5KSUA

Crystal structure of hla-dq2.5-clip1 at 2.73 resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Unraveling the structural basis for the unusually rich association of human leukocyte antigen DQ2.5 with class-II-associated invariant chain peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 182
sequence length 182
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksuA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksuA01
4RAVA 3WSQL 1KELH 3GSOA 2X9WA 2K7QA 2ICWI 1MI5A 1NCBH 3B9KA 1KJ2H 4GRMA 4RBPH 3S9DB 3K7UA 4LDOB 1AQKH 3FFCA 2GTWA 5F7DA 5DTFA 1KCUL 4FQHB 3PWNB 1Q0XL 1F6AA 2W0FA 3IRPX 4L9DA 1BFVL 3FO0L 4E9LA 3GSQA 2A2QT 3GGWA 3DSNA 5FOBA 3VWJD 2H9GA 4GS7C 1WVZA 1YMMD 2F74B 1U8HB 3RA7H 1A5FL 4XBPA 2Y36L 5IMLB 4HAFA 2UUDH 4G6AD 5C7XH 3NN8B 4FRWA 4TVPD 1X4XA 1D5MA 3SDCB 2YS4A 2OTWB 3HR5B 2Q6WB 5T1DL 4TVPL 4FOMA 3PNWA 1A7NL 2C3HA 4FFZL 3U7YL 4JM4L 3KJ4B 4OLVL 4RAVB 1JP5A 2G2RB 5CJ8A 1YY9C 5D71H 1EERB 1MI5B 5H8DA 1UJ3C 3BSZH 3BZ4A 3B9KB 1U8PA 4GRMB 3UJTH 2PXYA 4U7SA 4Y4HC 2VL4A 4WNQB 4BELD 1FAIH 5KVFH 3TIDB 4OTXL 2DL9A 1A7QL 5DSCB 2KQNA 4XX1G 4Y4FD 3FFCB 5F7KC 1MSPA 3RVUD 1TZHB 4O2FB 5F7DB 3EOBB 3ROLA 1FGVL 3MGOA 4R7NA 1GL4B 3CCHB 5IF0A 3BD3A 4PRPA 1F6AB 1PJ9A 2W0FB 4ZD3H 4UOW1 2YWYA 3MJ6A 2LVCA 3GSQB 4TUKH 4CVUA 2ID5A 2HA1A 5L6YH 2AEQL 4KK8D 4UT7L 4XBPB 5I73B 1URLA 2A9MH 5IVXB 1NBQA 5LGKA 5HYQA 5K9QI 1D5MB 1BVZA 2KKQA 4XMKL 4F37K 4I3GA 4H25B 4L29A 2Z91B 4TULL 4GXUM 4RBPK 2K9UA 1BF8A 4P9HL 2OR7A 2PXYB 2Z93A 3EJZC 3PXJA 1FZJB 2V7HB 4ZUUB 1R3IH 1ADQH 4RISL 1A4KA 3RPIA 3HPLB 3T09A 1C8PA 3MGOB 1AR2A 3V4PL 2HN7A 5IF0B 4PRPB 5CUSL 4Y16A 4RMWA 1J8HD 1BAFL 3AVEA 4LKXB 2JCCE 4GAFB 4U1SB 1TZGH 3LKPA 1J1XH 4MB3A 1S9WA 2UUDK 4R4BA 5HGBA 4KZEL 3LPGA 3E2HB 3KJ4C 4NN7B 5HYQB 2ED9A 1MCJA 3QUYA 5HHOA 3MRGA 4UNUA 1DBKL 1MREH 1FGNL 3Q2CA 4PGEA 3DLQR 1TCRB 3QHTC 4ONFH 4XH2A 2APBA 1IGCL 4K3DH 2GUOA 5DS8A 1IGML 4XVTH 4DKFL 4Y5VB 3RIFK 2J4WH 2G5RA 4XWOD 5GS1C 2NXYD 2Z93B 1DQLL 4HK3N 1F11A 4JVUA 1A4KB 2NYYD 5IB1A 1W0YT 3K2UH 3K80A 3MBEB 5I73C 1TJGL 5FA4A 5C09E 2D7OA 4BKLA 4P3WA 4Y16B 3NZ8A 4P3DA 4YAQB 3ZHDA 3LKPB 1S9WB 3MJ9L 2G75A 1OAZH 5HGBB 4D9RE 2VDRH 2X1OA 4LSQL 2CD0A 1L0YA 1IL1A 1BZ9B 1I3GL 4M9OA 3QO1A 1OQOA 5HJ3A 4LDLB 2XQYG 1MHEA 3QUYB 5HHOB 3MRGB 1J0HA 4P2QB 1DBMH 4U0RB 4XH2B 3TM6A 1YEFL 4FG6D 4MA1B 4YBQC 3W2DH 3VFPB 4GMSL 1QFPA 4WHDA 1XGPB 2HT2C 2J7LA 3RVXC 2AV1A 5FECA 2FGWH 2GK0A 3GBML 4F8TA 2H1PL 5IB1B 5D2LA 3QCVL 1DQMH 4L3CB 4ZUWA 1YUHB 4R8WH 5F21B 2OL3H 4JGJA 4DQOL 1A1OB 2GQHA 3E2HC 3TH4T 5D2NA 1VFBA 4Q0XH 1YYLH 1FFPA 4PJIF 5HHNA 2J8UA 3HB3C 1DLFL 4LCYA 3MLWL 2EDNA 2G75B 4LSVL 5C2UB 2AJUH 3QFJA 4JFFD 4A6YL 5E0QA 1WBZB 1U3JA 5DT1H 3N1FC 2AXFA 4P5TD 2YUZA 1MHEB 4L8DA 4EBQH 2CLRA 1CN4A 3ARGC 1CLZH 2NLJA 4HEME 4R97C 4XHJC 1K8DB 1O7VA 1UM4H 1GZPA 1VERA 2AEPH 4NRXB 4WWKB 4XP9H 2XWTA 2NXZC 1JF5A 3MBEC 5I0ZA 3O2VL 2X7LA 3GBNL 3RWDA 4ZFFB 1KJ3H 2MQ0A 2FGZA 5FECB 2GK0B 5EU6A 4TVPE 4DOHB 2R1WA 3O3AB 1D3CA 4Z7NE 4PFEA 4ZUWB 5EOQH 1LMKA 1C7TA 3F7VA 5D2NB 1F58L 3VFRA 1NBVL 1RPQA 2ZUXA 5HHNB 2J8UB 1AE6H 4LCYB 4QNPE 4AK1A 5DRZB 2MSPA 3U2SA 2FNBA 3O3DA 4U0RC 5E5UB 3BDXA 1RUML 1VGEL 1W72A 4MA1C 1IARB 4KQ3L 2AXFB 1OGTB 4RGMB 4N0RA 5DRNA 4KTEL 2DM7A 4DGVL 4L8DB 4Q9QL 4O9HH 3VWKD 3ES6A 4I77L 1C5BH 4M8QA 5C86A 2QLVB 2A0LC 3M1BB 3JVGA 2H2PD 1U42A 4V2BA 4R3SA 5C0IA 1KPVB 2P7TB 5J1AA 3RWDB 2LV4A 1AD0B 1CBVH 5EU6B 3OG4B 1VENA 4XAWL 5IROA 4LLUB 4G8FA 5INDA 3R8BB 3D18B 4M48L 1EMTL 4PV9A 1J10A 5TDOA 1KELL 4DWHA 5GS0C 3F7VB 3VI3E 1NCBL 3LY6A 1KJ2L 4X9IA 5JR1H 2H45A 3R4DA 1FO0A 1AQKL 1JF1B 1UA6H 3U2SB 4AZ8A 4X9GA 2XN9D 3O3DB 3O4OB 3O2WH 2H2SC 1JNNH 3LKQA 4WWKC 1FC1A 3WNNA 1MRFH 1IM3A 1CE1H 1EAPA 1MFCH 4GLRI 4WW2F 2DMCA 3ES6B 4YR6B 4FFWD 3SDXF 4M8QB 4K7FB 1IEBA 2ZNWA 3MRJA 5CILH 4N0UB 3MNWA 3RA7L 4MNQA 5BXFA 3DVNA 1PLGL 3VE0B 5C0IB 1DDHA 4UQ3A 2APVA 4NNPH 4X99A 5C7XL 4XNYL 1BOYA 3P30H 1B4JL 3BD4A 3DXAD 1S9XA 5ADOH 1A0QH 5INDB 4XMPL 1S7XB 2F9BT 4MCZA 5IBUG 3V6FA 1ZLUH 4PV9B 4YC2B 4JQVC 4KTYA 4HAGA 5D71L 4JG0L 2CDFA 5DD5H 1T1XB 2EYTA 1CVRA 3UJTL 1E28B 4RGMC 8CGTA 4YBLB 2PTUA 3RNKB 4JRYB 3HPJA 1FAIL 1FO0B 5KVFL 2NZ9C 2ZPKH 2RFXB 4MXWL 1EBAA 4UBDD 2RCSH 1E27A 1OWRM 5F9OH 1Y6NR 1UWXH 4FFYH 1GPOL 2X4TA 5E8NB 4JFHD 1CT8B 3STZA 5JORA 4TUKL 1A9BA 4Z0XA 4C56E 5L6YL 1TNNA 4OFIA 5I71C 4ZOAA 3ARVA 3DVNB 1J05A 4D0CA 1G9MH 1XAUA 1MAJA 3NMEA 1DDHB 1T7XA 5E2TH 3AREA 4UQ3B 1ZK9A 3HE6A 3CLFH 3RIAK 4LCWD 3WMSA 1SM3H 5CGMA 5KSUA 1S9XB 1QR4A 5I1LA 4OIAA 4MCZB 5DVLA 3OKNB 3BOVA 3IFLL 1PZUB 3GMOA 4GAYA 1HCFX 4ZS6D 5EO9A 4OLYH 1KNOA 3O4OC 2EYTB 4RIRA 2NY4B 2CLZB 3UEZA 3HPJB 1UQSA 2ICEA 1R3IL 5HI5C 1F02I 1HQ4A 1LP9B 1YEEH 1N6QH 4WFHE 5CZXC 1E27B 2GTZA 4UMGA 4URTB 5AG9A 1IGTA 4FZ8H 1A6WH 3STZB 2VDOH 4HWUA 3K1KC 1A9BB 4J23A 1HHIA 4Z0XB 2DIAA 1J1XL 3OZ9H 1CYGA 4M61B 4NDMA 3AREB 1B9ZA 4YC2C 3HE6B 2VLKE 4BK5A 3BAEL 4YHPA 4R26H 5KS9F 4ZXBD 1MREL 3AMKA 3LQAC 4U1KB 4PJFA 4ONFL 5DZLA 1FL3A 4K3DL 3GMOB 2MQ3A 4EN3D 3CX5K 5SWZE 2J4WL 3KYKL 4RIRB 2R69H 5GS2H 2CDEA 3MFGB 4MDIB 2X89A 2R23A 4WTWA 1I9IH 3LD8B 1FZMB 4PLKC 3SGKC 1QG3A 1I9EA 1UWXK 1HQ4B 2DM4A 3K2UL 4PJBF 2GTZB 1WICA 1U91A 4NGHH 4XP4H 1IGTB 4EI6A 1FE8H 2VTFA 3UO1H 4ZODA 3ILQC 3KPPA 4XPFH 3P4NB 4PJAF 5DJCA 1F3RB 1EJ6A 2DQDL 2VDRL 4NDMB 2LVEA 4Y19A 3L3DA 5IV2B 4YHPB 1ZLSL 1N2RA 4NYLB 2V7NB 3MA7A 3O6MH 1I9RH 5JHLH 4UDUA 4X6CA 1DBML 4PJFB 2AI0H 1FL3B 4G9DB 4I4WA 1E4KC 3W2DL 1A6TB 5IMMA 4RAHA 2UY7A 3X17A 3EYOA 1XH3B 5DHVB 2CDEB 1MOEA 1BQHA 1ZHKB 2BZDA 4P9MH 4WJ5A 5CS7A 4OT1H 2FGWL 2FYYA 2R23B 5C6TH 2FO1A 5C0BE 4EXKA 5JHDB 1RURH 4L9LA 4F3FA 3O9WC 5E2VL 1DQML 2W9DH 3QDGA 4R8WL 2C4FU 1I8LC 1U91B 2OL3L 2M8XA 4YHOH 3MFFA 2DKSA 2YZ8A 1FRGH 2W38A 5J13B 2VLJB 5IJKC 1UGNA 4G3YL 1SVZA 3KPPB 5I8OH 5DJCB 1BQSA 4JFEA 3U9UA 5EOCJ 3KPOA 3NCEB 1IAII 2AJUL 2IG2H 1NMCC 1ZVSA 1KB9J 5DT1L 2XN9E 1XZ0A 4YDVA 3L3DB 4JDZB 1UWEH 4XWGH 2OM5A 2F54A 1N2RB 2QR0A 3MA7B 4RZCA 3MV9A 2NY2D 4EBQL 1NCAH 4QKXB 1G9EA 3QQ4B 3FZUC 4X6CB 1CLZL 4PRBA 1CFQB 3CSYA 2Y72A 3L1OH 5SX5H 3JWDL 4OF3A 3NZHH 1UM4L 4PJCA 5FHAH 1PYWA 3ARFC 5JW4M 2AEPL 3TO2B 1W0WB 5IMKB 5IR1A 3SO3B 2YXFA 1BQHB 1IZKA 4WJ5B 5C3LD 1KJ3L 4LOUC 4NQCD 4L4TD 3PF2A 3JTSA 4BZYA 5EC2B 5CEZH 1LO2H 3DXAE 2C26A 2VABB 3O3EA 3O6LH 2EEDA 4ELME 3SKOB 3V6OA 3QXUA 1AE6L 4JFEB 4QHLA 1EEQA 3S4SA 5IFJA 2J6EH 4S11A 5E2WH 3KPOB 4K2UH 3LH2H 5BV7H 2YWZA 3ZTJH 2Z0BA 3QDMA 4HJJH 3R1GH 4TTGA 4PJXA 2F54B 2QR0B 5DJAA 4LU5H 2E6QA 4PY8I 2DIJA 4RZCB 3MV9B 5DXWA 4F9LC 4O9HL 3AB0B 4PRBB 3QQ3A 4LHUA 1MCKA 4WDIA 2AJ3B 1U9KA 1VGKA 3DX6B 1AP2B 3LKNB 1OQXA 3NCYS 4XB7A 4ZUTA 2NY6B 1CBVL 3DMMA 1GGCH 4E5XB 4HWZB 5I6XB 2EXYC 3ARRA 5F8QC 4I3SH 3T0ED 4U1GB 1A2YA 5T1KD 2F19H 4F7EB 2FBJH 4JY5H 1AC6A 4BQ9A 4FTVD 3WIHL 4GMTL 5JXEA 5IFJB 1MQKH 1UA6L 5IW3A 4CAGA 2DLGA 3NIDE 2ZWLT 2IAMA 4IRSA 3O2WL 5C70A 1V3KA 1JNNL 3DX7A 4ERSH 3OKMA 2P5WA 1CE1L 4KMLB 5SX5K 3DSFL 3SO3C 4NUJA 1OPGH 1UZ6E 1GOFA 2F5AL 5EORL 4YPGB 1CVSC 4ZAKD 1P9MA 3BH9B 4GAJL 5F44A 3H9HA 4Q97A 3OR7A 4WV1A 3MMEA 5JIKA 4GW4B 4PJHB 4NNPL 3JTTB 5BJTA 4ZUTB 3DMMB 1RJZB 3QUXD 1HSAA 4I5BA 4QWWC 5ADOL 1A0QL 4YGAB 2NX5E 1T1ZB 1QSFB 3TH3T 2ZSVB 2CKBB 1OP5K 1A2YB 4P23B 1LEKA 3JUZA 5IIEB 5DD5L 4IMKC 5DR5H 4G7YL 4OFDA 5TE4H 3FRUB 1MCBA 4OJFH 1CIDA 4XBEH 5KSBE 5DHYA 5I17A 3IDMA 3OJDA 3AB0C 4NBXB 2IAMB 4JFOA 4X6DF 3DO7A 5EU4A 4IRSB 3VXSD 1EAJA 1E4XH 1A7OH 1KJMA 1P7KA 4XNXH 5F9OL 4FFYL 2XKNA 2P5WB 4PR5A 3O3BA 4NUJB 3SJVB 4NQED 3P0GB 3I3EA 5KZCB 1KFAH 3H9HB 1G9ML 5GZND 2KZ1B 1YEJH 4Q7DA 2XYCA 5E2TL 1LNUB 2HJKB 4U1GC 5BJTB 3CLFL 1SM3L 4PP1C 5T1LA 4DGIH 1X5XA 4RMTA 4PJ9A 4R96B 3X3GH 1XIWD 2IH3A 5EWIL 1YN6A 5IB2A 1IRAY 1LILA 3MJ7A 3UTOA 1I1AA 4HK3J 1HILA 4OLYL 4AQOA 4KJPC 4KK5D 1RIHH 2APXA 1KB5B 5DHYB 5I17B 2GJ6A 5EZIH 4I9WD 2CIKB 5MEPA 2Q76A 5TFSH 1YEEL 1N6QL 1L7IH 1KJMB 3ZSTA 4LLWB 3G9AB 3HI5H 5L2KD 3P9MA 4FZ8L 4PR5B 1A6WL 3MRDA 3O3BB 2VDOL 4GT7A 3O8XA 4LCIH 2B4CH 1NLDL 3TN0A 5L8KB 3OZ9L 4E0RA 4J4PD 1IKNC 4R26L 4ZDHA 4LVOB 3MV8D 2UWEF 4PJ5E 4X7DC 4PJ9B 2FD6H 5JIIA 2C3XA 3DI3B 5I75B 4QRPA 4NQDE 2EIZB 5IB2B 3MJ7B 1BWWA 1D7FA 1FV1A 4FQXB 4EI5A 4GOSA 5GS2D 4LEOA 4HKZA 2R69L 2PYFA 4A2LA 5FM8A 4OKDA 2GJ6B 3RY4A 5DQ9A 1I9IL 4X6FA 4NQCE 1QA9A 3D87B 5ACMA 43C9A 4F33A 3P9MB 4NGHL 4XP4L 5JXAH 4P2RE 3MRDB 4H0HB 4O4YH 4F7PB 1WFTA 1NFIA 1VHPA 3UO1L 5HHQA 3QHZL 3G6AA 3WIFA 4XPFL 3VXUA 3TN0B 1QFUH 4MAYA 4AIZA 3NCMA 4E0RB 3UAJC 4D0BB 3O6FA 5M95B 1YNLH 5BRZE 3UTSE 1M7XA 2FR4A 5DD0H 3T0DA 3V52L 4KVCH 1I9RL 5JHLL 1Y6MR 3H7LA 3I6LD 3IDYB 4QRPB 2QEJA 3Q3GA 2AI0L 3TBVA 1T5WB 2V17H 4EI5B 1HXMA 5H2BA 1E4XI 2PR4H 2OXGA 1CXEA 1AR1D 5DJ6A 4P9ML 3NCJH 4OT1L 2EDFA 5K9KB 4M02A 5C6TL 4M6OH 2WWMC 2LAAA 4B50A 1QA9B 1NANI 2RHEA 4G8IA 3MUJA 2FWOA 2W9DL 2KBGA 3W39A 2EIBA 1BFSA 3MV7D 3PHSA 4YHOL 3T0EE 4U31A 1FRGL 2IH1A 3HTLX 5KVGH 4XP1L 2FX7H 4LVOC 3WIFB 5E1AA 3QXTA 5I8OL 4FTVE 3CFJA 1ETZB 3MRNA 2IG2L 4PRIB 1KTLA 2ITCB 5E6ZA 1MJJA 2HKFH 1TTUA 1IBGL 2YD4A 4FQXC 4XWGL 1UWEL 4KI5D 3V2AR 2FR4B 1RZ7H 1C16A 1NCAL 5E7FA 3C5SA 2IBBA 3Q3GB 1JL8A 2A73B 2IMMA 3KS0J 1OY3B 3QAZB 5B39G 1EDQA 4QGYA 1JHTB 5FHAL 5H2BB 4NN6C 3ARQA 2YD1A 5CEZD 3H3PH 4Z7UE 1SEBA 4K3HA 3RTQB 5EZJA 1NBYB 2MQCA 5CEZL 1LO2L 3ETBF 3QHFH 4POZC 3UBXG 2FWOB 4FS0A 1P7QD 3EAKA 3K81A 4W6YB 4AL8H 3RU8H 3H9SB 1Q94A 1CICB 2D7TH 1NAMH 2DQGL 1AKJB 4WW1B 2MPAH 3HAEB 3SDAD 3FQRA 2J6EL 4R0LC 5E2WL 2ARJQ 5JDSB 4K2UL 3C2SA 1Y18A 3CFJB 3IDYC 3WJLA 3MRNB 1NH6A 1BD2D 4FMFA 5DJDA 3S7GA 1KTLB 1ZT1A 4MQ7B 3TT3H 3N0PB 1MJJB 4GFTB 4WRLA 4WU7A 5HGHA 4QTIH 1TITA 4KMTH 4LU5L 5DMGC 3AY4A 1U93B 3WLBA 3B9DA 3Q6FB 5DRXA 3FO9A 3D39E 3CFEA 4KJWC 3ESUF 3C5SB 2D0FA 3ZE1F 4NQEE 1KENH 5FGCB 4OZHE 3ZKMC 1GC1H 2BVOB 5EOCH 3V7AE 4CN6A 1Z9OA 2JJTC 1DVFA 4UQ2A 5KW9H 3T2PA 1SEBB 2GI7A 5EZJB 4OUUA 5D7IF 3QULB 4IRZH 1I3RA 1ZXQA 1VEOA 2RAMA 4I3SL 2MHAA 1KIUA 4Q58C 2Z31D 1PG7X 2F19L 1FVCA 3NTCH 1MUJA 3DETC 2FBJL 1Q94B 4JY5L 4K8RH 1QTYT 2BVPA 2WM0A 3TFKD 3ARXA 4JRXD 3NACH 4LGRB 4NBZB 1MQKL 4GKNB 1Y18B 1U3HD 1LO0H 5DJDB 4AH2A 1ZT1B 3MC0A 3D2UD 4I9WE 1CE6A 4HZLA 4WU7B 4HK0A 4BZ1H 3C60D 1QFWM 1UG9A 4ERSL 3ARPA 4HUMB 3WLBB 1DEEB 5L2KE 5DRXB 1YJDH 3FO9B 5FYKH 1FVEB 5HYEA 2Y07L 1OPGL 3RTQC 4MZ2A 2EYRB 3CMGA 4LNRA 1KPUA 1ORSA 3PGCA 4KROD 4I0PD 1KULA 5IVXF 1LHZA 3T4AA 4QY8B 4KKCD 1H0DB 4UQ2B 1L9NA 3HG1E 2CJUH 4MQSB 2WP3O 1CICC 3MACL 2DQUL 1AO7A 3MV8E 3VXTB 4F7CA 1I3RB 8FABB 1Q8MA 4LBEA 5CP7B 3QDJA 3P4OA 2C4FT 3CFDA 1FVCB 4P2YA 4UTBH 4O51A 3RVWC 5DURB 4J8RA 1CF8H 2YUVA 5J06A 5C0DA 5TE4L 3BMVA 1T1YA 4R7DA 5DVKA 1QQDB 1TVDA 3LZFH 4U6XA 5TF1H 4RNRA 1CE6B 3IJHB 1E4XL 1A7OL 1OM3H 4XNXL 5JW5A 5L8JB 1I8IB 1WTGT 2PYED 3DRQA 3D5OF 4N8VG 4PJDB 1JFQH 4LNRB 1KPUB 3BN9D 5D1XA 1IQWH 3PGCB 1G7LA 3NPSC 1KB9K 2CIIA 4D0DA 1S7RA 4MD0B 4HH8A 4MJIA 3HS0B 4P2OD 4X0KB 3T4AB 1YEJL 3IDIA 5EZOH 5T1MA 1HIML 2D7QA 1IMHC 4XPAH 4MXQC 2JIXD 4DGIL 4NQVA 3X3GL 3BPNB 3I6LE 4LBEB 5FXCH 4OI8A 5SWQA 3QDJB 4QHMB 3P4OB 1NSNH 4O51B 1IJ9A 1T7ZA 4J8RB 3RGVA 3VH8G 3WKMH 5F9AC 4MX7B 1T1YB 2H8PA 2ZUWA 5EZIL 3RWJA 4WUUB 4U6XB 4NJAH 5TFSL 4RNRB 1L7IL 1R5WA 1I1CA 2OQJB 3HI5L 3M17B 5DFVC 3MV7E 3DRQB 1U8NA 3MLZL 1MH5B 2ZJSH 2ZCKL 4OZFB 3IJYA 1CFTA 3HHRB 2QKIB 5D96C 5C08B 3BQUA 1GYAA 1HDMA 1D9KA 3MPCA 2WLZA 1Q9OA 3IDIB 1WZKA 4LRIA 5T1MB 3B5GA 4GKZB 2B8OT 4OCYH 4KI5E 4JPVH 4X5XB 2VUOA 3BO8A 4MD4A 5JA9A 4NQVB 3BDBA 3PHQA 3DUUB 2FD6L 4KKBC 4ONHA 1S7QA 5C2BH 1CK0H 3CFKB 3U4BH 2OJZL 3VFUA 5B38G 4ZO7A 3V0AC 3THMH 1FL5B 5JZ7D 4KKLD 4W4OA 1DZBA 2JKXA 4PRHA 2H8PB 3RDTA 4HIEA 3MUY1 4BH7A 1MJUH 4GG8B 1ZLWH 1OAQH 3QG7L 3C6LD 3K4AA 3IDGA 2EDWA 4PJEE 3VGDA 3W81A 1QFWL 2ZCHH 4WO4C 4O4YL 5C9JA 5D7LD 5IJVA 5I2IA 1LK2B 2Z35A 3VXOB 1QFUL 1CFTB 4ALAH 3IVKA 4KAQH 1A4JA 3BQUB 3P4MA 3VFOB 1BBDH 4OF6A 1YNLL 1X5AA 2X09A 2VSDA 3HE7A 2O5ZH 3MGTA 4J7RA 3VCLB 5DD0L 4HUNB 3BO8B 4WTZG 4KVCL 1FCCA 4ONHB 3BGFC 1PKQB 5IB4B 2VXSH 3DHJA 3OKDB 1U36A 2V17L 3VFUB 5IGXH 1IC7H 1NC2B 4GBXC 3LRSA 1MAMH 5KAQF 1Q9KB 4YPJA 4BQCA 3CMOH 2PR4L 2VN7A 4M7LT 5D70H 4YFDB 1I7ZA 3NCJL 2HYMA 5DK0B 2CDGA 4M6OL 4HDIA 3LEXA 4LAQH 1T89A 3GRWA 1RY7B 2YPLB 5E8OA 4M6MH 4WTXA 1I85C 5C9JB 4LVNB 1UXWA 1OVZA 2J8UF 2FX7L 2Z35B 4CJ0A 4IS6A 1MHHB 5E8EB 3EYSH 4G8GD 5ACZA 5M94B 3GMRB 2HKFL 5IEHA 1QRND 2CK2A 3HE7B 3MGTB 1H8NA 4OZIB 4GRWE 1RZ7L 5ESQA 2F53A 4S2SB 3QJFB 4K3JL 1T3FB 2DLHA 3IF1A 4XXDA 3MLVH 2AERT 2ARJB 1HI6B 3VXRE 3LRSB 5H94A 1I75A 1I7ZB 3P9WB 2DWDB 5EUOA 3NCFB 4LPYA 4JHWL 3GIVA 1GCFA 3REVB 2YKLL 3D85D 4HDIB 4CMMA 4L8CA 3LEXB 3UC0H 3QHFL 1DE4A 1UCBH 2BP3A 3OQ3B 5DDHB 5B21A 4ODWB 4PLNC 4I3RH 2Y7QA 4JFXA 4OLXH 5E8OB 4AL8L 3RU8L 5B4MC 2L0DA 1J12A 2D7TL 1NAML 5DI8A 3LKSA 3IGAA 5I66B 1LD9A 2MPAL 3I84A 5GRXG 1IQDA 4YJZL 5ACZB 2O26U 4M93B 2XA3A 1HHHA 2P42B 4PRAB 4NM8H 3NABH 3TT3L 2NTFA 4QTIL 3QI9C 4KMTL 3CZJA 4PB9L 3QUML 1CXIA 1RK0A 5ESQB 4FFVD 2F53B 4XMLH 4XXDB 2PYEE 1ONQA 4U33A 1J86A 5KBNC 5JOFA 1KENL 1VEPA 3VU2A 1BECA 1GC1L 5EOCL 2R2EA 5BZDB 3TBYA 1WZLA 4XVUC 5GGTA 1FFQA 2W59A 5EUOB 5HDBE 1RZJC 3DBXB 2EDYA 5D1ZB 5LCVH 4IRZL 4MZ3A 2AJSL 1TVHA 3KS0H 4K8RD 2Y7QB 4JFXB 5EZLB 3VFWB 3QJHA 2KL6A 5LAXA 3UTTE 3SEPA 4K8RL 3LKSB 3H3BC 3RJQB 3T0XA 1IQDB 4KGJA 3NACL 4NFCA 4JJ5A 3MODH 1BLNA 1LO0L 2I9LB 4PLJC 2DD8H 25C8L 2ADIA 4BZ1L 5FYKD 4G6MH 2ARWA 5IVOA 1RK0B 4HJ0C 4GG6A 1YJDL 3WHE0 5FYKL 5HHMB 4S1RH 3OKEA 3PABB 1BQLL 1SJEA 2ZOKB 4M00A 1QBAA 3O0RH 3TBYB 1W72H 1TIUA 5EA0L 2WQ8A 1AHWA 2CJUL 1BGXH 5J11B 5IBUB 4UB0H 5SWSD 4F57H 1TVHB 4M93C 4QF1B 2Y6SD 4UTBL 2D4DA 2XXCB 4P99A 1CF8L 4IRJD 4QRTA 5DZNA 3SDCD 3PWJB 3EDFA 5MP6H 3X12A 1RZIA 5INCB 1MCRA 3T4YA 4NZRH 5LGHH 5F9JB 1K8IB 1LP9F 3U9PL 3DRTB 5E6IB 1KG0A 5TF1L 2VDLH 2WINA 2ADIB 1VACB 1MI5D 3G6DH 3B9KD 4NHUA 3VFTA 4XCEA 3QCTH 1ED3A 5JW3H 1YQ2A 2IBGA 1JFQL 3FFCD 5D1ZC 1FO0H 1IQWL 2EDTA 4HGWA 5CBEA 3OXRA 3V0VA 3DURA 3TCXA 4OCLC 4M7JH 5EZOL 5IVZA 4XPAL 1EHXA 5IHZA 4PJ7A 1UKQA 2BK8A 2DYPA 5CJOH 4Y4FA 5I74B 3U0PA 4HIHA 1NSNL 5DWUH 1R24A 2VDQH 3HLAB 5CZKA 4JGUA 3WKML 4N5ED 2QQNH 3ET9F 3X12B 1RZIB 5IW1B 4AEHL 4YHKH 3GJFB 2X4QA 1RJLB 3DPBA 4NJAL 2WINB 2X9YA 5IUSA 1WZMA 5IB3B 1EV2E 4HF5H 3VFTB 2PXYD 4XCEB 2XXMB 3BISA 2VXVH 4MDJA 3EJYC 2BJMH 4QRRA 3GB7A 2AGJH 4LLQB 2P5EB 2ZJSL 3FO2A 4LIQE 1EEYB 4G8GE 5HI4C 3DURB 4PRPD 1T80A 5A2IH 1Q0YH 4OCYL 1OTUC 1QRNE 4L3EA 1ES0A 4DK3A 5IHZB 3QCUL 4PJFF 3FCTA 3QWQB 2DYPB 2QSQA 3DNKA 5C2BL 1CK0L 3U4BL 4YHMH 2OSLB 3V8OA 1BQUA 3O4LE 2ZSWA 3BPCA 4JLRA 3U0PB 3RJDA 2NW3A 3THML 5E6IC 1R24B 4UIMA 2DS4A 4OCRH 5IQ9A 1J9CT 1KACB 4UAOB 5AAWA 3RWGB 1GAFH 1DSFH 1MJUL 3NIFE 1FJ1B 2EZ0C 1OAQL 3FO1B 4TNWF 4Y5XC 1EK3A 1QLFB 3TA3C 4MD5B 2OI9B 3B2VH 2ZCHL 2YD9A 1N8ZB 1HKFA 1KCKA 4FQPA 2A83B 4QRRB 3QIUC 1PKOA 3FO2B 3REWA 1U8QB 4QT5A 3FOMA 4KAQL 4J3SA 1BBDL 2A6IA 4U1IB 5E9DB 5I74C 5CSBA 4Y16D 1ND0B 3FQUA 3UMTA 3HZVB 2O5ZL 5FGBC 1BZ7B 4L3EB 3T0AA 1ES0B 2YRPA 2Z4QB 5EPMA 1U3ZA 3FCTB 4JO3H 4NFDA 3BJLA 2VXSL 4IOIB 1C1EH 2ZCLH 4O5LH 5CGYD 5IHLB 1ZA3B 1IC7L 3BPCB 4JLRB 3VGBA 1MAML 2NW3B 3CMOL 4MQXD 4DUXA 3KLHD 1HSBA 5D70L 5IQ9B 3QUYD 5HHOD 4HH9B 2YHGA 1XF1A 2WBJA 4AJ0A 1EZVY 4UV7L 4LAQL 5ID0A 4DKEH 4IOSD 5MERA 5ANME 1KIQB 4M6ML 3WXVH 3G5VB 1NMAH 5JUEH 1RHFA 3A6CH 1YA5A 2VLRA 4H1LG 1K2DB 2UZXB 2PCPB 3QXVA 4P5KA 3REWB 4MA3A 3FOMB 3EYSL 2BCKB 2ZUVA 1F6FB 1T66C 3ZDZE 4I2XA 1C08B 1VADB 2VH5H 4QCIB 1ROWA 1JBJA 5SV4A 5FYKE 5GGSY 3U4EB 2E6PA 3G5YB 5JNYB 5K59E 3MLVL 2GSGA 5ID1A 3Q5TA 3D3VB 4N0CC 4FQJL 2VC2H 2AK4B 2AJYH 4LPCA 1NCDH 1REIA 3NFNB 4A6YA 3UC0L 5IQ7H 2ATPB 3O3UN 2PKDA 3NGBB 1YNTA 5ID0B 2BOBB 5SWSE 4WWKD 1JHLH 3V5HB 4I3RL 1T22A 3GM8A 4OZGE 5MERB 3L6FA 1JTOA 4Z7VE 2R56H 4U7MA 4P5KB 1J7VR 2V9QA 3FTGB 1KCLA 4MSWA 4KK6C 1F8TH 3CUPA 2HFEA 3ZT5A 3MXVH 5IG7A 1JYNA 4NM8L 3NABL 3IAQA 1IC4H 1CWVA 2RR3A 5F7MC 4Y2DA 1MI5E 2D9CA 2GKIA 1MLBA 2Z92A 4XMLL 2IANB 4JO4L 4F8QA 2GSGB 4WVRA 4G43B 3DV4B 3DARA 5IK3A 4JY4B 4PJHF 4KHTH 1N0XL 2MMXA 1GHFL 1KIPA 3BEWA 1QVOA 1M7DA 3N50A 3GSUB 5E4EC 5LCVL 1DQDH 4QRUB 1XF4B 5FM4A 5I1AB 1YNTB 5KG9B 2HTKC 3PDOB 4JCLA 1T22B 1S78C 1MFBH 3FB7A 3KPMA 5F1IA 1K9TA 1GH7A 2EDBA 3PE9A 2VNCA 3G6JF 5EU6D 2X1PA 3SCMA 5D1QA 3VWKA 4PPTA 2HFEB 3MODL 1NBZA 4DGYL 3BZEA 4TNWK 4UZGA 2DD8L 5C0JB 4Z77B 1RZGB 2SEBA 4K9EC 2NY3B 3IB4A 2HMIC 4PJGA 2O61B 5L88L 1FNFA 1MLBB 4YGVB 1T03H 1J0JA 2Z92B 3HMXA 2RJMA 5GIRA 4S1RL 2HT4D 1C12A 4LQFH 4P49A 4BSWB 2HWZH 3GSVA 1PVHA 1LDPH 5IK3B 3G08B 4DTGH 4XI5D 3O0RL 3OV6A 1W72L 1FG9C 1KIPB 2N1KA 1FSKB 2PO6A 1ZT7A 4U6VH 1M7DB 1BGXL 2VDPH 1G7JA 4HKJA 4Y5YA 4MJ6A 2JB5H 4HKBA 1BPVA 1KYOJ 3F58H 4F57L 3RVTC 3KPMB 5F1IB 5CINH 1JWMA 1P6FA 4ZFZA 1VFAB 3MLXH 3HZKA 4ONGL 5CD5D 1HQRA 2LAGB 4ORGA 1JWSA 4JO1H 5MP6L 4IOFC 3BP5B 4MNGB 2AEWA 5LGJA 2UZIH 3E8UL 4EVNA 5EUKB 1NBZB 2DICA 2VDLL 4MAUH 4JM2C 2EE3A 3TJHC 2Y06H 2CKBH 3WNOA 2SEBB 2W0KA 3G6DL 4PJGB 4TPRH 3QCTL 4PG9A 4ZQKA 5ICZA 1ZSDA 2V9RA 4JE4B 1OAXH 3EYUH 4N8CH 1C12B 3GSVB 3FHAA 1FO0L 4ZYKA 1ZS8A 4OCSH 4WU5B 5GGRA 3IDXH 5F7NC 2PO6B 4M7JL 1ZT7B 4ISVB 5BZWA 1G7JB 2OS7A 2JJSC 4XXCC 1JZ4A 4MJ6B 1E6JH 2Y5EA 2ILLA 4HKBB 2OYPA 4MNQD 2E8ZA 4JGMA 5AEAA 3D6GA 1UWGH 3G5ZB 3ZKXB 1R5VA 1DBJL 5E56A 1JWMB 3DROA 3PJSA 5DWUL 1F5WA 1TZIA 1JUFA 2VDQL 2CXGA 3L3GA 2KPNA 3PDDA 3TWCH 4LLVA 2QTEA 4AM0A 5ACLA 5LGJB 2X42A 4YHKL 1OP3H 4ZSOA 2P43B 1F00I 4JZNB 1U58A 3WDJA 1CTOA 3F7PC 2NY4D 4HF5L 1ZSDB 2IADA 2VXVL 2BJML 3KPSA 2AGJL 4X9HA 1KB5H 2OR9H 2P45B 3OAYH 1QHOA 1DTUA 5GGRB 1DANT 2EC8A 3RX5A 3SGJA 4OLUH 1MCFA 2CLVA 1WBYB 3F5WB 4FZEH 2NCMA 3GMMB 1EEZA 1EXUA 1Q0YL 1XGQA 3VFVA 1LEGA 1PGRB 3ZT6A 1DUZA 1NGWA 2XWJA 4HWBL 5F3BA 1NGXA 4YHML 2NMSA 3VXQA 2DQHH 3ARED 3DROB 3HE6D 1VPOH 2R1XB 3PJSB 4DCQA 4OCRL 4LLVB 1GGIH 5KSAB 4N0FA 5CGTA 2OMNA 1CL7H 1JMZA 1DSFL 3ARSA 4ZSOB 4PGCA 1U58B 2EE9A 3K4DA 3G04B 2UYLA 1Z2KA 4KQ4H 5E08H 3BIAX 3CDYA 5DJZB 1K4CB 5LVEA 2IADB 3FZUD 3LV3A 3T3PE 4GQ9H 3KPSB 1KLGB 5F72S 4K7PY 4XC3H 5D2LE 2H3NA 2NW2A 3U36A 4L4VA 3FFDB 2H6PA 2DQCH 1EXUB 1EH9A 3DGCR 3VFVB 1HXYA 4M6AA 1NGWB 2XWJB 5B39A 2J8UE 3FQNA 4LMQI 4C57C 5F3BB 2ZCLL 3LEYH 4OF0A 4O5LL 3QFJE 3PWPA 1OCWH 2JELL 1JZ2A 4MXVF 3D0LB 5EIVA 1OP3K 1XR8A 1FYTB 1G0YR 1R3LA 4N0FB 3UBXA 3HRPA 2VLME 3LKRA 1FC2D 5ITFB 3EW3B 3X11B 1WAAE 5HDQH 4DKEL 3UTQA 1LO4H 4XCYA 2DJSA 1CFBA 1NMAL 3MCG1 4M9PA 5JUEL 4U3XA 5C0AA 4NKOA 3A6CL 2X89D 3OAYK 3K1DA 4PJ8A 2H3NB 3QH3B 2V5YA 3QDHA 4L4VB 3U36B 4M7LH 1KSRA 3LS4H 5HYJA 2VH5L 1JPST 1WT5C 2EXYD 2VLJD 4X98A 2XZZA 4Q9BA 2R4RH 5D7JA 5KSAC 1QBML 2BSSA 3PWPB 1IAOA 4Y19D 5EG6C 1AGBA 3LB6D 2EDRA 3HUJA 4GUPA 5L9DH 4HUXA 2AJYL 4GKSB 3I3BA 1NCDL 5CAYB 1DQJA 3ME0A 5IQ7L 1R3HA 1JHLL 4ZUVB 3UTQB 4XCYB 4OFYA 4J3VA 4JREB 4NKOB 3BP4A 3MJ8A 4YEEA 3RY5A 2R56L 5CIPB 4OLEA 4XCCH 1I1RA 5ETUA 4OKVB 2JK5A 4PJ8B 3QDGD 1F8TL 3F12A 3MXVL 1BOGB 4MS8C 1IC4L 2Q8AL 5HYJB 1UJTA 4BFEA 3GMPB 3BX7C 4X98B 2GJZA 4PS4H 1MCDA 1WFNA 3EYVA 5JPNA 4JFED 1FL6A 1V7MH 2O5XH 5D7JB 3T77B 1CL7I 1OTSD 1B90A 1E6OH 1DBAH 4P0DA 3TIEB 4KHTL 3HUJB 2AJZA 2F54D 4I1NB 2ZG2A 4X80H 4HUXB 2ESVA 3MV9D 3BEVB 3S5LG 5K9JH 4PLOB 1DFBH 1P4LA 2M1KA 4CN1A 1DQDL 1DQJB 4H8WC 4BH8A 1G9NH 3HNVH 5BS0E 3LQZB 3W0WA 4MNQE 1R3HB 4NUGH 1MFBL 2EO9A 2VAAB 3BP4B 2NY6D 3MJ8B 4YXKH 1INEH 5CSZA 5ETUB 5I76B 5EDXA 4P46B 5FO7A 4PJIA 3TVMA 3MRCA 3C5ZC 4J3OC 1GGYA 4NPYA 2GW5A 1KCVH 2X4UA 4HC1A 5DA0B 4N8VA 1A6PA 1JGVH 2BNQA 3EJJX 3ULVC 1VFUA 5C3TA 4PJDF 1RHHB 1A9EA 3FL7A 2XG5A 1FL6B 2B1AH 3GMQA 4LQFL 5FDWA 1O5DT 4W4NA 3RWFA 4U1MA 1LDPL 5FV1L 2IQ9H 4ETYA 3DIFB 4DTGL 1FP5A 2X5PA 2EKJA 2I5YL 1CDCA 1QNZH 3EO0B 1X9QA 2BHUA 4X4XA 4PGDA 4U6VL 3WIHA 3L3IA 2VDPL 4JREC 4JB9H 4LHUD 3CDCA 3MREA 1X7QA 5J1TC 3F58L 2N7AA 3W0WB 4MWFB 5DO2D 3O11A 3WO4B 5T3XH 2HTLD 3KXFB 3MLXL 3VH8A 4OBRA 1KIRA 1AI1L 3DMMD 1F3DJ 2DMKA 4JO1L 32C2B 3D69A 3BN3B 1A7PH 3TVMB 2UZIL 1FYHB 2BXZA 2R0WH 2X4UB 4HXBL 4P23D 3OMZA 1L0QA 3QSKB 4B41A 2Y06L 2CKBL 3OXSA 4N8VB 1Q1JH 1WZ1H 3QUZC 4KDWA 4TPRL 2BNQB 3NIGF 1OGAA 5CKGA 4LPVA 1OAXL 3SE4A 1A9EB 5JXED 3EYUL 4N8CL 1EGJL 3RWFB 2IAMD 3C09B 4U1MB 4IRSD 1XGYH 3UTZA 1YQVH 4IHOA 2P5WD 3IDXL 4X4XB 1MVUA 2FL5A 1IC5L 3IS1X 3L3IB 2G9HA 2LFGA 3KGRA 5IM7B 4OGZA 5E2UH 1I1FA 5AYQA 5DFTA 1X7QB 5EN2B 4QEGA 3U7WH 5B38A 5IW6A 5KZCD 4P46C 5M7QA 2BNRA 1PX3A 3VH8B 2YPKA 4XTRD 5D5MB 3S34H 5J9PA 2BDNH 3TWCL 3GZKA 4F7TB 2HFGH 3EGSB 4XP6H 3CVIL 5HDOA 1S7VA 2YA2A 1N7MH 3U46A 3MCKA 3GKWH 1IGYA 4QHNB 4OGAD 1X5FA 2Y1VA 3FQWA 4BSVA 3ZE0E 5DUBA 1UFUA 1UZ8A 2LE9A 2ZKHH 2MCG1 4WW2A 1KB5L 5I8EB 2XKSA 1QBLH 2OR9L 3SDXA 1HK6A 5JLZB 3UTZB 1D5BB 3BZFA 1SBBA 4OLUL 4U6TA 5ALCH 4Z6AT 2FL5B 4NO0A 4PP2B 4WTZA 2IQAA 5TDPB 4XGZB 1EEUA 3QP3A 3MNVA 4WFFD 2ENSA 1I1FB 3JUYA 3U0TA 4PYHA 1Y0LA 2XA8H 1MCIA 3DTXB 1ZLVH 3WL9A 2DQHL 1VPOL 2YPKB 1JHKL 1P4IH 4Y19E 4OCXL 4PG2C 5ABDE 3B83A 3T0BA 1TTFA 5MENE 5LWYH 2A77H 2NNAA 4PJ9D 1GGIL 4YFEA 2IFFL 4X6CE 4HFUH 3SGEH 4U1HB 3HKFA 2LTQB 1I1AD 1WLHA 2R8SL 2HJFA 5C0CB 4KQ4L 4BSVB 5E08L 4XNUL 5JW4N 3BKYH 2EDQA 1UZ8B 2GJ6D 4GQ9L 4UU9A 1BIHA 3WEXA 3QPQC 3SDXB 3UZQA 3RWIA 4I18A 1I7UB 4WIQA 2BVQA 3T1FA 3VG9B 3CDFA 4G9FB 4N0YH 3QDGE 4DN3H 4NRYA 4PRDA 3G5XB 3VFGL 4OZIF 3KVQA 1EFQA 2DQCL 1OAYH 3O8XD 3MNVB 4L8SA 4YQXH 1T1WA 5DJ0A 4KZDH 5F93C 4CVXB 5FGRA 5AG8A 1WFUA 3TN0D 2HG5A 4ODSH 4Y88A 3U0TB 4M1CD 1Y0LB 4JFEE 5E8PB 2XNAA 1PY9A 2APFA 3LEYL 5HPMB 4NCC1 3WL9B 4JKPH 1OCWL 3ISWA 3WLWC 4QHUB 2X9XA 3WJJA 4JHZA 5I1HL 2DQJH 3PWLB 3MOBH 2W65A 3QFDA 2VE6B 2NY5C 3MV9E 1KYOK 4CRPA 4QRPD 3I6KB 5JO5B 5BW7A 4NM4H 1MHCA 5FA3A 5JMRA 4EI5D 3QIWC 2HJFB 4YZFE 2K1MA 3CX2A 1QLEH 1LO4L 4PJCE 1UXSA 2C1PA 4P4KA 2X4RB 4V1DE 4YIQA 4UU9B 3O45B 3WEXB 3P77A 1KPRB 3RWIB 1P1ZA 4I18B 2BVQB 3IDJB 5C0GA 2IPTH 4M7LL 3LS4L 5IT2H 4NRYB 1A22B 1QPPA 4TRPH 2MKWA 1NFDE 4KRPB 5KS9A 1BJ1H 5DJ0B 1ZLVK 3V6OE 5C8JA 1UVQA 4XAKE 3VXUD 5FUCC 2R4RL 4L8BA 3O6FD 2XNAB 2D03H 5DMKB 1UM6L 3C8KB 2LTQC 3QDME 1WIUA 3GI8H 4PJXE 4G6JH 3QEQB 3A67H 4KDTC 2P8PA 4Z7OF 3NAAH 4UOW0 4JDVA 3RGHA 1CXLA 2J1KA 1UXSB 4TTDD 4PJBA 3ARDB 4LVEA 4P4KB 2XOTA 5DD6B 1HKLL 3IU4H 4KJQC 4C4KT 3GHEH 4XCCL 3FT3B 3P77B 1P1ZB 3RVVC 5C0GB 4PJAA 1CGXA 1VB9A 4PY7B 2C3WA 3H9SD 3GRWH 4QXWA 3ZDXE 4HS3A 1FG2B 3INUH 1A14H 5CMAA 5KS9B 3NVQA 4PS4L 2NR6D 5C8JB 1UVQB 1DQQA 1V7ML 2R15A 2O5XL 3SGEI 1E6OL 1DBAL 2XQYK 2D7PA 4Z18A 4G6FB 4X80L 5D7SH 5F7HA 1P5VA 3HNSH 3SDYL 5K9JL 1DFBL 1D5IH 2P8PB 3MRPA 4WHTA 1G9NL 4JDVB 3SDAA 2E7BA 2HVJA 3WFDH 3ZE2E 5L0QB 1JPGA 4F2MB 5GISL 2EH7H 4NUGL 5I8KH 4YXLH 4Y0GA 4ZFOA 5DHXB 1AXTH 4G5ZH 4YXKL 1INEL 3H42H 4OF5A 4WENB 4J3UA 5DMIH 1ZA6A 1KCVL 3KLDA 5HY9A 4R6UA 3VGEA 4MXQD 1QR1B 3VJ6B 5H37H 2J88H 3VXMA 1JGVL 4Y1AA 5J6HB 2EDJA 3SQOH 3ZHLA 3V95A 2JCCA 3T8XA 2B1AL 4QTHA 1DQQB 1MRCL 3PXHA 3VI4F 1G1CA 2IQ9L 3DWTA 4WFGD 5JW4R 2MJWA 4N1CA 2Z31A 2EXWD 1QNZL 1FBIH 3P40A 3QNXB 3ARDC 2YC1B 2W9EL 1ZT4B 4R2GC 4X7CC 4JB9L 4XCNB 3U6RA 4WFFE 3SGDH 3MRPB 4UDTA 4HBQA 4WHTB 2QADB 5T3XD 5FFLA 1U3HA 4N5UA 2R0ZH 3OF6A 4ORZC 3RUGF 5DFVD 1DVFD 4G8EA 4OZ4A 3GUTA 1H15A 1XR9A 4O2EA 3ALXA 5GGTH 4LVHC 3FB8A 1OTTD 5IB5B 5CEXA 4PTUB 5T5FH 5E8DH 4TUOA 4W81A 4JRWA 2R0WL 4N90E 4YE4L 5IMOA 3CK0L 2OJEA 1B4RA 3V79C 3VXMB 4Y1AB 3UZEA 3DX9B 3TZVA 2JCCB 5FO9A 3T8XB 4QTHB 4CVZB 2GJ6E 3MZGB 1XGYL 1OF2A 4HQQH 1VDGA 4UT6H 1WIPA 1YQVL 5L0QC 5BOPA 3ULVE 1PQZA 3MYJA 4UDTB 5E2UL 4O00A 3QEUA 3AS0A 5A2JH 4HKXB 5AD0A 5DEGA 4BM7A 1R6VA 2JB6B 4G8EB 3D1MC 4OZ4B 3S34L 2B5IB 1UM5H 2BDNL 1M71B 4JQXC 5IWLA 2BMKB 2HFGL 1AO7D 4OAWA 4XP6L 3MRHA 4D9QE 4DFHA 3KNBA 3TO4A 5LXGH 1N7ML 5FAAA 4CNIA 1V7NL 3HZYB 3QDJD 4ONOA 3SKMA 3I9GH 3AROA 4CU8A 3GKWL 5IMOB 5E24E 4J3XA 4IMLB 2OJEB 4LNVA 4L4JA 1G0XA 1LEIB 2ZKHL 5C07E 1F4YH 3MUGB 4OGXH 1QBLL 4GXVH 1OF2B 2CRYA 4F7MB 4O2CB 4R4NC 4YDKL 5C1MB 3V5DB 5HHPB 3MYJB 5EBMB 3CFCH 5T1DH 3VGAC 5D1XD 4FFZH 2X4NA 5ADPL 3QEUB 4JM4H 3TBWA 3ULUF 3VXUE 4NN5B 2XA8L 4MJID 4OLVH 4YHIA 5IBLD 3DVGA 3SDDB 3ROOA 2CR3A 1OW0A 1P4IL 2OTPA 1F4AA 1XT5A 5F6IC 4APQC 4HS6A 3S35X 5LWYL 2A77L 3HFMH 4OAWB 3EHBD 1J1OL 4FXGA 2DM3A 1XF5B 2HJLA 3KNBB 4GRLC 1Q38A 1RV6X 4HFUL 2V6HA 3SKMB 3QWOB 3N85H 5IVNA 2A74A 3RGVD 4Y4KA 4YDJA 1MNUH 3PP3K 5CJBA 4H1LA 5DD1H 2FJGA 2ATKA 1U8KB 4F15B 4Y2OA 4N0YL 4NCDA 1X5YA 4DN3L 4JFYA 1X3DA 1OAYL 3QZWA 1N26A 2B5IC 2Q3AA 3IDNB 4YQXL 2ADGA 4KZDL 4U1NA 1RZKC 2AQ2A 3TBWB 3BQUD 1JK8B 1D9KD 3OTTA 4JFDE 3VWJB 5D7KE 3VFNB 5HI3C 4JKPL 3U1SH 3PL6A 2DQJL 3CPLB 3MOBL 5H35B 5F96H 2MFNA 2GCYA 4F9PC 4FXGB 3RZCA 2EDEA 4RISH 4FQ1H 1PY4A 2P24B 4NM4L 5HGDA 4CMHC 4S1DD 1YN7B 2CSPA 3WFHB 2A74B 5FGCE 3CIQA 4YDJB 3V4PH 3ULUH 5CUSH 43CAB 1FNEB 4H1LB 4FABH 4PRHD 1TPXB 3RDTD 2ATKB 5TGBA 4KRLB 2NY0C 4BUHA 1FVDA 2QQLL 5EU3A 2IPTL 2C9AA 2XTJB 2PW1A 4NN5C 3FMGH 2DI7A 1MCPH 5IT2L 3SDDC 1MCQA 1LE9B 3QZWB 1DLHA 4TRPL 4OFPA 4XRCA 3OR6B 2CO7B 4TNVF 2CGRH 2B0SH 1DBKH 2UWEA 1AJ7L 4U1NB 4QRSA 1KLUB 1IGCH 5IKCA 2D03L 1IGMH 4DKFH 3GHBL 4IIQA 1KTKE 3WHXA 2IWGA 3HE7D 3GI8L 3PL6B 4WFGE 1SJHA 4G6JL 1A1NA 4OD3H 3A67L 2GCYB 2IGFH 3MRBA 1U6AH 4NO5B 3RZCB 1H8OA 3NAAL 1RIVH 4JDTH 2K3TA 3PUCA 4F15C 5T3XE 3VRLE 2DDQH 4HJ0D 1JPSH 4XPGH 4NSKA 1HH9A 5T3ZH 4KPHH 3IU4L 3QBTB 1XF3B 5TGBB 4Z78B 1SY6A 4GO6B 2V5TA 2VZSA 1NUFA 4HIJA 2VLLA 3OKLA 4LSQH 3VWJC 3G9VA 4NWTH 4HFWB 1I3GH 3GRWL 5FUOH 1L4IA 4XRCB 1I3UA 4AQ1B 3INUL 1A14L 2WMPA 4OQTA 2FATH 5F9WB 1A3LH 4C56A 1Z6JT 4G6AC 4XX1E 2XPGB 1YEFH 3L9RB 2PF6A 5A3IC 5IKCB 3L3HA 3DX8B 1S7UA 1CDJA 4IIQB 3WHXB 1XEDA 5C6PB 3SKUD 2ICWA 3BJ91 2B39A 1SJHB 5D7SL 1A1NB 1DR9A 3TYGH 3NCBB 4LRNH 5FUCE 1GVIA 2F53D 3NFSL 4Z7QF 1GIGH 1UT9A 1T0PB 1D5IL 1TPXC 2I24N 2H1PH 1GZQA 1HWHB 1SMOA 3KYAA 3E6FA 3GDBA 3LPFA 3DVIA 2EH7L 4JVPA 4K71C 4J1UA 3E6HB 4TSBH 5I8KL 3QUMA 1RFDH 2AP2A 3RVUC 1AXTL 4G5ZL 4K7PX 1VCAA 3ARTA 3T08A 3DI2B 2NXYB 3FT4A 3H42L 3HRZB 5DMIL 1AO7E 3Q0HA 5DJYA 3EYFB 4HUVA 2VLLB 1UJ3A 4KK8C 3CSBA 4PJGF 5FK9B 5GHWH 4JPKL 1DEDA 4Y4HA 2J88L 4Q6IC 2C4XA 1XGTA 4KWUA 3WKNA 4C56B 1CIUA 3UYRH 3UX9B 3SY0A 3PGDB 1S7UB 2GITA 1N6VA 2VL5B 1KCRH 3B3IB 4R4FH 2ICWB 3MA9L 1TJHH 1FBIL 3EDKA 4Y8AA 1CD1B 5I15H 2GT9A 4P9HC 1TVBA 1Q9WB 2V2WA 5EOTA 3ORJA 3SPVB 3E6FB 4J1UB 4MJIE 3VD5A 5JOEA 2X10A 4CW1B 1BJMA 1JF6A 1F3JA 2Z8RA 1NBVH 5GGTL 3FT4B 1ZHNB 5T5FL 3QEHB 1CDUA 2AKRA 3HAEG 4HZAA 1T7YA 5DJYB 3BPLB 5E8DL 5J8OA 3MRMB 4HUVB 3HI6H 1RUMH 3B9EA 4FQHA 3EZ8A 4Y4HB 3PWNA 1XGTB 2HLAA 1W8OA 3S36X 1XF2B 2L4OA 1J18A 4I77H 2ZG3A 4FQQA 1U8HA 2VKWA 2J12B 5CEYA 1BVKA 4UT6L 1FFOA 2VLKB 3QIBB 3MLYH 2KQMA 1U95A 4TNVK 3BFOA 4OV5B 3NOIA 4AIOA 2GT9B 5J1SC 4XAWH 2OTWA 2EZ0D 2V2WB 2M2DA 3HMXH 4XWOC 2NXYC 2XZAH 5B3NA 1V05A 5D7IA 2G2RA 4ZTPH 3W9DA 3ZZ1A 1IEHA 4X5LA 5SWZB 2NYYC 4QOKE 1CFVH 1NEZB 1UM5L 4HCRA 3Q5OA 1F3JB 4WNQA 3BMWA 3TIDA 3OWEA 5C0BA 4XC1H 4E42B 5LXGL 2AKRB 5DSCA 5J7CC 1H5BB 1JZ3A 3I9GL 1TZHA 4O2FA 1DN0B 3EOBA 5GS1A 5GGQH 1IAKA 2V5SA 3CCHA 3C8DA 2HLAB 4M43L 4PRHE 1F4YL 4OGXL 4P48A 2ICCA 3FT2A 4FQQB 1KUMA 6CGTA 5C92A 4JCMA 4GXVL 5E2JA 2FEDD 5KJRH 1PLGH 5CEYB 1BVKB 1FFOB 5IVXA 1HYSD 3CU7A 4Y7MA 1U95B 4FG6C 3BPOC 4OIBA 4PUBH 4XNYH 4X83A 3CFCL 1B4JH 3CXHJ 3ZMRA 2FDBP 3UTPD 2EEBA 2FX8H 4XMPH 1SYVA 1YY8A 5D7IB 5K33A 4H25A 2Z91A 3W9DB 2XFXB 3BPLC 4JG0H 4KH2A 4X6BA 1FFRA 5DEFA 1U2CA 1M05B 3HFML 5ISZE 1ZAGA 1FZJA 1YPZE 2V7HA 3L3KB 4ZUUA 5C0BB 2DYPD 1T66D 3UCRA 3HPLA 2BVEA 4MXWH 1YNKL 3N85L 5BVJB 5F7YC 5GS1B 1HHGB 1IAKB 1FAKT 1MNUL 1GPOH 4YWGH 3UDWC 1N64H 3QIBC 5DD1L 4LKXA 4YFLI 4U1SA 2BX5A 3FT2B 4P5TC 3CGTA 3GJEB 3WCYA 4KUCF 4HWEH 5IP4A 3GBLA 3UYPA 2BVTA 1LGVA 1QSVA 1G7QB 4QRRD 4RMSA 1MLCB 1TCRA 1SYVB 1YY8B 3IFLH 4JZJB 3IFPB 3CDGA 1UCTA 1H5BC 4OCNC 4Y5VA 3U1SL 1F97A 1PAMA 5K9OB 1AQDB 4X6BB 5DEFB 4L3ED 3ARGA 5F96L 4S0TD 1ODAA 2F53E 4FQ1L 3DXAB 1MCWM 3ULUD 3GSWA 5I30H 1DBBH 3MBEA 2JJWA 3ULUL 2FZ3B 3LN4A 4NO3A 2DQFB 5F89B 4FABL 4H20L 4ELMB 4YAQA 5EUOE 4ZOBA 4EQ2A 1OL0A 2Q3ZA 4YDIH 5HBBA 2FRGP 4KRMB 4OZFG 3FMGL 4BSJA 1MCPL 3BAEH 1BZ9A 4RWHA 2H2PC 1RUKH 3ESVF 2X4OA 2CGRL 2B0SL 1NUNB 4P2QA 1MPAH 2WWKO 4HPOH 1QHPA 3CDGB 4ZUSB 3P0YH 3VFPA 3HUJF 3KYKH 5LJYH 1XGPA 3S5LA 4OD3L 4J2XA 1JE6A 3ARGB 2IGFL 1U6AL 4R97B 4WHCA 1HZHL 2NX5A 1RIVL 3WDIA 3GSWB 2DMBA 4JDTL 4L3CA 1YUHA 2NXZB 2GK2A 5T3ZD 2DDQL 2DBLH 1JPSL 1RK1A 4XPGL 2B1HH 3LN4B 4NO3B 5D93B 1A1OA 1Z0MA 5T3ZL 4KPHL 4M03A 2E7MA 2WBJD 4P3CH 4OF7A 2PUQT 2DQDH 3AS3A 1LE5A 3BWUC 1WBZA 2R0KH 4FFWC 4JZJC 4NWTL 5FUOL 1ZLSH 1ZMYA 5DGQA 2VLRD 3KYMA 3PHOB 2X4OB 1BF2A 2FATL 1A3LL 3A6OA 5IFHH 4LP5A 1K8DA 4HLJA 1K4DB 1NCWH 3VMPA 4WWKA 5KN5B 4NRXA 2G60H 3ULSB 1J1PH 3S5LB 3TYGL 4LRNL 4ZFFA 4J6RH 1OHQA 1G7HB 1BP3B 1GIGL 4GG6E 3O3AA 2NX5B 3SHSA 3UZVB 3ELAT 3OAZH 4KUZH 5E2VH 4KKNA 2CUMA 3RWCA 1XGRB 4TSBL 1RK1B 1RFDL 3S37H 4X7SH 4UBDC 1A1MA 3S3SA 5KSBB 4G3YH 1Q72L 4JHAH 5F7LB 4DVRH 1N5YH 2JTDA 5KSVA 1RSFA 4P59H 4JQVA 1LE5B 5DRZA 1CXHA 2ZOLA 1V3MA 4HS8H 4U1LB 5GHWL 1OGTA 3KPQB 5GGUB 3KYMB 5JOPD 4LGSB 4U6HA 4N9OB 3BIBX 3UYRL 3CU1A 4GSDH 4JQIH 3VFSB 1KJVB 3M1BA 3JWDH 1YMME 4J12A 5CJQH 3ALPA 1KCRL 4R4FL 3KR3H 2NY3D 3LMJH 1KPVA 1TJHL 4Y2DD 2P7TA 3BXNA 3WS6C 5CD3B 1SJVA 3C5JB 1AD0A 4MB5A 5D93C 5I15L 4ZS6C 3GSRB 4PJ5A 1QO3B 4LLUA 2D0GA 5CBAA 3VRJB 4NQDA 3D18A 3RWCB 5D5MF 1HN1A 3SKNB 1AC0A 1A1MB 2AQ1A 5DJ2B 5F70A 1R5IB 4Z9KB 4Q9CA 5KSVB 1JF1A 5DK2B 4JHBA 4PJ7E 3L5WB 2ZOLB 5TF0A 3HI6L 2OL3B 4P2RA 3SCMD 5D1QD 4U6HB 5CJXC 4YR6A 4K7FA 1YYMH 4EDWL 5I16A 4N0UA 4LAJH 5CHNA 3VE0A 2X6MA 4ZXBC 1OARL 4HC1H 3BXNB 3MLYL 3IT8D 2R2BB 2BERA 1WUNT 3OAZK 5DLMH 4EN3C 5I71B 2CR6A 4PJ5B 3I02B 3HMXL 1S7XA 2IPUK 5CBAB 2XZAL 4NQDB 3SQBA 3UBXI 4XB8A 2A6DA 3S36H 4ZTPL 4OV6F 2PO6D 1T1XA 5H37G 1CFVL 3WXWH 4EKXA 2Y23A 1E28A 5HSFA 4QHKI 3RNKA 4RGND 1ZEAL 4JRYA 3WIHH 4AY0A 4GMTH 1F4WH 4XC1L 4JG1H 2RFXA 4NQCB 3NPZB 1ZOXA 3CFBB 1N3NA 3HN3A 5GGQL 2W60B 1WWBX 3CSGA 5E8NA 3HC0A 1CT8A 4P2RB 1HOCB 4EQ3A 3DSFH 3SGKA 1NAKH 1J8HE 2DWEB 2F5AH 5EORH 5I16B 2OMBA 4GAJH 5KJRL 5CHNB 5HD8D 2E5EA 1K3IA 5BRZB 5SX4H 2PETA 3UTSB 3GO1H 4PUBL 1FNSL 1J8KA 3FOLA 1B6DA 3W11D 4MB4A 2Q86B 2FX8L 1ZHBB 1FHGA 1CLCA 1GGUA 3OKNA 4U49A 2A6DB 3TJEH 3JV0A 2QQQA 1KF9B 1WWCA 1FN4B 4G7YH 4BQ8A 3B2UD 2CLZA 2FEEL 1JGLH 1DUYA 1E4KA 1MFNA 1LP9A 5JQ6H 1N3NB 5J3HD 5J0BA 2CK0H 3HC0B 4YWGL 3T0EB 5T1KB 1N64L 1H9VA 2GYSA 4LPUA 5KSAD 4HWBA 3O9WA 5TJWK 4DW2H 3W82A 4FTVB 1I8LA 4HWEL 4M61A 3VFMA 1A47A 2QHLA 2YK1L 4JN1L 1QFHA 5IJKA 3KPSD 3FOLB 1KEGH 2VLRE 3D39A 3K8LA 4U1KA 5EWIH 15C8H 5I1GH 4ZAKB 3AXLB 2DRUA 5DVOA 4I2XE 3L5XL 1CI5A 4Z7UB 3IFOB 1DUYB 3D25B 4MDIA 3EDEA 1FZMA 4DJMA 3QUXB 3ARFA 5I30L 1DBBL 3U82B 4HIXH 3HI1A 1G7PA 2D0HA 4WI5A 3K8KA 5HHXH 4WI2A 1UACH 4QRQB 3VGGA 2VXQL 3O9WB 1NLDH 3V0WH 4KRNA 4YDIL 5DJXA 3P4NA 5GJSH 1A3RH 3VFMB 2Y4SA 4JFFE 2XV6B 1WC7A 5HVFB 5IV2A 1D5ZA 3KPNB 4NYLA 2V7NA 1NCCH 1RUKL 5F6HJ 3D39B 4LSRH 2C3GA 1MPAL 3HA0A 1NMCB 4NT6B 4HPOL 4L4VD 1T83C 4G9DA 2NPLX 1A6TA 4OZHB 3P0YL 5C0ND 4YXHH 3PV7A 1XH3A 5DHVA 4F9LA 1CQKA 3NCCB 1ZHKA 3T0EC 3HG1A 3WS3B 2XACC 1G6RA 5JHDA 5FKAB 1OAUH 2IMNA 3BW9B 1CDYA 3ARFB 3PWPD 3WNMA 1XIWB 3HI1B 1G7PB 5E70A 2DBLL 3WUZA 2B1HL 4U3CA 5SX4I 2VLJA 3QHZH 3CLEH 2W0LA 4RX4A 5DJXB 4P3CL 3MQIA 4FQCH 5E5MB 3WN5B 2R9HD 4NRZB 3RZWA 2R0KL 3HR6A 3MLUH 4P57A 1WC7B 1EUTA 5CZVL 4JDZA 4ZAKC 5C0AD 1D5ZB 3VXPB 4G80A 4ODUA 1CXKA 1YDPB 4LF3B 3V52H 3HNTH 5L2KB 5B22A 3QQ4A 4PJ8D 1CFQA 3JWOH 4H5SB 3KPTA 3O81A 5IFHL 3QUXC 3BE1H 3OSKA 1NCWL 3U30C 2ICWJ 1FNLA 4KTDH 3TO2A 2D4FA 5HYJD 2G60L 1W0WA 5IMKA 1J1PL 2MNUA 4J6RL 3HG1B 1O7SA 2YN5A 4OM1H 5DUPH 1G6RB 5EC2A 5GRVK 2PW2B 2IALB 3MV8B 3QPXH 5D7JD 2RGSA 4KUZL 4RCAA 3VG0H 2VABA 3HMWL 1A6VH 3S37L 4LKCB 1OLLA 2RB8A 2VZVA 4X5WB 3SKOA 4X7SL 4XP1H 2YN3A 4JHAL 4DVRL 1N5YL 2W92A 2X4PB 4RGNE 4P59L 3PQYA 1UADC 1WSST 4OFYD 1RMFH 4FNLL 4P57B 3H0TA 1G9MC 1IBGH 4IMKA 4HS8L 5CWSA 2VKXA 1H8SA 2H26A 4G80B 4ODUB 5F3HB 5GZNC 2JCCF 1NL0H 4HGKC 4ENEC 4GSDL 4JQIL 2AABH 2AJ3A 5T5NF 1H3GA 4M5ZH 4C54A 4KXZH 5CJQL 5D9SB 3DX6A 1AP2A 3KR3L 1XIWC 3LMJL 2IBZX 2DLFH 3HZMB 4PD4J 4NZDA 3LKNA 4GJTB 2VR4A 4E5XA 4HWZA 4D3CL 5DQDH 1X5ZA 1FIEA 4Z5RB 1IFHH 3WN5C 2ZZUT 2GHWB 4F7EA 3GMNB 2ESVD 5F1SA 4HG4J 1JGUL 1EHLL 1OP5H 4XBGB 3T3ME 2DQGH 2FHBA 1BJ8A 4RMVA 2PTTA 3QG6B 1A3QA 3W0WD 3TGXA 3PQYB 5ICYA 2X41A 1XCTB 2M26A 5HVHC 3H0TB 2I25N 4IEFB 5CWSB 3QQNA 3CVHA 2ITDA 1F45A 1C5DB 2H26B 3BUYB 3J7HA 4J4PC 4JFHE 4ZFGL 3TVMD 1YYML 4YPGA 2ERJB 3BH9A 1ORQA 1WITA 2P8MB 3TCLB 3X13B 4GW4A 4RDQF 4HC1L 4PJHA 2D31A 1OSPH 3JTTA 2BNQD 2LU7A 5DLML 2OCFD 1RJZA 4LCWE 1T1ZA 1QSFA 1IKNA 2ZSVA 2CKBA 4PGBB 3S36L 1QLRB 3VXNA 4P23A 3EOAB 5KOVC 5IIEA 3WXWL 3FRUA 1EGJA 1FFNB 3G6JA 4CVWA 1F4WL 2PTTB 4JG1L 1MFDH 5ICYB 3ZYOA 3C08H 4P5MA 5DD3H 1CD9B 2ITDB 3CVHB 3MRKB 4NKIH 3EFFA 3V4UH 1Z5LB 3DVFA 4PJEB 2ZP0T 5JQHC 4ZO8A 5HYFA 2VB5A 1NAKL 2R29H 1Z9SA 2Y07H 3KYNA 3OHXA 2WZPD 3SJVA 2AS5M 4WFED 1ORQB 5BV7B 3TT1H 1WBXB 2ORBL 3TBTB 1MIMH 4DKDC 1NJ9B 2D31B 1LNUA 2HJKA 3ZSSA 1OGAD 3GO1L 4HWNA 3MACH 2DQUH 2X70B 2EDKA 4R96A 1AR1C 5FEBA 4HHAB 3TJEL 3VXNB 3MRIB 3P9LA 2HT3D 2YUXA 1JGDA 1KB5A 3H9YA 3L5IA 2XWBA 3G6JB 3L7FA 1OD9A 1JGLL 4CN4A 3KPLB 4Z7NF 1K6QH 2CIKA 2AEIT 3VRIA 4P5MB 2BNRD 2A6JB 2ERJC 2H41A 4KXZI 5JQ6L 1N5AB 5FYJH 3EFFB 2XT1B 4LLWA 1OT2A 2CK0L 1BEYH 1B2WH 1CGTA 5E00A 1W2KT 3KYNB 3OHXB 2E9WA 4QNPF 4UUJB 1D6VH 2KH2B 4KI5C 5ENWB 3TC9A 2YEZA 3AS1A 4DW2L 3MLRL 4LLYB 3MRQA 2ADFH 3EYQD 3JV6B 5BO1L 4KU1A 3D2UB 1HIMH 4BZ2H 3C60B 5C0AE 4GRWB 5DRWB 1RU9L 4NZJA 3V4VH 2NY1D 5I8CA 1HINH 1KEGL 5GS3A 4DVBB 5E95B 2EIZA 4G9FD 15C8L 5I1GL 4X4MA 4FQXA 3VXRB 3B8YA 3P9LB 4NO0D 3DYOA 4WY7L 1JGDB 2DLIA 2BHZA 5HYJE 4YNYB 2XWBB 3C8HA 3L7FB 4HIIA 1K85A 4HSQA 3VDCA 4K07A 3VRIB 4HIXL 5BV7C 1UB5A 3SDAC 3VI3F 5HHXL 3B9AA 1T2QH 3UTTA 1UACL 3SE3C 4F7PA 5D6DC 5E00B 3MLZH 4MVBD 5DYOB 3V0WL 2ZCKH 2YEZB 4UT9H 5GJSL 4DAGH 3MRQB 1A3RL 5HGAB 4D0BA 1T6VN 4I13B 3AM8C 1MFEH 2OXHA 5GZOD 1S7TA 3I2CL 1CXFA 2CPCA 2VOTA 5DFWH 1SHMA 1NCCL 4H1LH 5I8CB 4R0LA 4LSRL 5ALBH 3LHPL 4OD1H 2VQTA 2PYEB 3UJJH 4KK9D 4M1GL 2VERN 1B0GA 3IETB 1T5WA 3EDDA 2OJZH 4YXHL 2EIDA 1MFAL 4KRPD 2X1WL 4P2OB 5FCUH 2EECA 3KDMB 4HIIB 1GSMA 5K9KA 3FONB 4HGMA 1OAUL 1KBGH 4L4TE 3QG7H 2JJTA 1MCLA 4NN6B 3TFKC 4MJ2A 1UB5B 5D72H 3QB7C 1QFWH 3UTTB 3GI9H 3OGOE 2ESVE 3DV6A 4C83A 3CLEL 3C60C 5A43C 4RQQB 3LSOA 1RUPH 3EO1A 4FQCL 1ETZA 3I75A 1X4ZA 3AS2A 4PRIA 2ITCA 3MLUL 3ARDD 1S7TB 4GAGH 5F1NB 4P4KD 5A16A 3ECBB 3WFZA 4OFVA 4WGVB 4KROC 4I0PC 3HNTL 1YMHB 1MCCA 3OKOA 5ERWB 4LPWA 4R0LB 5EBLB 5EU7E 3UPCA 2IF7A 5FOJA 3JWOL 1B0GB 2A73A 3E3QC 4PJIE 1AGFB 4K94H 4QYOB 5BCAA 1JHTA 3BE1L 2J8OA 4KTDL 3V9FA 4AIXA 3M45A 2FCBA 4OM1L 3RTQA 5DUPL 5B8CC 1JNHB 1CDHA 3IU3A 2VXTH 1BMGA 1NBYA 3TPKA 1S9VB 3C87A 3QPXL 1YEDA 4BFIB 1EUUA 1U8JA 3OX8A 3VG0L 4ODTH 4G6FD 2R2HA 3QRGL 5DQJB 3H9SA 1A6VL 2DTMH 4OIIH 1NC4A 1CICA 3DV6B 4C83B 1AKJA 2WP3T 4WW1A 4HX1B 1A6UH 3HAEA 3ZDYF 2AVGA 2WNGA 3LSOB 5JDSA 3EO1B 3I6GB 3I75B 4MQ7A 1RMFL 5A16B 1U8IB 2VO5A 3BN9C 2JJUA 3JSSA 1U93A 3OKOB 3Q6FA 4N68A 4P2OC 1NL0L 4K3JH 4MA8H 4WGWB 1A6ZA 4Z8FH 3RKDD 1W8NA 1SY6H 2AABL 4WHYG 4M5ZL 5F9DC 4WFEE 2WW8A 5FYKU 1T20A 4BQBA 2BVOA 3IKCB 2DLFL 2WBKA 3CC5A 4JHWH 3SBWC 5ESVB 1OGAE 2A6KB 3IU3B 2YKLH 5FHBH 4G6KH 1A7RH 4OQTH 1YEDB 1U8JB 3QULA 3OX8B 5DQDL 2VISA 4LK4A 4TUJA 3MR9B 3O4LA 1IFHL 2B7DT 2R2HB 1KOAA 2BY3A 3IXTB 1FZOA 1NC4B 1UB6B 4XHQA 1QKZH 2QADD 4DUVA 1D5XA 1NUDA 1INQB 2B4CC 4GKNA 5EBWB 1AH1A 3QUKB 3VXSE 2BNRE 1BFOA 5CJ5A 4PB9H 3QUMH 1XCQB 2O5YH 1LK3H 1DEEA 5HPOA 4NNXB 5IHUL 1FVEA 4ZFOL 1A6ZB 2EYRA 3LKOA 4IJ3B 4NKQB 4OI9A 1RJYA 1T20B 5GRUL 4YDLB 4G8GB 2D9QB 2IPUG 4QY8A 5LKNA 3VXMD 1OSPL 4Y1AD 1H0DA 1QFWI 3CC5B 3BT2H 1QRNB 4KY1L 3Q6GH 3NPSB 3VXTA 5JZ7C 4JPWH 2H32A 4KKLC 2VISB 3SDXE 8FABA 1ZGLA 4TUJB 5CP7A 4JFZH 3WV0A 2AJSH 3O4LB 1KXTB 4NZUH 1FZOB 4HT1L 2ADJA 1I9JH 4RFEB 3C6LC 4MJ5B 1CZ8H 4J3TA 1D5XB 4KFZC 3WUWB 2NY7H 1QQDA 4S1SH 3RY6C 3TEUA 1MFDL 3GK8H 3OF6D 1KEML 3ZKND 3C08L 5DD3L 5ITBH 3IJHA 25C8H 1KCSH 4LP4A 1CGVA 4NKIL 1BFOB 3V4UL 5FO8B 1VSCA 2J3SA 1I8IA 1NAMB 5AAMA 2R29L 3LDBC 4PJDA 1BQLH 3LKOB 5HI3D 1RJYB 2N7BA 1QEWB 3TT1L 3ZYZA 4H26B 4MD0A 4X0KA 3HS0A 1MIML 3B4NA 4WO4A 4XP5H 5KVDH 4ETQA 1S7WA 3RFZC 5EA0H 3TZVD 4Y8DC 5D96B 1EX0A 2H32B 5FV2A 1ZGLB 1A7BA 4Z95H 4QHMA 2FH6A 1OP9A 1FIGL 1JRHL 3QR2A 4RA3A 1RUQL 1ULVA 1R3KA 5IOPB 2ADJB 1T4KB 4E41A 1DL7L 3STLA 1H3TA 4MX7A 1K6QL 2E9IA 1BX2B 4GBXA 4WUUA 4R90L 5FYJD 3U9PH 4ELKB 4IJ3C 3UPRB 2OQJA 5FYJL 4OZGA 4FXKA 4YDLC 1BEYL 3IDUA 5ANMB 4ELMF 1B2WL 1DCLA 3M17A 4X8XA 2JJVA 4HCRH 4OQ1A 3TO4D 1D6VL 1MH5A 2C7UA 1NGZB 1T21B 4OZFA 2QKIA 4D94A 1T04B 5C08A 2ADFL 2LU3A 1I85A 4WO4B 3ABZA 4ETQB 2V5RA 1S7WB 4UILH 4OUOA 4GKZA 4BZ2L 2E7CA 2APTA 2D2OA 3V4VL 1NGQL 4X5XA 1R3JA 1HINL 3DUUA 2JLLA 1YEKH 1VKXA 3CFKA 1I8KB 3FQXB 4X7FC 4PD4K 1R3KB 1FL5A 1FDLL 4ZMAT 4LCUB 4E41B 4HUWB 4LASH 3STLB 3BGFB 5KS9E 3IXAA 4AEHH 2BOCB 3RWHB 4KJYB 4GBXB 4GG8A 4NC0B 5C0RL 1A64A 5SWSB 2EYSA 5GRZA 4HG4K 4OZGB 4FXKB 1T2QL 3LN9A 3ARBB 4JR9H 4Z7VB 2XZCL 5A3ID 2BNUB 4IRJB 1FQ9C 2C7UB 1LK2A 2CKNA 3VXOA 4UT9L 2R1YA 3NIDF 4DAGL 3VFOA 4FFVC 3CFIC 4ODXB 4Y4KD 1MFEL 3VD9A 1GC1C 3GSOB 2BFVH 4PJBE 3VCLA 2EE6A 2RIKA 4K55A 2A1WH 2DQTL 3MGAA 1R3JB 1UZ6F 3QCUH 3OJVC 2X40A 5ALBL 4OD1L 1PKQA 5IB4A 3UJJL 1VKXB 3OKDA 2XTJD 4PJAE 1NC2A 4LCCC 3QI9A 2GTWB 1Q9KA 2DF3A 4N9GA 4XNZC 4M1DH 2QQKH 5DTFB 5FCUL 5DK0A 4EIZC 3IXAB 2GY5A 3QQ9D 4K8RC 5CEZE 1X5IA 4NKDA 5EC1A 3GGWB 5FOBB 1KBGL 2H9GB 5F7FA 2EYSB 2VDKH 4PYGA 4LLDA 2YPLA 3GSNA 3PL6D 4JFQA 5D72L 4PY8J 5DC9B 3GI9L 4FXLA 2PTVA 5KSBF 3RZCD 1YJDC 3JZ7A 4KKAD 1MHHA 5E8EA 2R1YB 4XNMA 5DK3A 1RUPL 3PNWB 4XPTH 3WE6A 3GMLA 4GAGL 3GMRA 1BD2E 3ZLQC 5GJTH 4OZIA 4P4RA 3NA4A 1LWRA 3BZ4B 2HLFD 1U8PB 4S2SA 3QJFA 35C8L 1T3FA 1EO8L 2E7LC 4PRNA 4AG4L 4K94L 2ARJA 1HI6A 3U48A 3QI9B 5IEKA 4N9GB 2J2ZA 1T0NA 4JKLA 3ROLB 3LPWA 1QYGH 4R7NB 3CD4A 2DWDA 3VXME 4Y1AE 3ARBC 3RL2A 3REVA 2Y6SC 4NKDB 2VXTL 5EC1B 4LEXH 3MRLA 4IRJC 5HDLA 3SDCC 1K5NA 4UV7H 5DDHA 4ODWA 4LLDB 1TXKA 3GSNB 4ODTL 4JFQB 3KYOA 5I1IH 2DQIH 2DTML 4OIIL 3S6CA 5L2JA 5I66A 5AZEH 1A6UL 4XNMB 3B9KC 4JRXE 3WE6B 3GMLB 4PRAA 4PB0L 1E4JA 4L29B 1ERNA 5HVGB 2HH0L 1EO7A 1VFMA 5A2LH 4HXAH 4P4RB 2JE8A 2E27H 4MA8L 1BM3H 4PRNB 3BESR 4Z8FL 1SY6L 1HYRC 5GXBB 5IEKB 2XZQH 1RVFH 3RPIB 4FQJH 1IVLA 5GS0H 1T0NB 5BZDA 2HN7B 4KV5F 4Z7WA 1L6ZA 3E3QE 3K74B 3RL2B 4C56D 3NA9L 3DBXA 4QLRA 5D1ZA 5FHBL 4G6KL 1A7RL 3MRLB 4OQTL 1K5NB 4N5EC 4OCWH 1U92A 2WUCH 4M6NL 4R4BB 4KVNH 4BYHA 3KYOB 5EZLA 3VFWA 5FB8A 5L2JB 4Q9RH 5GRWA 1JIBA 4LSDA 2NQCA 4NQXA 1QKZL 2PXYC 2HFTA 4PGEB 4M62H 2I9LA 2F5BL 5FYJE 5I1JH 2GUOB 2YRLA 5DS8B 3KJ6H 3W9EA 2O5YL 1LK3L 5F71A 4GLRH 4JO4H 1F11B 4X7TA 3PABA 5CP3A 4NZTH 1YY9D 2ZOKA 4WFHD 5JA8B 5TPWL 1BIIA 4Y4HD 1N0XH 1GHFH 5D8JH 5FA4B 4BKLB 2VN4A 4QXTA 4Z7WB 3BT2L 3NZ8B 3Q6GL 4P3DB 2FO4A 2HRLA 2FJHA 4NN7C 5DEZA 4JPWL 2OBGA 4IDLA 1KLFA 1U92B 2X1XR 4JFZL 3ZHKA 2VLKD 3QIBD 3CH8A 4QF1A 4NZUL 5A40E 5FB8B 1IL1B 1I9JL 3QO1B 5HJ3B 4Y5VC 3PWJA 3RIAF 5GQBA 4NQXB 5FIEA 5INCA 4RWYL 1CZ8L 1YEGL 5F9JA 1K8IA 2NY7L 4S1SL 4DGYH 3GK8L 1MEXH 3DRTA 5E6IA 2YD5A 5ITBL 4AEIH 1B6UA 1KCSL 1WAAA 1VACA 2VZUA 5SWZD 3W9EB 3MNZA 5L88H 5I1CH 5E03A 3SE8H 1PG7H 2AV1B 4X7TB 2OZ4A 4Y16C 4O58H 4Y5XA 4M7ZB 5D2LB 3TA3A 3CSPA 1IE5A 3EJZD 4XP5L 1BIIB 3CJJA 3HC3H 4X6DE 5KVDL 4QXTB 5CGYC 3QIUA 3WYRA 1VFBB 2FO4B 4MQXC 2FJHB 2YD7A 1WWWX 3KLHC 4YH6A 1FFPB 5KOMC 5HVWA 4MNHA 3QUYC 5E5RB 4Z95L 3QFJB 1OOAA 1J0IA 2XTJE 5FGBA 3RUGA 3HLAA 4ONGH 3KHQA 4Z7UF 1JNLL 3QA3A 4TSAH 5FM5M 5IW1A 4HPYH 4LSTH 2CLRB 3GJFA 4CJ1A 3E8UH 1RJLA 2NLJB 1T5XA 5L7XH 1U2HA 5IB3A 1GZPB 3MNZB 5DZOA 2XWTB 4MLIA 4YLQT 5DMJB 2X7LB 4HCRL 5D7LE 5C0BD 3DYPA 3WD5H 4LLQA 2P5EA 3KHOA 3LQAH 2R1WB 3MXWH 4Y5XB 1EEYA 3TA3B 4TSCH 4W6WB 5T5NG 9CGTA 3UPAA 3WNPA 1JJUA 3QIUB 4UILL 1FORH 2B20A 1IGFH 2E9BA 5FDYA 1VA9A 3VFRB 1YEKL 3OJMB 4IDJH 3LIZH 4MNHB 4OZHF 1AXIB 5D4QA 2OSLA 5CLWA 1DBJH 1I4FA 3RUGB 3F7YA 2WAHA 1W72B 5HHVH 4LASL 5DRNB 3QA3B 1TQBB 1YZZA 2UWEE 3RWGA 1L0XA 3VD7A 1T5XB 1FJ1A 5BS0A 3FO1A 1QLFA 4M7ZC 3H6JA 4MD5A 4R3SB 2ZG1A 1N8ZA 4JR9L 5J1AB 2A83A 1NDGA 4YBQD 3WIIH 5D2NC 4HW6A 1U8QA 4G8FB 3BYYA 2KZWA 1CLOH 2HT2D 4U1IA 5E9DA 3RVXD 5TDOB 1ND0A 2BFVL 3HZVA 1BZ7A 2A1WL 4OCMC 4RDQG 2Z4QA 3BSZL 4FA8A 4WEMB 4BUGA 3WFBH 4HWBH 4IOIA 5LG1A 2IFGA 1I4FB 1ZA3A 3HCVA 3F7YB 4M1DL 5FUZH 2QQKL 3LKQB 3HB3D 4HH9A 4NFBA 1IM3B 1EAPB 4ZD3L 4ZPVA 2IC2A 4MQTB 1IEBB 2KDGA 3MRJB 3PWUA 5BS0B 3MNWB 4MNQB 5BXFB 4LARH 2VDKL 4HLZG 4M8VA 2A9ML 3QWRD 1KIQA 1CD8A 3G5VA 1FNHA 4X99B 3ARGD 2X2YA 2KUTA 1P84J 1NDGB 4XHJD 1K2DA 2PCPA 3VDAA 1QUNA 3VA2C 2BCKA 1L9MA 2NXZD 3V6FB 3MBED 4XPTL 3SOBH 1IAIH 2HT4C 2YBRA 1C08A 1VADA 5EU5A 5GJTL 3IJSA 2VQ1A 2CDFB 4QCIA 3U4EA 1CU4H 4XI5C 2VWEC 2QL1A 3G5YA 5JNYA 1UH4A 1TQBC 1V3LA 3ZDYE 1OWWA 1ADQL 3HCVB 2JELH 3D3VA 3LS5H 3JVGC 1QYGL 4WI7A 2AK4A 1TNMA 2X4TB 4ZPVB 3NFNA 4P2QD 4MMXC 5JORB 4HMCA 5KANG