 3IDUA 3U46A 2AJZA 3RIFF 1QVOA 3TV3L 1BD2E 3QZWB 4MHHG 4DGYH 3VRIB 3QG7L 4HS8L 3VFUA 4XI5D 5HHPB 1IM9B 3R1GL 3IU3A 3ISWA 2CLZA 1NC4B 3VFPA 4HJJL 4OV5B 4G6JH 5FUCC 4Y4HC 1CD0A 2XN9D 4WHTA 1AE6H 1S9VA 4E41E 5KVFH 1VADB 3FFCB 1FZMB 3HMWL 3AREB 4NJ9H 1Y18B 4U6VH 3BD5A 3BD4A 4ONGL 1UENA 1M7XA 5IB2A 4BSJA 1BVKB 5HI3C 5E8PB 5GRYA 5IOPB 4POYA 5C08B 4PJFE 2VN4A 4F7EA 1BAFH 4ZSOA 1J9CT 2YXMA 4TNWF 1G7MA 4Z18A 3MV9D 3UBXI 1BQHA 3NA9H 4JY4B 4OCRH 4N90D 2Y6SD 4LBEB 4I4WB 3F7YA 5J12B 3X3FH 2IBZY 5I8EB 3MLRL 4Z7OF 2CR3A 1OAZH 3IB4A 5DJ6A 1RHHA 2ICES 4N5UA 5I1JH 3MLYL 5K9QG 4X99B 4MGXA 3WFDH 4HWBH 1NANI 4PJDA 1DBAH 4KRMB 3KLAA 4L3EE 1K9TA 5C2UB 3O8XC 1NMBH 1WEJL 2VH5H 3WFEH 4NC1E 3HC4L 4ODSL 1NUNB 3GMOB 5DYOA 3MNWB 3VG9B 4NC1C 4U49A 1H3TA 4P2RD 5HVHB 4UZGA 5KS9E 1MI5A 4FQXC 4MJIE 4J3XA 2FD6L 1H3UA 3QCUL 1YEHL 5F1OB 4C57C 4KRPB 2CIIA 1Q0XL 2JJTA 1I7ZA 1YPZE 1IZKA 3BQUA 3BISA 2C3XA 1I7RA 3EYQD 2Z93A 1UKSA 4TNVK 4WEBH 4HG4K 3MRHB 5E4IA 4M7JH 3D85A 3T77A 3MRPB 3R06A 2O26U 2H32A 3JWOH 1Q94B 1Z0NA 1NCAL 5FYKD 5FCUL 4PRPD 5FA3B 1MVFA 3RPIA 1IKFL 1T80A 3WUWG 3L3JB 1EVUA 2DIAA 3D3VE 4Q58C 3RZWA 1E6JL 2GTZA 3NZ8A 4L8CB 3QH3A 3LHPH 1RURH 4ZXBB 3BKJH 4J12A 4MMXC 4NKIL 5FYJE 5ID0B 2JJWA 4ZUWA 4WFGE 4PJIA 2EIEA 4G8GD 4R97B 4WU7B 1ZVYA 4RFOL 5K9OA 2DTMH 3H0TA 5DRWB 1HI6A 5SWZA 1HXYB 3JSSA 3K2MC 3L9RB 3AY4A 2XPGA 5CUSH 4JHAH 2BC4B 4LPXA 3O81A 3IJSB 4ZSOE 2KZWA 4F3FA 3VFNA 4M62H 1OQOA 2B0SL 3HE7C 3U0TA 2BDNH 3NCFB 1C5CH 4XMKL 4GG6B 5CSZB 3K81A 1AXIB 1XCQA 1S7SA 3VXSD 1CFTA 4TRPL 5KN5B 1X4ZA 3ULVH 2DLGA 2BVPA 4YXLH 3V5KA 1I85C 3C6SA 3CMOL 4HQQL 4RZCA 1DE4B 2NY1D 4PJDE 2HWZL 5I1LA 4OIAA 4FTVA 3TJHD 1BM3H 2GT9A 4HZLB 5CBEB 1O0VA 1MJJA 4RGOH 3OJ2C 4HFUH 4L4TB 3VXQB 1CR9L 5IF0A 1UCBH 1M71B 1HHIA 1J1PL 1FAIH 4WW1B 3HNSH 4G7VH 4JY6B 3CU7A 4BSVB 4K55A 3OMZA 1PX3A 2ZSVA 5BJTA 2X89A 5C09A 4EIZC 1BQUA 1MI5E 4IRJB 2NY2D 2X10A 4V1DB 2ICWI 3VW3L 2BVTA 3ZZ1A 2Q8BH 5GZOC 5TDPB 1ZHNB 1G0DA 1BECA 4JKKA 3DBXA 4KK6C 3E0GA 2W0KA 5EU4A 3CDGB 3S37X 1VACA 2PW1A 3KG5A 2KDGA 3BQUC 3D1MC 2HLFD 5T5NG 3PDGA 3ZLQC 3MV8D 4NN6B 3U4AA 2XA3A 3KDMB 4ALAL 1YMMB 1WAAA 1IQDA 4P9HC 4PGEB 4MXWL 5J1AB 2X4QB 5H37H 1NGQH 5C0FB 1MRCL 1KTLB 2YWYA 5ESAB 5FECA 3IVKB 1I1AD 1HINH 1MFCL 2DQDL 3L7EA 1N0XL 2ED7A 4N0RA 2Q20A 3OAZH 1KIQA 5SWZE 2FGWL 4AM0B 5C0NC 3LKQA 2WUBL 2X4UB 3HFMH 4P2OC 4X7TB 4D9LH 4JFOA 3AY4C 4XP9L 5E6IA 5I66A 2VUYA 1INQA 1HE7A 5LAXA 5FO7A 3MQIA 1VFBB 3NOIA 1UG9A 3LEVH 5C3TA 2CDGB 3MLZH 5D70L 1FIGH 3HPJA 3T1WA 4M7LH 3PGCA 3NVQA 4FTVE 3X13A 4XP4L 1F3JA 3DARA 4JPKL 3MZTA 2YC1A 4LLQA 4NC2B 1EFQA 5TPWL 1SJEA 4L4VA 1MIML 4WCYL 5T1LA 3CZFA 3RVVD 2C3VA 2EEBA 1HNFA 3W5NA 1QFWM 5IT2L 2V2WA 2ATPA 4YBHA 5BW7A 4HKZA 5CJXA 2BCKB 3EYFB 1IM9D 4HIXL 3SY0A 4O2EB 5C09E 2D9CA 3T2NH 2NY0C 5MHSD 5B4MC 3L3IB 5DVOA 2CRIA 2YA2A 3BYYA 2E3VA 2D0FA 4FOMA 4LF3A 1UZ8A 4TYUA 3QFDA 1GGTA 1NUDA 3BEVA 2BVOB 8FABA 2LU4A 5GS0L 4YPJA 3SKOA 4N1CA 5BQ7A 2HFGL 4GSDL 5J1SC 4U33A 5IGXL 4NC0B 5FM5M 1R3KA 1T2QL 4TVPH 4BKLA 4OCSH 2QSQA 4N5EC 4NFDA 3AC0A 3BP7A 4C4KO 1AQDA 4JLRA 3QQ9C 2ESVD 3FQXB 1UA6H 2A9NH 4XAWH 5GHWH 1WAAE 2R0WH 3DUSB 4HS3B 2WBJB 2J88H 4PS4L 3Q3GB 4X0KA 4Y16C 1HSAB 2BMKB 3QPXH 5IJKA 3SE3A 4XNQA 3VGGA 1Z6JT 1A3RH 4LASH 2AJVH 3VD9A 3C5ZC 2VLLB 1CFVL 3GSRA 3IKCB 3MFFA 4NSKB 1NMCC 2YD1A 4X6FA 3WCYA 4NO3A 1GGBH 3FO0L 1NGWB 5F7KC 1KC5H 1LK2B 4TUKH 5I73B 3JWNC 2EKJA 3MOQA 4OGAC 1IL1A 1TCRA 3K2UH 1VKXA 5B8CC 4L8DB 4F7CA 4JREB 2MNUA 5F1NA 1EA9C 3QNYA 3UTOA 1MCJA 3TESA 1D9KA 1G7HB 1S7WB 1WTGT 3CVIH 4M6OH 5EFIB 3SQOH 3T2OA 1J8HD 5JR1L 2VZUA 2NY3B 4L4VE 4UT6L 4WI3A 4I0PD 1U8JB 1GGCL 2XZAH 5DQDH 1BFVH 1GC1L 4AG4L 1RZGA 3CSGA 1ZEAL 5LGJB 4NUJA 1OARL 4JZNB 5FOJA 5C0IB 5IV2A 3OXRA 3NTCL 5DJ2B 4MB3A 4ZXBD 3L5IA 3U2SB 4IMLB 1RUPH 2DQHH 2JB5L 1G7PB 3MOBH 4AQOA 2AP2A 1L6ZA 3TFKD 4K7FA 2MOVA 3HR6A 4ODBD 4GRWF 2IH1A 3SCMB 1HXMB 2WP3O 3VI4F 4H1LH 1P7QA 1HQ4A 3RTQD 2P46B 4XBPA 3ZL4L 1U8NA 3IFOB 3RVXD 2RFXB 5GQBA 1JRHI 2D2OA 3P9MA 1U8PB 3OPZH 5DTFA 3IDJB 4HK3N 4HLJA 5GS2H 3T0ED 2CUIA 2JIXD 4FQ1L 5HYSB 1QFWH 2ZCKH 4KTEL 3G08B 4OM0L 4WEUD 5EBLA 1EJOL 1LP9F 3DX9B 3VXTA 3O9WB 2BRQA 4RMRA 2YRLA 1CK0L 2B2XH 4OM1L 4QHUA 4QWWD 4PGDA 5C6PB 4APQA 3UYRH 1RIVL 2H45A 1DQDL 4LKXA 5T3XD 5L6YL 2PCPB 4UI2A 1XT5A 1RK0B 5EC1B 4FA8A 2VNCA 4KKAD 4XCEA 5HD8C 1HHHA 5C86A 3EGSA 4IRJD 5E5UB 5J7CC 4V1DD 4ZOAA 2I9TB 3W9DB 3SOBL 5L7XH 3RUGF 4N0UA 3I6LD 1KIUA 2GJ6D 4KKCD 1QG3A 1PGRB 4H26A 1J0HA 5I6XC 1A1MB 1N8ZA 1JF5A 3IDMB 1D9KC 1ZS8A 4UT9L 5F7DB 3P4NA 4R0LB 4RQQB 4MWFA 1AXSA 3LQMA 3WIHH 1F58H 3K1DA 4P0DA 4UIKL 3RWFB 3FB5A 4M48L 1P53A 3V4PH 5E8EA 3FQRA 1CDHA 4ETYA 1UB5B 1YYMH 3LIZH 4M4RA 1VFOA 5IHUH 3RWDA 4ZG1A 2XRAH 4HLZH 1EAJA 2PO6A 5HJ3B 1S9XB 2F8OA 4WO4D 1GOHA 1IEAB 1JGVH 2DKUA 3EO0B 1RU9H 2CPCA 2AEPH 5IW1A 4XC3L 1BFTA 2X9XA 4O9HL 4KJYB 1N5YH 3LRGA 3LKPA 2KUTA 4LDEB 3BFOA 5C7XL 3F7VB 4TQEH 1KCSL 3RX8A 2LTQB 4OZGA 4ZUTA 2C1PA 1JMXA 3FN0L 4BK4A 4PUBL 2PTTB 1LK3L 5DT1H 1D3CA 3DV6B 2DM2A 3VWKB 1WIOA 1EBPA 3DVIA 5HYFA 4UDUB 1MHCA 2GAZA 3WDHA 3CLFH 1QSVA 4Z7WA 4M8QB 2FWOB 3PIQB 1VSCA 5EBWB 4MAUL 4KPHL 3OJDB 4YEFA 3GJEB 1V7NH 4ZO8A 1OLZA 2MWCA 4LCWB 5LCVL 1RI8A 43CAB 1NCCL 2V7NB 3QXAA 4PTTB 3MRKB 3QUXA 4X9GA 2A6DA 1P6FA 3IETA 4KI5D 3MPCA 3DRQA 4APQC 4S1SL 3AS2A 4GRWB 4GXUM 3FQUA 4Q7DA 1RZ7L 5DEFA 5FO8B 5DD5H 2DQCL 5TE7H 3VA2C 4CDHA 4F7TA 1DEEB 4X80L 1K4CA 4MQ7A 3GI8H 3OHXB 4QRTB 3LQZA 1NCBH 2O61A 3JV6A 2H2SC 1RFDH 4G6JL 4XAKD 3BPNB 1I8IA 4RAUB 3WDIA 1AE6L 4P9MH 4M03A 1KLGB 1HKLL 1XGYH 5CCKL 1S78C 2VUOA 4NJ9L 2HT3C 5IB3B 3PP3H 1IZJA 1BREA 4KKLD 4P3WA 2FGZA 5DK0B 4D0CB 3WJLC 1KJ2A 1C16A 5ACLA 2X4OB 3M45A 3VDCA 5B3JE 3JTSA 3KXFB 2E5EA 4MMZC 4P3CH 3DNKA 2D7NA 4NIKB 5GJSH 1A22B 4U1IB 3MNZA 3TBTA 5IHLB 1AKJA 3ET9F 3OX8B 3OKMB 1FVDB 4Z7UB 3MJ9A 1D6EA 5DVLA 3RUGB 4BH8B 2R1YA 5FUZH 3DMMA 3AM8A 3QIUA 5DO2C 5GGRB 3ZYJA 3X3GH 4OZGE 5JQ6H 1R5VA 1AR1C 2OSLA 1L7TL 2JE8A 5I2IB 4O58H 4PV9B 3OKLB 4HUWB 5A2FA 5EDXA 1BFOA 1JI2A 2EDNA 1OAYH 1XGUA 2GY7B 4L8BB 3FONA 3MV7B 2DDQH 1NDGA 1YEDA 2P7TA 4ZYKB 1HYSD 4WY7L 5SWSD 4UAOC 4Z7WE 2BP3A 4UBDD 1C8PA 1ZHKA 4ZAKA 1XR9B 1ZA6A 4N0FA 4E0RB 3C2AL 1KT2A 4Y5VA 1SVZA 4P5MB 4BA8A 4BH7B 3U30B 2DQTL 3MXWH 1MAKA 1QNZH 4MA3B 1S7VB 3NFPA 4S2SA 1G7IA 1JJUA 4I1NB 1MCPH 3HI5H 1EUUA 1MPAH 1NBYB 3B6SA 1TZGL 2J2ZA 1WISA 2IALA 4Z0XB 3QDMD 1XIWA 3BRFA 4KJWD 2P8MA 3HR5A 5AYUH 3CCHB 3NCYS 4GLRI 4QY8B 2Z4QA 5F71A 2E6PA 4I9WE 5TQ2L 5JUEH 3BX7C 1KB5L 3G6AA 1K5NA 1SEQL 1X9QA 5EC2A 3VD3A 4KTDH 1XR8B 3BN9D 5BZDB 5CUSL 35C8L 3P40A 4X6DE 3RX5A 5AG9A 1IRAY 5D6CB 2ZKHH 3BUYB 5TDOB 3BH8A 3KNBA 4HKJB 3OF6D 5C07D 4ZFFB 2A83A 4U1JB 5KS9F 2IBGA 3TNNB 3LY6A 2P45B 4YE4H 1W8NA 4Z5RB 1J1XH 2VDOH 5D71H 3V6FA 4YXLL 1Z9MA 5EZOL 1Q72H 1CZ8H 5FYKU 3G5ZA 3L3DB 1YPZF 2CMRL 3BO8B 1IFHH 3QIUC 1JGUH 1BJMA 2VMFA 2ZOLA 2ERJB 4KVCL 2FX8L 3W0WD 3RL2B 1A0QL 2XFXB 3PWJA 5JMOC 2NR6D 3W39B 2F58H 4WTZA 2QKIB 3BXNB 5D1QC 1HILB 5E94B 1L7IL 5F9WB 4KDTC 5J9PB 5F44A 3HLAA 5EOCJ 4JDVB 3SDAB 4JDZB 5F88B 1B0RB 2PKDA 3L95B 3S4SB 1CQYA 3LH2H 3ROOB 2R29L 2YK1L 2ZG1A 4KK5D 4GAFB 4ZAKC 1DLHB 1A3LH 1QSFB 3UPRA 4KMLB 1GYAA 1NEZB 2FB4H 1JHKH 4PJ8D 4Y5VC 4M6ML 3VU2A 5JIIA 2OQJA 4PD4K 4QRRA 1BQLL 1RZJH 2YRZA 4LLDB 2GITB 4TOYL 2Y7QB 4BZYA 5AZ2L 3H42H 3WIFB 2LVEA 4PY8I 4DGVH 3FCTA 2VLJA 1IAOB 4NQCA 3NFNB 1R3JB 3FO1B 4PP1D 1CVSC 5EPMA 4Y4HB 1NGQL 4K2UH 4C56B 4KV5E 3F12A 2XWTB 1HINL 32C2B 2YUWA 3SKJL 5TGBA 2XQBH 1I7UB 5KSAA 2F53D 4QRUB 4QGYA 4QXUL 2CDEB 5DFWH 4D9LL 1U3HB 4LCUA 2D0HA 4KH2A 3O11B 3BMWA 1CFSB 4PJ9A 4E42A 5IKCB 3MLSH 1NDMA 1TPXB 4U1NB 3VWJC 5GJTL 1RZKC 4BQ8A 2VAAB 5JW5B 3D0VB 2FYYA 5EO0B 3TJEL 4ZTOH 5DJZA 4H20H 1EHLH 1G9MH 1OW0C 3LKOB 3U0PA 1FPTL 2ICCA 1MLBB 2QSVA 1KULA 5ALBH 2GSGA 1QRNB 1KFAH 3EDEA 1QRKA 2CUMA 3CFKB 1B0GA 4PJ5B 3LZFH 2NZ9D 5HY9A 2AERT 3O4LA 3VXNB 3CFJB 2BJMH 2GFBB 4CKVX 4FQXB 1ORSA 4KHXL 2NTFB 3D5OF 3PNWB 3U7WL 1FORH 2JCCA 2QQNH 4MAYD 3LS4H 3OKEA 1FV1B 4D9QD 2IAMC 4XTRD 3MRCA 4FXGB 1WZLA 5C0AA 4MJIB 5BOPA 4EDXB 4TNVF 2VOTA 2OJZL 1FRGL 4R7NB 2CH8A 1X3DA 2H3NA 4LAQH 2PYED 4O2FB 2EYRA 4NRXA 2VDKL 2VR5A 1IKNA 3E3QC 4QRRE 3V6OC 3B2VH 3UTQB 3F7RA 1ZSDB 3CUPB 3GSNH 4R4NC 2VLJE 5GIRB 3SDXA 1DDHA 4XAWL 3FMGH 1P4BH 1QVOB 4HWZA 5LG1A 2BNQD 3UP1A 3VXMA 3BVNA 3D3VB 3LRSB 2EKSA 1MY7A 2OR7A 3MOAL 4UU9B 3S88H 5FYLD 1SBBA 5F89A 2GQHA 2RCSH 3NFSL 2R4RH 3I84A 1IC7H 4FQHA 5J6HB 4WFEE 3O6ML 1MUJA 4OFYD 2OL3L 2OLDA 4N0CC 4AL8L 1SYSB 3U1SL 2AV1A 5FDYA 1Z9LA 3HE7B 1KC5L 5I1DA 4X5WA 5DEZA 5KSAC 3MGAA 2W65B 1GZQB 1OP9A 2X70B 3MRMB 1U8OB 4J1UA 5CIPB 2HLAB 5CLTA 4X9BA 1BQHB 4UINH 5D7JC 4PJ9C 8CGTA 5HGHA 3QUZB 4OT1L 3VGEA 4I48B 4HIJA 2D3VA 1RUQL 2DQJH 2LQRA 1Z3GH 2FZ3B 3JTTA 1MCWM 4GUPB 5CD5D 3FT2B 1VGEL 1BBDH 1HEZA 1JK8A 4JQIL 1YC7A 1VPOH 5DQDL 5B38B 3IF1B 4AT6A 2EYTB 1ROWA 3AROA 4X7SL 3RKPA 2W38A 2ZSWB 3LV3A 4NO0B 3P0YH 1NC2B 2G5BA 2VXUH 4U1KA 4DW2L 1V3LA 3O4LE 1WTLA 4GRLA 5K9JH 3WLBA 3HNVL 1A6TB 5EIVA 2JCCE 5FCSH 5T1KA 4GQ9L 1C5DA 4EXPX 3PABB 2RIKA 2W9EH 5C0AE 3JWOC 3MOBL 4Z7NF 5GGUA 3A0OA 5IMLB 1EVTC 3OR7A 4LSSH 5TF1H 3FZUC 3I75A 4D0BB 1OB1B 4M1CC 3P0VH 3CAFA 3S36H 2MCPL 4M93C 5FYKH 3KR3H 2R1XB 4YFDB 1FO0H 4KFZC 5DS8B 4ZO9A 4NGHL 3REWA 3VXME 3VFTB 1EO8H 3UJJL 3IXAB 5FM5O 3H6JA 3OPZL 1L0XA 1L9NA 3OKOA 5JW4N 4F33B 3BKYH 1EERB 1BVLB 1DQLH 3QIBA 1EZVX 3G6DH 4DK3A 1UB6A 4K8RL 2Q3AA 2HVKB 1NH6A 5FO9A 5C1MB 2Z31B 2E9WA 4DFHA 5EORH 4Y8AA 4GBXD 1CLYL 4F7MB 4P2OB 4QOKB 5DJ8A 2BSED 4R9HA 4P5TA 4ONHA 5ACMA 4Y4KD 2DM3A 1XGPB 3CJJA 5D7LB 3RBGA 3LB6D 1JYXA 3U0TB 3BEWB 1EJ6A 1NAKL 2WWKO 1J0KA 5DJXA 1C12A 5ICXB 4I0KA 4JANA 3D39A 2E7LA 1ZGLA 4UTBH 4WWKC 1LE9B 4MSWB 3HPLB 3GBLA 3TBVB 1TVBA 3D25B 5LBSL 1FNSH 4BYHA 2ADGB 5SWQB 2YSSA 2NY5C 2DL9A 1DL7H 4EQ2A 1MCDA 3IDIA 1R3IH 4NKQB 4GAGL 1F6AB 3MRDA 5IB5A 3SE8H 4DZBA 3O2WL 3V4PL 3TH2T 4EDWL 3VDAA 3SDDA 4HV8B 1BD2D 2RGSA 4IOFC 3MBXL 5CLWA 3I50L 4P2CG 2H6PA 1IGJB 3BYTA 1ZAGA 4U31A 5FFLA 4WHYH 1NQBA 4HHAB 4FFVC 3NCCB 4LFHG 4E41D 5HI3D 3S96B 4ODXA 3EBAA 3ESUF 4PIRF 4TQEL 3MCLL 5EA0L 3TVMA 3GM0A 4OZFA 3CPLB 3PWPB 3HRZA 4DN4H 4NM8H 4LQFL 1RZIA 2EH8L 4KJPD 5JPMA 1B9ZA 4Y16B 4XBGB 5I18H 4KZEL 2V2TB 4NHCH 4XP1H 2VDNH 1DUYA 1TETL 1UC6A 4G9FB 2VL5A 3CH8A 4JO1H 3CLFL 3C5ZB 3EKCA 3ARQA 4PB0H 1H3PL 1CTNA 1EH9A 4RIRA 4YFEA 1NEUA 1XGQB 3QIBC 3WMSA 3O8XD 4HWEL 3QJHA 2IF7A 4NRZB 4J3UA 5LGHL 3OZ9L 4LGRB 4L3ED 3HZKB 2ZZUT 2OJEA 3QRGL 3C8KA 4FQLH 1DJSA 5B8CB 2EDQA 3CH1B 5IIEA 4OF6A 1A64A 1IM3B 1K8IB 4DN3H 3CNKA 2E7CA 1IAII 1KACB 3D39E 5DD5L 3KPOA 5CGMA 1SM3H 2A9ML 4F37K 4MJID 1NCWH 3X14B 4U6YA 3CFBA 3ALXA 1FCCA 2Z92A 4QRQA 1BBJA 1YUHB 5I8KH 2IANB 3HG1B 4P9ML 4RWHA 1IGMH 3BIKA 2XA8H 2VRAA 2VE6A 5L8KB 1XGYL 2IQ9H 4PJHF 2MMXA 3BHBA 3GMQA 1GL4B 1M05B 3VCLA 3DX6A 3J8F7 4HC1H 4YHOL 2V2WB 4RDQF 5DD1L 2FSEB 1OPGL 1KBGH 3D3VD 1F4YL 3O3AB 3CSYB 5HPMA 5KBNC 2J4WH 2BOBA 5FYJD 5M95B 4KUZL 1YEGL 4CVWA 3WNLA 4WFGD 1DN2A 4LHQB 4AENB 1T1YB 2NY4C 2A6IA 1WBXB 1OGAB 3M17A 3WLWD 3BESR 2CRMA 2DI9A 5INDB 3MX0A 4QTHA 4OD2A 2J6EA 5GRVK 1N5AB 3V2AR 2GCYB 5DK2B 4ZUUA 4HH9B 1C1EL 3DETD 2J8OA 2YUZA 5MP6H 1ACYH 1DLFH 1E4JA 1CD1A 3GJFK 3IFLH 5TE6H 3GSVA 2OZ4A 5F96L 3C9NA 5BV7L 4XPBH 1DUZA 4O2CB 1UZ6F 2Z8WC 4GG8A 3S5LA 1NFDF 4JHWL 1MWAA 4NJAH 1I7TB 1U8MB 3GSQB 4DTGL 2PYFB 3KPRB 1A6AB 1IBGH 4NOFA 1YMHA 4JFFA 2CDFB 2Z91A 2D9QB 1CI5A 3WKNA 1KCRH 1B4RA 1T3FA 1EXUA 3R4DA 5HHOB 1J88A 4NO0D 5BO1H 4HGKC 4LLVB 3GJFA 2ENYA 3DUUB 2ZPKL 3MUY1 4RFNB 1MCPL 3HI5L 4TPRL 3ZMRA 4JFZH 3MUGA 5B3JF 5GZOD 3TH4T 1MI5D 1E27B 2OS7A 3OAUH 3EUUA 5DZOA 3MRJB 3MROB 1T6WA 5I6XB 5JA9A 2GKIA 3UZVB 4DAGL 3GBNL 3EYOA 5C0GA 1JWUA 4DKDC 1XF4B 1DVFA 1T1ZA 2ZUQC 3BQUD 3IJHB 3BD3A 2OM5A 1TQCC 2JK5B 4XHJC 1S9YA 3AXLA 3IFNL 4N8VB 3DO7A 5JZ7C 1UJ3A 5HGDA 3N06B 4W70A 5ACZA 1DSFL 5IB4A 5KOMC 5C0CB 4I3RL 4YFLF 4KTDL 4X4YB 3UJTH 4GMTL 3LKNB 4NO2A 4ZDHA 1LNUB 5SV3A 3MCKB 4YDIH 5MEQB 3Q6GL 2BK8A 1WVZA 3H8NA 2YN3A 3I2CH 2AJYH 3N85L 1HSBB 3HE6A 4PRNB 5BS0B 1OL0A 4Z7VA 5JHDB 5C0ND 1CZ8L 2MSPA 4LPUA 3GSOB 2YN5A 1I9JL 5D7IA 3HC3H 4P2OD 3MA7B 2ZUTA 1WIPA 5DMIL 3I3EA 3GRWL 4XGZA 5J8OA 3F5WB 4PJHB 4CRPA 5J06A 5BRZA 1GPOH 4CL7A 1AGDB 3VXRA 1N2RA 4OF5A 3QAZC 1J18A 1HHKA 1HDMB 4MD0B 3RU8H 3P11H 2A73B 1H3XA 3QDHA 2X6MA 5H35B 4FFWC 1G7QA 5DTFB 5HHMB 1DN0A 4JFFE 1R5IA 2PTVA 2VXTL 1AY1L 1X5KA 3T0BA 2C7UB 2F5AH 4FTVD 3T1FA 3EOAB 4XCFH 2QSCH 1A3LL 2NPLX 1J8KA 4OGYH 1FGVH 2ED8A 4GKZB 3RWJA 4POZD 2FR4A 5J4MA 4B7LA 4FN0A 4M43H 5T3XH 4X6DF 4OF0A 4CGTA 4OB5H 2FJGB 2LVCA 2F15A 2NY0D 5B4MD 3WJJA 3H42L 2X89D 5C09D 2E27H 2MJWA 3T3MF 1KXQE 4JFDB 5DHYA 4ODUB 3DVGB 2W0FB 4JHBA 5DHXB 2V2XB 3UAJC 2BHUA 3IJYA 4K2UL 1PY4A 2ORBH 5EO9B 1CD9B 4CN4A 1M6OB 3P4MA 4H0GA 1NFDB 1AI1H 2G2RB 3LMJH 1DVFC 2DF3A 3BW9B 3B9KA 3QQ9D 3P73B 1ZOXA 2IG2H 1B4JL 5I1KH 4PRHB 3WNPA 4GKSB 5IG7B 5IB1B 4Y16D 4NQXB 3TP4A 5F7EH 3ZHDA 3L3KA 1CT8A 4HUVB 1SYVA 1BWWA 3C8DA 3OKDA 5IR1B 3DX8A 4ESKA 2ZUYA 3MRIB 3C5ZD 4KK9C 4HAFA 4OTXL 1EEYA 3MNVB 1CDBA 2UWEB 1K4DA 3VFRA 5D7IE 1RJLA 2NY6D 1UH3A 3C60C 4LSQH 4BFGA 4MCZA 3O2DL 1MRFH 2DRUA 1G9ML 5E6ID 3SJVA 4PJAF 1QUNA 4JO4L 4NRYB 3VXRE 5MEOA 5E70A 3HI6H 1KNOB 1BOGA 1MHHA 5E5MB 3WN5A 1WT5C 1HH9B 5IBUB 2DIBA 1CDYA 4UAOB 4H8WH 4TTDC 3GMPA 1ORQA 3EFFB 4U3CA 4BZ2H 1NJ9B 1V05A 1CN4A 3MRRB 3MLPA 1JI1A 4JKMA 5EUKA 3C08L 3LS4L 1P4LA 5CHNB 3RJDA 1YEJL 2DB8A 2VIRB 1NMAL 1WICA 4L4VD 5T1LD 3O41A 3RGVA 3W2DH 5FGCE 1JNHB 4Y1AA 2NW3A 2VDMH 1H0DB 3B2VL 4DWHA 3BDXA 2R1WA 3FFDA 4BQ9A 1YEKH 2QQLL 3MV11 3DRQB 1B2WH 2DM7A 2DD8H 1F4XH 2ICEB 4TUOB 4CW1A 1UFUA 4X5XB 1AH1A 2DMKA 1A6PA 3NN8A 3RX7A 4G6KL 1UQSB 3PHSA 4K3JH 2X4NA 1ZT7B 2YPKB 5SV4A 2RCSL 5TQ0H 1FYTB 2BNRA 1D5ZA 1IC7L 1NGZA 3N9GH 1KV3A 2H8PA 2I9LA 3ARYA 3ZYZA 4OFKA 1KCVL 5L8JB 2HP4A 4PY7A 3V0VA 1JWMB 4X6DB 5FB8B 3QUMH 4EI5C 1A6UH 4C4KT 3CVHH 5DJCA 1KCUH 2MKWA 2PR4H 2XKNA 5FHBH 1GGYA 4P59H 3E8UL 2NQCA 4FG6C 3CX5J 2VLKB 3P4LA 3LSOA 3D2UA 5KZCD 1BZ7B 1XGTA 1AXTL 4JN1L 5I76A 3A6CL 4XNMB 3VFSA 4XCNB 3SJVE 3T3PE 2WUCL 2FJFA 3LPGA 4YGAB 1H15B 5D1QB 5CAYB 2GUOA 1RPQA 5F3HA 3SDCA 4MLSA 3S97C 1OCWH 1UWGL 3MUZ1 3MUHL 4UNTA 2V7HA 2PW2A 5GISH 1D9KD 1KIRB 1X7QA 2OMBA 5A1AA 1LEGA 1ETZB 1FFOA 2OR8A 4NZUH 1F90L 5GGRY 4AH2A 4DQOH 1DANT 2H26B 1SY6H 4N0FB 3BPCB 4PJ7A 2OP4L 4X8JA 1FL3A 1IGFL 1L4IA 3S6CA 5A16B 4Y1AE 3FT3B 4EQ3A 1ZWIB 3ZT5A 3S36L 4YX2H 3KS0H 4P4RA 3DIFB 3OBAA 4D8PB 1HWGB 3NAAL 5HGBB 1FO0L 5TFSH 1T7VA 1X5FA 5F6IC 4JG1H 4PJAB 1OAKL 4ZUSB 1IEBB 4JO3H 3DO3A 4NKMA 2WW8A 2BX5A 3SO5A 1J5OL 3VFWA 4LHUB 1OT2A 4L9LB 1ACZA 1I1RA 2BNRE 3ILPA 3UBXG 1PLGH 4XBEH 2F8VA 1LO2L 3O45A 3TLRA 4IHOB 4TULH 2P24B 3GMNA 1MQ8A 2VXVH 4LDOB 5HHNB 3HAEA 3BMVA 5EORL 5JORA 3REVB 2NXYC 4HCRH 1RULH 2DQUL 5C0JB 2CO6B 4OLVL 3U36B 1MLCA 5L0QC 4WIQA 3GHBL 4NZTH 1A9EB 1M1SA 1P5UA 1U58A 2WP3T 4AY0A 1A7RL 5IROC 3WXVH 3QQ3B 5MEPB 3QDJB 4MD5A 3VWJB 1OAXH 6CGTA 1WJ3A 4EUPG 3J7HA 5I0ZA 4QYOA 4YGVB 3NIDE 2E7MA 2Q3ZA 4RAVA 5D2LA 2DTSA 3RDTA 1HHJB 4YC2B 3DROB 2CRZA 3BP6B 2X9YA 1FJ1B 4JFHE 1JFQL 1MCRA 2IADA 2E7HA 2OMNA 2H1PL 4APQD 1JYVA 3DRTB 1DL7L 2D7QA 2M26A 4XPFL 3A67H 1YJDH 4Z0BL 3VE0A 5DMJB 1T22B 1NAMB 1PW3A 2Q76A 3O0RH 5B39A 1U6AL 3MRNA 5HGGS 4HUUA 4K94H 4Z78A 3AFLA 1E28B 3Q6FA 3AS1A 4O5LL 4F2MA 2IAMB 4MB5A 4NNYB 4RISL 2CIKA 3O3UN 1INDH 3PDOB 5JOPE 4EIGB 4PRBA 1T89C 1RZJC 4NKDA 5CD3A 4LSUH 1WBYA 4KUCF 3T2PA 1F11B 2VZ1A 4NCC2 4PV8A 3IAGC 4XMPH 5FGSA 1AP2A 2W07A 3M8OL 4M6NL 4NM8L 4G42A 4LNRA 2OTWA 5D1XA 1G9NH 2PO6D 2W9DH 3QP3A 2VDQL 3LS5H 3RWIA 2R0LH 5IEKA 5ANMA 1M7IA 1I8MA 1UADC 3V4VL 1CXIA 2VR4A 5EU6B 1YY9D 3FN9A 4MJ6A 2YMXH 1AD0B 4JO1L 4QHNA 1S5IH 1AR1D 3G9AB 5TE4H 3GGWB 1RUAL 4XRCB 2AK4A 5D1ZC 1Q9OB 3QSKB 4U1GC 3MYJA 3I6KB 3UTZA 3FOMA 4FXKA 4JPIB 1JTOA 1FGNL 4FQ2H 2EDYA 4FZEH 3OKNB 2NX5A 2ZCLL 2FH8A 5D7JB 3MRBA 1NBVH 4YHPA 2HA1A 1K6QL 5D2LE 1TJHH 4YO0B 4HXBL 4LCIH 3QEQE 2KL6A 4U4BA 5KAQF 1IGML 1JWSB 1Q0YL 4WV1C 2XA8L 1A4JA 3EOTH 2HJKA 4OLYH 1S7TB 4HC1L 5HYEA 1J1OL 3ARGC 7CGTA 5I9QC 4FZ8H 5F7YC 1CXHA 1X5YA 4PREB 4LSTH 1DBML 2QADC 1O5DT 2B1AH 2CKBB 3KYNB 4JFQA 2P5WA 4FQJH 4PBWD 3GIVB 1C08B 4LIQL 3RGHA 3VD5A 4EVNB 3BGMB 2CK2A 4I9WD 3VJ6A 5ITFB 3KLDA 3MGTA 1CICA 1RZ8A 3JUYA 1HIMH 1IGYA 5JO5B 1MCHA 4Z6AT 1JN6B 1OAUL 2O5XL 4M93B 3JWDH 1MVUB 1G0XA 4A6YH 4EOWH 3WS6A 3LQAC 1JRHL 2UUDK 2H9GA 4LRIC 1OP3H 1DLFL 3MV01 5HYQB 2JB6A 4WENB 4MJ4A 5ANME 4JR9H 2DJUA 5K93A 5IW6A 2VLKD 3CX5K 7FABL 3GSWB 1AKJD 1F4WL 5EU5B 4XC1H 5FYLH 2UY6A 4RMVA 3W9EB 5ICZB 1YY8B 1CFQB 3ARWA 3DMMD 1AGCA 4OAWA 1GZPA 1P2CA 3QIUD 4RMTA 5DD6A 3CC5B 1MHPH 4I18A 4KVNH 4UNVA 5FKAA 5C8JA 3H3PL 2AK4E 2IBZX 1R24A 3BZFB 1XAUA 3BZEA 2Y6SC 4LVHC 3DHMA 43C9A 4XVTL 2GTWA 2QLVB 4J4PA 2AV1B 5BO1L 3ILQD 2ITCA 3KJ6L 2DICA 1KELL 5FYJU 4G5ZH 1FSKC 2J7LA 5D5MA 1XZ0A 1C5BH 3HC0A 4YHKH 4U1HB 4YFLI 4YQXL 3FHQA 4OF3A 1FL6B 4WWKB 4ZAKD 4X6CF 4HPYL 5ERWA 5T1DL 3SGDH 1IVLA 1XF5B 3B3IA 2WV3A 1REIA 4FMKA 1DBJH 3A6BL 1JF1A 3G5XA 1MCQA 3ROLA 1R5WB 4Q0XH 4WJ5A 1FFNA 3O6KL 1NPUA 3IKKA 1D5BA 4I77L 3UTTB 3UJTL 3VG0H 2EE6A 2HFEB 4PYGA 1XIWD 2RB8A 4OIBA 4RMWA 2P5WE 4JFYA 3LPFA 4PR5A 1BIIB 1YDPA 2AJYL 1ERNA 3KPPA 4FXLA 5BCAA 3GUTA 3CK0H 4OKVA 2YD2A 3B43A 1RJZB 4JQXA 4P4KA 1S7QB 4OZHB 5EU7E 4OCYH 5DRNB 2EE9A 1WFNA 2MQ0A 4M3KB 3WHE0 2X5PA 3MREA 2NZIA 5EU7C 2VQ1A 1IGIH 3NCJL 4YHNA 3DGGB 4BFIB 2FJHA 3VWJD 4EBQH 2XTLA 3WDJA 1BF8A 1IGTB 1LE5B 4R96B 4CU6A 3ZTNH 4OZ4A 3ES6A 4EI6A 3UO1L 1AD9B 1OTSC 3QUKA 5EZIH 3TO4A 3AVEA 3EO9L 5EUOF 4E5XA 4OBSA 4CMMB 4LSRL 3ZSSA 5IEHA 1T5XA 4KI1A 5DLML 3VRLE 3ULUL 4CNIB 5JXEA 4OUOA 5D5ME 5JXAH 3OSKA 5J11C 4F37F 2FL5A 4M02A 3U9UA 2BY0A 1T83C 3UTSA 4KQ4L 3GMRB 1MFDH 2Y06H 5ALCH 5IFJB 4B41A 3QFJA 3X17A 4Y2DC 3WE6A 2VKWA 3C5JA 3QZWG 4GAYA 4LGPB 4YBLC 1W72H 3KPMB 1JGDB 1AGEB 4KQ3L 3SBWC 4QRRD 5ISZB 1ZGLP 4J3SA 5DMYA 2CR6A 1QA9B 1S9WA 3M1BB 5I17B 2YPVH 4CUCA 2VLJD 4EUPH 3L1OH 1ONQB 5BXFA 2I07B 3S7GA 4KZDL 5GGVY 2HH0H 1MJ8L 1N4XH 4NWUH 4NPYA 4XPHH 5CZVL 5HVWA 2NY4B 1Q9LA 4QNPF 4G3YL 1UWXH 5BVPL 3CU1A 1WZ1H 4X6CB 4WFED 4M7LT 4JZJC 1D5IL 1ZT4A 2DM4A 4X4ZA 5KSAD 4HIEA 1WC7B 4HWUA 4EN3B 2X1QA 1S5HB 5D7JD 4JCMA 3VXPA 4H0IA 3I3BA 3QULB 4MNGA 4PJ9D 1CGUA 2QL1A 1G6RB 4WUUA 4RFEA 4WI7A 2IPTL 2I60L 4P23A 3HS0B 1KB5A 4YDKH 4QRSA 1UT9A 4ZPVB 1KGCE 1V3JA 1VESA 1U93A 2APTA 4LU5H 2EH7H 2APFA 5C9KA 4UDTB 3OV6A 5EOQH 4MXVF 3OR6A 3MRLB 3W2DL 2XI9A 5CBAB 3ZT7A 4YDVA 1MQKH 1AO7A 2CLRB 1NKRA 3TEUA 4QHMB 1QR1A 1QEWA 4HJ0C 1H8SA 1B2WL 1CL7H 3O4LD 4KHTH 4Q74A 4XWGH 3UTSE 4NQDA 5C0RH 2DD8L 4LPYA 2F54E 4X7DC 1QP1A 2DLEA 1QSEB 3FQWB 4IDJH 5HHVH 2PETA 2D7MA 4P2QB 5K9KA 2Y07H 3QFJE 4GW1A 4K3JL 2W60A 5C0AD 3AU1A 1TQCB 4M1CD 5E1AA 4U6YB 5TQ0L 1RK1B 1MCOH 5DA0B 1KXTB 3BWAB 5T5FH 3QXWA 1V5JA 1E4XL 3N9GL 5BZWB 1LD9A 1K8DA 5T5NF 4ZFGH 1WUNT 3UC0H 5EUOB 4XVSH 1AC0A 3WFHA 5JW3H 4ZO7A 5FHAH 3VXMD 2BSSA 1A7OH 4QHLA 1MCWW 4EXKA 1J0JA 4MD4A 5FA4B 5FYJH 3HCVA 5DWUL 1HKFA 4Q9QL 1A9BB 1OD7A 1JGEA 4OUUA 2PXYB 4DCQB 1H3WM 4LK4A 4OCWL 3DGCR 5EN2B 3EIFA 4X4XB 4KUCD 5KJRH 3CLEL 3RNKB 3TT3L 4MNGE 5DJAB 4WUUE 2VLRB 1DBBH 1NFIA 3F58H 4WWKD 5E08L 3PL6A 3WUWB 1OAQH 5D2NA 2XWJA 5GISL 3MLTA 5A40E 1VA9A 4XXDB 5L9DL 1AHWC 4HFWA 2WWMC 2QEJA 2E8YA 2QR0A 3UROR 1SY6L 3NCYP 5FKPA 2DQGH 1RIHH 3ARBB 5GSVB 2J5LC 1EXUB 1AO7E 4XCCL 1FCGA 3ARDA 1Z0MA 1INEL 1E6OL 4IOFD 2YEZB 2YWZA 1P6AB 4LCYB 5F3BB 4GRLD 4IRZH 4NQDE 1HWHB 5AD0B 1R3HB 2A74A 4QF1A 4YAQA 4WNQA 1EFXA 4QXWA 1T4KB 1I3GH 4FFVD 5T1KD 2D03H 2YD8A 4HKXB 2Y5TA 2BY2A 5E9DB 1IC5L 2EIZB 3VFMA 2BXZA 3QDGA 1ES0A 3Q2CA 3P0GB 5HHQA 5C0DB 4YWGH 3PWVB 1GOFA 2H32H 1KYOJ 2IBBA 4P9HH 1PZ5A 5DK3A 1GAFH 4IJ3B 5GGSB 4HCRL 1RULL 3GB7B 2C5DC 2KQNA 1BZ9A 3V52H 1EHAA 5SX4I 5CZKA 4HK0A 4LQ1A 3WXVL 3IU4H 3QIBD 3PQYA 4UB0L 2BSTA 2Y36L 2R8SH 4OJFL 4R2GD 4F9LC 3KHOA 3T0AA 2A77L 5GSRB 4CVXB 4OZIB 3LEXB 5L8LB 3C60B 4I2XA 1NGXB 1TVHB 4MQXD 4TSAL 1MEXL 5C0BE 1PD6A 3TZVA 2C26A 3RVXC 4JZOA 2Q6WB 2UYLA 4P5TD 5MENA 3R8BB 2D7TH 3U4BH 3T0EC 1CDIA 1FFPB 1YJDL 4JRYB 4C58B 3T2QA 2HN7B 15C8L 5D2NE 2R56H 3IXTB 3SKNB 3D39D 3TCLA 4ORGB 1T03H 5I8OH 2GK2A 2VZ3A 5D2NC 2OL3A 2WWKT 3VD7A 4ODTL 4C83A 4ZQKA 3QNZB 2HMID 3VFOB 3BIAX 3BPOB 4KKAC 2ADFL 1KEGH 1CLOH 2FO4B 4KY1H 1XFPA 3QWOB 4AIOA 3S35L 2OTUA 4G7YL 4K71C 5FGCB 1XF2A 1J7VR 3IYLW 4KKCC 5DF0A 3SDDD 4YHZL 2AJXL 5E0QA 1EGJL 2ARJA 1PG7H 4MYWB 1A6VH 2EDHA 5I15H 1D6VH 5FDWB 1G9NL 2ZG2A 3JVGA 2HJFB 2R0LL 3STBA 3BDYL 1I1CA 4JE4B 3G9VA 1I9IL 3NIDF 1FL5B 3CFDA 3QDGE 5JTWA 3QO0A 5FOBB 1YEIH 3OGCA 2E6JA 2IJ0C 3SDYL 4YNYB 3VFVB 3GNMH 3FO9A 5TE4L 4PJBF 3BH9B 4QXTA 3U48A 1LO4L 3TVMD 1MRDL 5LWYH 2HJLB 3ALPA 2P5EE 5J89A 1KLUA 3K1KC 5D7SH 3GIZL 4HIIA 1NBQA 1B90A 4EI5B 3CD4A 5HGAA 1NCTA 5E8NB 3OGOE 3VI3F 1NCNA 3QQ4B 1RJYA 3FAWA 4I2XE 3TA3A 3RHWK 3VFRB 1XF3A 2W1NA 1GSMA 3QCTH 1MREL 2VDPL 4OD3H 4Y19B 1B88A 3QHZL 4H1LA 3P30H 3GHEH 4G6AD 4QRPB 4Z76A 5MENE 1JUFA 1KPRA 5HI5C 2LU7A 3GKZA 3TIEA 4MJ5A 2EICA 3FB8A 1JPSH 1MIEH 1P1ZB 1UXWA 1UM4L 5H94B 4HIHA 1UWEL 4DFIA 1KENH 2SEBB 4GW4B 1SJHA 1LEKA 3DSNA 5DD0H 3CDFA 2AK1H 2Z8RA 4LMQE 4F7PB 1WWCA 5A3ID 4NKOB 1FLRL 2IPKA 1I3RA 1U8LB 4OLWH 2AV7B 1Y0LA 4KI5C 3U0WH 1N59A 1UVQA 2EIBA 5KSVB 1PQZB 3FQNA 3QT2A 3WHXA 3VGAC 5BMFL 3ZO0A 5I1EH 1AQKH 3MRGB 1QFOA 3QEHA 4PJCA 2WM0A 5DHVA 4Y1AB 5IFHH 4J3TA 4Y4FB 5F9JA 4CMHC 3RWCB 4NHUA 4O00A 5F6IB 1MH5A 4DOHB 4PTUB 1MFBH 2DQFA 2EYSA 3ZE2E 1NGYB 1W0VB 5IVXA 5DSCB 4JR9L 2YPLB 2C1OA 4MA8L 1DCLA 3WKML 1DQMH 2AXFB 4ZUVB 4XVJL 3BGFC 3WIHA 2ZNWA 5CJOL 1KUMA 4HUNB 1Q9KB 2HKHH 4KVNL 1OF2A 4DKEH 5JW4M 1F97A 4IOIA 2NY7L 4GAJH 3F7PC 2XKUA 2R2EA 3EOBB 5L2JB 2NXYB 4EZMA 5L0QB 4K7PH 2OK0H 1U91B 3IFPA 1ZKAA 3MRFB 4M5ZL 3G6JE 2EEDA 4Y7MA 1T0MA 3RA7H 3ZE0E 4JM2A 1C7TA 2YHGA 2ID5A 1FVCB 4YPGA 5EZJB 4JFFD 4XCYB 4JPVH 3SKUD 5EU3B 1KB9J 3L5XL 4PLOB 1G7JB 3IGAB 3PGFL 4S10A 2ZOKB 3QUYA 3T4AB 5EBMA 1QHPA 4D3CH 1HN1A 1MJ7H 1OTUD 3D0LB 2J8HA 1JZ5A 3B9AA 1KPVA 1KJMB 1CF8H 4PJBB 3PE9A 5JDSA 3H9HB 3O3EA 3VG0L 1CG9B 2EC8A 3UAJD 1RUMH 1G6VK 2Z35A 4P57B 3U6RA 1S7UB 1FNEA 4XPTL 2XY1A 3S34H 4K8RC 5FIEA 3QEGH 1LO5A 1DVFD 3R8QA 1I8KB 3HUJA 3OQ3B 4XT1C 2EDLA 1I1YA 1KYOK 2AEQH 4PJCE 5K9QI 3WEXB 4F15C 4OQ1A 5E2UH 4PJGA 2J8UF 4NZDA 2JTDA 4X6EB 4P46A 2N1KA 5IVXE 4I5BB 1A5FH 1QLRA 4EBQL 1UM6L 1WBZB 1JE6A 3JBG7 1T04B 4K9EL 1VENA 4HZAA 3P2TA 3BN9C 3F6LA 2A1WH 1UYWH 4FABH 2XZCL 3P4OB 2HG5A 1KIPB 1KCKA 1JHTA 1GGIL 1H5BC 5D1ZB 4U1GB 1GGUA 4L8SA 4NQEA 4NO5A 3MR9A 2JJSA 1YN7A 2CKNA 4NZRH 4JRYD 2O5YH 1A1OA 1IAIL 3VXRD 3DX7B 4JAMA 1QFWI 1YQVH 1CU4H 4JKPL 4PJXF 3VXUB 1XH3B 4DVBA 5IWLA 3STZA 1LO0H 3BN3B 1I75A 1MFEL 2DYPB 5E4EC 3QA3A 3IDGB 5I1GH 3ZKND 4BFEA 5KSBF 2VDLH 5DQ9B 1OGTA 3G5VA 4HBCL 5HVGB 3RY6A 1X6NA 2NR6C 5ITBH 3ABZA 4WV1B 3PV6B 2HT4C 5IJVA 4GRMB 5EB9A 1W0WA 1ZK9A 1QLFA 5T1MA 3QEQB 2HKFL 3ARGB 4FNLL 4PLKD 2YPVL 2ICWJ 3NH7H 4ODVH 3Q5OA 2HVJB 3EYVB 4CADA 2QADB 2IH3A 1B6UA 3QXUA 1CYGA 3LN4B 4WI8A 3U9PL 5IM7B 3X11B 3HUJE 1D5MA 4PJ8C 1JZ4A 4WI4A 3GSNB 3WL9B 2AJ3B 2FIKB 3DUHA 5EIIA 3B9KD 4OQTL 4W68A 5FUOL 3MLUH 4OLUL 4DEPB 4R4FH 4PJGE 1YNTA 3EFDH 1LO3L 1CBVL 1ZANL 4XPAH 1LEIB 4YHLL 2XN9B 3BPLB 5H8DA 4X98A 5JA8B 2CGRL 3SGKA 3ARFC 4TSCH 5AZEL 3PXHA 2VXSH 1EUTA 4G9DA 3PXJA 3D18B 1YYLH 2Q7YB 4CVZA 2VQUA 2DBLL 3INUL 2X1WL 5E00B 4DVRL 2AEWA 4IRSA 4LLYB 2BOCB 1FZOA 3DV4B 4KDWA 3MV9B 5KG9B 4NQEE 3OKKA 3LAFA 4LVHB 4S1QH 1ITBB 3KGRA 2C3HA 4Q9RH 5DRXA 4PP2B 4UQ2B 5HDBE 4JFPA 5DJDA 1T1WA 3SJVD 3I02A 4KAQH 2V6HA 5DFTA 1FSKB 3CFEA 2JJSC 3ECBA 4GMSL 3MJ8B 4YDJB 2VQTA 2J8UB 2MCG1 5CEXA 1NGPH 2A6JB 3L5WB 1P4IL 3THML 4RNRB 3KPSA 2P8PB 4NNXB 4FQIH 2CLVA 4D0DA 4XZUA 3GRWA 4LLUB 3RGVD 4ODWB 4ETQA 5DUMH 3RY6C 1MCOL 5EIQA 3VA6A 4QTIH 1F42A 4Y1AD 3T0DA 2NZ9C 2R69L 3MBEA 4P2RB 1Q38A 3S37H 4ZFZB 2GSIB 3QWRA 5CJQL 3I6GB 2R2HB 1W0YT 4UV7H 1IAKA 4MAYC 4ELME 2WBKA 4YBQD 2YPLD 4XVSL 1UACH 4P5KB 4Y5YC 5C0EA 5CEZL 2PTUA 1T0PB 4S0SD 4U6XB 3GMLA 1TTFA 2XACC 4PJXB 1A2YB 1MCBA 5JLZA 4LCCC 4PRPB 1RSFA 4G43B 4O02H 1QFPA 4JDTL 5KSBB 3OB0K 3PUCA 3ZKMC 1U92B 1GHFL 5GS3A 4PB9H 4L5FL 2FATH 5JDJA 4HPOH 3HZMB 5E2VH 1JVKA 3HMXL 1KJ2H 4OI8A 1U8QB 2ENSA 5INCA 1G1CA 4RSVA 5E8OA 5CP7B 4HX1B 3HZVB 4G8GB 4LSVL 4JFEB 3EDKA 3FJTA 4RRPA 3SGKC 3MJ9H 1ADQL 3PGDB 4NYLB 4PG2A 1KB9K 3D2UD 4Q2ZB 1T7XA 5I1HH 3PWNB 1QYGL 4JRXA 5F1KC 5F1IA 5JNYB 3VXOB 1YEEH 2EDWA 1RIUH 3UBXA 1BPVA 4YUEL 4LEXH 5C71A 1XCTA 4IRSC 4PRDB 4JFHD 1S8DB 2DQGL 4YH6A 1NSNH 4Q6IA 2WIIA 3L3OB 1KPUA 4IIQA 4R6UA 3KYKH 2BSRB 1Q1JH 1M7DB 5IK3A 4WW2A 3BDBA 3S4SG 2ITCB 1CE6A 1PYWA 2F5BL 3SDCD 5J11B 4Y5XA 5C2BH 2NY1B 4K3DH 2IC2A 1NEZG 3HC0B 4BM7A 5IMKA 3KPSE 3MJ7A 4UILH 4JM4H 1D5XA 1JHLL 3V9FA 2Q87A 1I3GL 4PJEB 5L2KE 5IBLD 1F4HA 4OCLC 4Y2DB 5JOPD 2LAGB 2P42B 3O2DA 1MF2L 3DVNB 1X5AA 2XQYG 3V7AE 3SE4C 2XWBB 1K2DA 4ERSH 4UTAH 4ZS6D 2OZ4L 1IE5A 5HHXH 2IGFL 3O6FA 2DLFH 2ZUWA 4L3CB 2DWEA 4HULB 5A2IH 5CWSA 3T8XA 3MO1B 1A7NH 1SHMA 1B6DA 5JPNB 4CVUA 5CSBA 2CRYA 1DBKL 1KTRL 1U8IB 4GW5B 4ZOBA 4MCYB 3MV8B 4WDIA 4JZJB 3GSXA 5F7LB 1DFBH 4MX7A 4PRAB 4XPGL 1FQ9C 4F57H 4GQPH 3G04A 4P3DA 5F9OH 2VO5A 1FZJA 4WU5B 4Z77A 2GJZB 4R3SA 2D7TL 4ORZC 1MFNA 2R15A 4UT7L 1CGWA 3RVWC 5GS0D 2Z8SA 5GGVL 2BNUB 2R56L 5D9SA 1LDPH 2ATKB 5DMKA 3C6LA 4NWTL 5GRJH 5I8OL 4JRXE 1T03L 4GBXC 1NLDL 1N6QH 4UV4H 4MDJB 2IQAB 4L1HA 3MGOA 3MACL 1PKQA 1VFAA 3LB6C 1Z5LA 4O51B 4EJ1C 1F8TH 3QEQD 4QXGL 2G9HA 3FQTB 3K46A 2ZP0T 1NAMH 4R7DA 4OD1H 3MLVH 4LPTA 4XXCC 1NLBH 4H25A 1J05A 1I8LC 2E6QA 2B8OT 5I74C 5KSUA 1YA5A 5DDHA 4OZFG 3WHE1 1A6VL 1VB9A 4FHBD 1KF9B 4DGIH 5IMOB 1PDKA 3QCVL 1NKOA 3T65A 5ADOH 2F54B