5KSVB

Crystal structure of hla-dq2.5-clip2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Unraveling the structural basis for the unusually rich association of human leukocyte antigen DQ2.5 with class-II-associated invariant chain peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2016-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksvB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksvB01
3H9HA 3SE8H 5F7UA 5IMOB 4KTDH 4KAQH 4I77H 1F2QA 3IETA 3PJSB 3QZWG 5E5UB 5EBLA 1T22A 1DLHB 1CZ8L 4BZYA 5TDNA 5IVZB 5T1MB 3KPPB 4ZDHA 4OLUL 5BV7C 1H8SA 4Y8DC 2OI9C 5TPWH 1BQHG 3GSXA 1FL5B 4W6WB 5TFSH 1OM3L 1NQBA 3EYSL 4LCYB 5AZ2L 4E41E 4XCFH 1F6AB 3G9AB 3HC0A 1YMMA 5TDPB 5DVKA 1DQDH 1QSZA 5E99H 2R0ZH 4KJPC 1WZLA 1QSEB 5BV7L 2D03H 2JJTA 4H88H 1QSFE 1FN4A 1HIML 3AS2A 4JFHE 4JN2B 1LO3H 1RJZB 4HQQL 3A6BH 1YNLL 4NN7B 5DK0B 2R15A 1I7RB 3RUGB 2AV1B 4YZFE 4MDJB 2AW2A 4NFBA 3UPRA 1Q9WB 1PFCA 2CSPA 2FZ3B 2X4TB 2XPGA 4PTTB 2W0FB 4DVBA 1DQMH 3FHQA 4ELMF 2P48B 1WBXA 2WBJB 5D7IE 1Z5LB 4PS4L 1S9VA 3ARBB 3C6SA 2HKFH 4F58H 3EYQD 1JNLL 2ESVE 3JWOH 3C5ZC 1F3DJ 4PJ7B 3MRMB 3NZHL 5T3ZH 2R2HB 5C0BB 3PWUB 3LMJL 3LQAC 4LHQB 2Q1EA 1E4KA 1Q94B 3DGGB 4WI7A 3T4AA 3FRPA 4GS7B 5JR1L 1RZKC 4I18B 5FGCB 1RURL 1OGAD 2DD8L 3LS5L 3D39E 5D8JL 2DQJL 2BSTB 4PD4J 1MFEL 1HHJB 4KKBD 5FUZL 2X4NB 4OLYH 1WIUA 4YAQA 1I8MA 1ROWA 2QHRH 5J4MA 5EWIL 1MAMH 4NRYA 4AIOA 2OCFD 3LQAL 1N64L 1Q9LB 4WWKC 5GGRA 4EI5D 3MRNA 1X4ZA 5DK3A 4RFEB 4ODVH 5ANMA 3ARDD 1YDPA 3DV4B 3LKOA 3QAZC 4HKBA 1T5XA 3RUGF 2D7MA 2EICA 2FX7L 2O5ZH 3PF2A 4FXGA 2EC9T 3HFMH 4XVJH 4JM2D 4ZFOB 4LQFL 3OR6A 4LCWD 1GL4B 4OLVH 5C0CE 1ORQA 4MYWB 3BGFB 3VH8B 3ZDYE 5IJKA 1QFHA 2PR4L 1CGUA 3K8LA 4PJ7F 3D85A 3EDDA 1ITCA 1C08B 2BNRE 4GRLD 2VSCA 1ULVA 1WQVT 1AKJB 2I5YL 2AGJL 1JWMA 4PY8J 3T0BA 4J3SA 2CUHA 4G8GB 4A6YA 3MR9A 4HPOL 3F6IA 4JE4B 5JHLH 3T0ED 5JLZB 4FP8L 5CD5C 1QTYT 4FQXA 1UGNA 3FFDA 4HUUB 1RIVL 4GBXD 2R1XB 3T3MF 2A73A 4M7LH 3EDKA 1S7WB 5EOTA 3EW3B 4M8VA 2PCPB 3ARUA 2IADB 1QR4A 2VDML 3ULSB 3PGDB 3ZT6A 4WU7B 5DA0B 1INEH 3L3DB 4OI9A 4BQBA 3AREC 1D5XA 2A6KB 4YGVA 5D1QB 1RMFL 4M1CC 2A6IA 3VD3A 4ERSH 3JV0A 3JV4B 4GKSA 4L1DA 1OP5H 4KU1A 1HHKB 5DRZB 3N1GC 3MBXH 3HRPA 1S9XA 3MRKB 4P23A 4QYOA 1H3PL 2EH7H 4G6MH 1B4JH 2NW2B 4P46A 5GSVB 5C08E 4Y19B 4H1LA 4PJ9D 1MI5E 5LGKA 1E4XI 1KIRB 3UTTB 3VCLA 3C60A 4TQEL 5EUKA 2X4QB 3WFHB 5I1DB 2C4FU 3OKKB 4U2ZA 1T1WA 3RHWF 3RJQB 3ARFD 3LZFH 2V7HA 2XA8H 3O2DH 3MA7A 1FNAA 2HT2D 4QY8A 5D70H 2NY1B 3EIFA 4WWID 4J6RH 1MRCL 1JN6B 3IFLL 3DECA 1UB5B 3K2UH 4ZS7H 3PWJB 2W9EH 3F7RA 5C2UB 1X9QA 2Z35A 1MREH 1N2RA 3FFCE 4NZUH 3BZFA 1QFOA 2BOBB 1WZMA 2NLJA 4LSQL 4MJIE 1CT8A 1H9VA 4KDTA 2MWCA 5IROA 1XR9A 2Z93A 4O02H 1BGXH 4OGXH 1YPZB 1FBIH 5D93C 2UWEE 1M05B 5EZOH 5E8OA 1J1PL 3C09B 3HI6L 4OLXL 1P7KA 2FL5B 1KJVB 4IHOA 5T5FH 4QWWC 3VFVA 4JVUA 5DEGB 4X7CC 4D9QE 1AP2A 4PRDB 3IFPB 4O58L 4YDVB 4ZFZB 5FA4B 5J3HD 5EBGA 1MCCA 5TF1L 4PR5B 2EYRB 5CJ8A 5KVGL 3FZUD 3CFBB 2COQA 4F33A 1UB6B 4M5ZL 2ITCA 1DANT 4WHYH 3BSZL 3DO3A 5CWSB 2VLKA 3RWEA 5KG9A 3KPSA 1R24B 2HYMA 3QG6A 4Y4KC 4XP6L 1JI2A 3V6ZB 2YD9A 1QVOB 4EI6B 1J0IA 1J8HB 1LK2A 2HJKA 2ZCLL 3IF1B 3LKSB 5LCVH 1W72A 5TQ0H 3S3SA 1YPZF 4Y4HC 1QACA 1CDYA 1CFQB 3OBAA 4UNUA 3CK0H 4NQVB 4YBQD 4CNIA 3HR5B 4YE4H 1R3LA 2DLTA 3QUXB 4U1KB 4NQDA 3LEXA 4EQ2A 4FQLH 1KEMH 3MRQB 2ORBL 4HF5L 3ULVE 2AABH 4QRPA 1UKSA 2IH1B 3DUSA 3V0VB 5HHVL 4V1DA 1EDQA 1G7QB 3MSPA 5IK3A 1PEZA 32C2B 5EU4A 2CMRH 3IFNL 1I1YB 2CD0A 1JPSL 2J8UB 4S0TD 1FYTE 3MRBA 5DJYA 3U9UA 3SDAB 1KCVL 5DFVC 3RA7H 1AGFB 3LDBC 3LKQB 1XGUA 1FFOB 5F6HJ 3U1SL 3PL6A 4U1JB 5KW9L 4KKAC 3MRGA 4HJJH 4FQ2L 3SCMB 3UDWA 2F54A 4LLYB 2B4CC 1KOAA 2AJYL 3O3BA 3QH3B 4HWBA 3MOAH 3S9DB 3QEQD 2H6PB 3IAQA 1RUKL 12E8L 1PVHA 1SJXA 2YD7A 1INDH 2VQ1A 1FC1A 2R4RH 4HPYL 4HIXL 5C0RL 2AERT 1NLBH 1NMCB 4W4OA 3RZWA 4S1DD 3TYFB 2Q8BL 3QIWD 3VW3H 4CMHC 1F4WH 1T4KB 4O9HL 1T89A 2HLFD 3UTPD 1KB5B 2VLJE 3EOBA 4XPGH 2NTSP 2J8UF 2FB4H 4XCEB 5IWLC 3QJFA 4XB7A 1PYWA 1KGCE 3QIBC 3Q3GA 4RZCB 3M1BA 5IMKA 4HS3A 2BCKB 1BVKB 4GAYA 3I2CH 5E9DA 5DJ6A 3TIDB 2ZUXA 4I0PC 3HZKA 5IHUH 3ULUD 3QNYA 3STZB 1NEZA 4TSCL 3MXWH 2YD2A 4NZRH 3DRTB 4YPJA 4P57B 1Y6MR 3ULVC 3M8OL 2R56H 1MF2L 2PF6A 4U6XA 3HRZB 2MPAH 4HIJA 3TC9A 5IP4A 5T3XD 2ZSWB 3SKOB 1R3JA 3QXAA 2F15A 4ZFFB 3I02A 3GMQB 1ED3A 1LEGA 1K6QL 2DL2A 5LXGL 4PG9A 3FOMA 4FFZH 3MV9A 4P2OB 5HGHA 2XWJB 3L7FB 5D9SA 4QRQA 3GB7B 1FSKB 2I9TB 4UV4L 1V7NH 4XX1G 1FNFA 4UNVA 1X5IA 4U1NB 2BERA 4TVPD 2AEIT 2LQRA 3MRCA 3Q48A 3MO1B 5E94A 1NL0H 5IW1B 3OG6B 3MRDB 3WFBH 2IPTH 4KQ4H 3RWIB 4MA7L 5J7CC 4JY5H 4OGYL 3TO2A 5CJXA 1OGAB 3O3EB 3R4DA 2RR3A 2XTJB 2VABB 2V2TA 1K8IB 1VDGA 5D72H 2Z4QA 1OAYH 4K7PL 4X9IA 3RWDA 2DI8A 3WLBA 1C8PA 4EI5B 3S5LA 3K4AA 3L3KB 1J1XH 2GT9A 3WN5A 2OJEB 1KLGB 1KCRH 5LG1A 1IAII 4MAYB 3KVQA 3ARDB 1LE5A 4U49A 4FQIH 5MEPA 3MCLL 2EXYC 3D69B 3GK8L 2D0GA 4S2SB 1ZA6A 4KK6C 4LEXL 3B2UC 1P4BL 4R0LA 3MACH 1DVFC 1TNNA 3WIFB 4JM2B 4MNGA 5SX4H 1C16B 3A67L 5EN2B 3S97C 3GHEH 3L5HA 5I1KH 5INDA 4NQXB 1NFIA 3UYRH 3MODL 5HXMA 1JNHB 3TBSA 5J12C 5DVOA 3LS4L 3RX8A 4XT1C 2P46B 3WKNA 5K59F 4LCCC 1BZ7A 4GRLB 1U93B 3QO1A 5C0JA 5IEHA 5LGJA 3Q5TA 3VWJA 5D1XA 2P8MB 3H9SD 1T66D 1LVEA 1U3HA 4JFOB 4QHUB 2PO6A 3VXSE 4GBXB 1KIPB 4YHYC 1LD9B 2BFVL 1JUFA 4GXVH 2EYTB 4M5YL 2G5BB 4XH2A 5HPMA 2GK0B 3RZCC 1QRNE 4MQXC 4IS6A 1GRWA 3O6LH 1J11A 5DD6B 4OB5H 2GTZB 3HCVA 4OT1L 3RVTD 3LEYH 4WUKH 1LNUA 3QPQD 1ZLWK 5EPMA 5F89B 1FH5H 1LEIB 4HUVA 3G6JA 2WZPD 5HGBA 5HY9A 5ALBL 4DUVA 5DT1H 4AZ8A 4QGTA 2P5WE 5CMAA 3GEWB 3PWPD 5D7LB 4XMKL 4JM2F 2P8LA 4ALAL 4UZGA 1BWWA 1PSKH 4JGJA 1BFVL 1U3YA 3GSRB 4G6FD 1MRDL 1SQ2N 2BMKB 4L4VB 3TBTA 1HDMA 5C3LD 2DKMA 2HT3C 2YS4A 3ZSTA 5DUBA 5FOJA 1S7VB 3QG7H 2YRZA 4XGZA 1C5BH 4JZNA 5CJOH 4GQPH 2NX5E 5BVPH 3DRQA 1OAQL 1KB9K 3SOBL 2IQ9L 2EDWA 4YO0A 3WUZA 1UXSB 1CE1H 3MLYL 3V2AR 4TNVK 4D9LL 1KB5H 1RULH 4XNUH 3ARFB 5KSAB 5DD5H 4TUOA 5DEFB 1JF1A 4Z7NE 3GRWA 1JGEB 1XZ0B 2F19L 4BSWA 5EA0H 4XX1E 1QR1A 5JHDE 5C09A 4WO4A 1A4KA 5IV2A 1KTRL 5DF0A 1JVKA 4Z6AT 1B2WL 2EDBA 4YEEA 2BVPB 4P4RA 5GIRB 5I1HL 4XPHL 1CLYL 4WU5B 1TLKA 2R2BA 3J7HA 1F13A 4JAMA 4PB9H 4XP4H 4JZJB 5I17B 4GRWB 4G8IB 1W2KT 4MQ7A 1JTPA 3SKNB 1CD1B 1IE5A 4KTYA 4OZ4A 4YBLB 2H9GA 2O5XH 3F6LA 4D9RE 3DX6A 4APQD 1ZT4B 2X4SA 2G60L 3TT3H 3X13A 3BX7C 3CX2A 3ZKQD 1OLZA 2D9QB 1JZ7A 3WE6B 1O7SA 4CL7A 3NFNA 3V7AG 2KBGA 1T03H 3VXMA 2Y36H 5C0GB 1U91B 4F7MA 2HT4C 1KFAH 5E8NB 2DN7A 3KPTA 1ZHKB 4TNWF 3BQUA 1BAFH 4J1UB 4RMQA 3SKMA 1YY9C 3ZYIA 3ISWA 4AMKH 4EUPA 4ODUB 5LGHH 1IGYB 4Z76B 5DJDA 1QBBA 1X5KA 4MD5B 1MFCL 3KNBB 4LRNH 1J05B 3IDXL 4GRWF 4Z7QF 4NJAL 5KVDH 5KOMC 2ZUYA 1FFNB 3BPNB 1WAAF 5ID1A 5KN5A 4P4KA 3U0WH 4IMLB 1G9MC 4X6CE 4EN3B 4ONHB 1U8HA 2FO4A 4YDJB 1LO0L 1FDLH 4M4PA 1AO7E 4WW2B 3FO0H 1OY3B 4XVSH 1FZKB 3SE8L 4KTDL 5CSGA 5F44A 4KAQL 4I77L 5HBBA 1ADQH 4JFFA 4K55A 3DETD 5C0DB 1JYVA 1F4YH 1T5WB 2L4OA 3NGBC 4C56A 3WNNA 3Q6FB 1OB1B 4H0HB 1IAOB 5TPWL 1BEYL 4LLMA 4RQQB 4PYHA 5TFSL 3HPJB 1WCBB 1S5HB 3OZ9H 4R2GC 4XCFL 3UROR 4PGDB 3D25B 1DQDL 4NQCA 5E99L 1IJ9A 5E00A 4KFZC 4CN6A 5IEKB 3GMRB 2R0ZL 3U83A 1ACZA 5F8RC 1YA5A 5F96H 2D03L 4H88L 2BVOA 3QEQB 4OKVB 5E6IA 1VEOA 1LO3L 3CDGB 3JWOC 4Y1AA 3QFJE 3A6BL 5C71A 1V8HA 3GM0A 3BP7A 1GOFA 5HI4D 3E6FB 4FZ8H 1CGSH 4GT7A 3MLWH 4UDTB 5D2LE 4HUWB 4HIEB 1DQML 1JGDA 1UKTA 2IALA 1NANH 2LV4A 3DV6B 3KPOB 3QIWB 4WW2F 4OZFA 2VC2H 2DI7A 4F58L 3TN0C 1A64A 4BK5A 3JWOL 4F7CB 1KULA 3C60D 1D5MA 4U7MA 1JV5B 2CIIA 5T3ZL 1I8LC 1WBZA 2DRUA 4PRPA 2N7BA 5FAAA 2VR5A 5E8PB 3KS0H 1ZGLM 3F5WA 3ZT7A 1MSPA 1WEJH 1G6RB 4YH6A 1CGTA 5C07B 3IKKA 2Y5TA 3P0GB 4OLYL 1IGTA 1I1AD 3QCVH 3CH1A 4P5TB 1FYHB 2YA0A 2HAZA 4PJFB 2QHRL 4M3KB 1EMTH 3RGVC 1MAML 2KH2B 4CADA 4L3ED 2AXGA 4JRXA 3V7AE 1S8DA 3I6GB 2G2RB 3FQXA 3MJ9A 4ODVL 2WWKT 4PJHE 15C8H 3QUYD 4XVUD 4OSUH 3B9KA 5J13B 1QSEE 2O5ZL 3QNZA 3QIUA 3HFML 1A1OB 3MNVA 4XVJL 1B0WA 4HGWB 3GI9H 4JPIB 1KTLA 4OLVL 5I0DA 1ZSDB 4DCQB 3H3PH 3RUGE 1QNZL 3S37H 5K9OB 1F4AA 3FQWB 1FO0B 5B8CC 3FKUS 4JFEA 1OP3K 3JUYA 1SJHB 4F7PA 4UT6H 2A9NH 3GSUB 1OAZH 2NY4D 4XNYH 2ZNWA 3LKPA 4PRHD 2D7PA 4P9MH 2AK4A 4PJ7E 4K7FA 5I74C 3F7YB 3ULUF 4M7LL 4JFDA 1Q9OA 4PJFF 5C0BE 3V0AC 1IGIH 3D5OF 3T0WA 5A2FA 1B0GA 3GUTB 2PW1B 1UJ3C 1ACYH 1KPVB 1A3LH 1S7XA 3GMOA 3ZL4H 4PLKD 2W65A 3G5YA 1INEL 3T3ME 2GCYB 4XBGA 1GXEA 2C3XA 2NW3A 3TWCH 3VGAC 3E3QE 4Y5XB 4RAVB 2IAMA 2R1YB 1RY7B 2PW2A 4ERSL 3SGDH 1LDPH 1ETZB 1FVEB 2K1MA 3QDGD 3RWFB 3JWNC 4FQHA 2BDNH 3MFFA 4IJ3B 5D1ZC 1BBDH 2W1NA 3IFOA 4R4BA 5HGAB 5F9JB 4R7NB 2EH7L 3MMEB 2WINB 1B4JL 2VIRB 1MHEA 3GMNB 1R5WB 5DJZA 2YD5A 4FXKB 3VGBA 4WFHD 4BH7A 3GMMA 2B5IB 2AV7B 3CH8A 3DARA 5GRXG 3RVWC 4F7EA 4YWGH 4OUOA 5DLML 1A6AA 5IIEB 4X6FB 2IANB 1AD0B 1PZUB 3CZFB 3BYTA 2GSGB 3K3QA 3LZFL 2XA8L 2D4DA 4P2QB 2RFXA 3O2DL 1F3RB 1MCLA 3FQTA 5D70L 4J6RL 2MKLC 2B39A 4I9WE 1NBVH 2WIIA 4X99A 4NJ9H 1CDJA 4NN7C 4NKOB 3K2UL 4ZS7L 5L88H 2W9EL 1H3TA 1MREL 4OZIB 2IH3B 1DQTA 4WNQB 4HGMA 5DJ8B 4NZUL 2NXZC 4IOIA 2QADD 4HFUH 1O7VA 2XN9A 3PWPB 2O61A 4O02L 1BGXL 4OGXL 1FBIL 5JOPD 2ATPA 1OTUD 3QPXH 5TDOA 4Z7UB 2ZG2A 5I8KH 4EXPX 5EZOL 1FG2A 3QA3A 3F7VA 4WI3A 1EFXA 4G6FB 3T77B 1TPXB 3PDOA 1MJJB 1AD9B 5DC4B 2APXA 3RY6C 5I1AB 4LKCB 4AT6A 3H0TA 4GW4A 2IPUG 3QXVA 4GS7C 4I18C 3FO9A 2MTPA 3VFPA 2GAZA 1I8KB 4LLUB 3CZJA 4JEGB 3QEHA 1RHHB 3TCLB 1A0QH 3PNWB 3ESUF 4JY6B 4Y19E 4P2RD 3E3QC 3QI9B 4ZSOB 3X11B 4C59B 2C3HA 1JE6A 4FQCH 5F9WB 1YN7B 4C58B 5DHVB 3BDYH 2HJFA 1TDQA 4ODWA 1G6RH 4LKXA 1NGXB 3D3VA 4X4YB 2QQKL 2OQJB 4OZIF 5HVHB 4JCLA 3ULUH 4MHHG 4P2CG 5SWSB 4OV5A 3P2TA 4Y8AA 1YJDC 2FEEI 3RIFF 4H8WC 4NQUA 3MBED 3MRIA 3TF7C 2E6JA 5LCVL 5TQ0L 5F6IB 2CDEA 4X80L 5T3XH 1UWEH 4Z7UF 3CK0L 3E0GA 4YE4L 5EG6C 1IEHA 4FQLL 3LD8B 4J23A 4APQB 4NKMB 1KEML 1BD2B 4Z5RA 4PJXA 4NGHH 4U1GB 2IQAA 2AABL 3OR7B 3FQUB 4WFGE 4Z9KB 1V3KA 5BQ7A 1YPZE 2BVEA 4ZFOL 3ARGB 2CMRL 4RNRB 1FNGA 4TVPH 4UB0L 2FX9H 2JELL 3I3DA 4LVHB 3BT2H 3AAZA 1BJMA 3RA7L 1FO0H 4XCYA 1L6ZA 2Q7YB 4HHAB 1WT5C 4QRRA 3HN3A 2A1WH 3P9WB 4HJJL 2N7AA 5C8JA 1KYOK 5D1QC 4FFVC 1X5FA 1A1MA 4XNMA 4KRLB 3MOAL 4I0KA 5DYOA 3WIHA 3CAFA 2L0DA 5FF6A 3E6HA 4QTIL 1S7UA 2QJDA 3OMZA 2EE6A 2YUWA 3TJEH 1RJCA 4D0BA 4O51B 4ORZC 5DJ0A 1INDL 3UJIH 1M6OA 3IDNB 2R4RL 2DIBA 3MCKB 3RTQD 3LIZH 2V2XA 1GAFH 1G0XA 3L6FB 1NLBL 2UZXB 3IJYA 4WUUD 4Q6YA 1J8HE 1JIBA 3VW3L 3C87A 1F4WL 2GI7A 1XT5A 4PRAB 3VWJD 1CN4A 5D1XD 1JWUB 4XPGL 5CEXA 1TZHB 4ODBD 3TPUB 1RVFH 2FB4L 4NT6A 4MX7B 4XHJC 3GJFA 4X5LA 2AJZB 4JZOB 4N1EA 4J8RB 3C6LB 2KQNA 3I2CL 1AGEB 2J8UE 4KKLC 3VA6A 3TBYA 5IHUL 3CMOH 1F4XH 4RAHA 3C5ZA 3TFKC 3MXWL 1T6VN 4NZRL 1NPUA 2X44D 3CMGA 4PLNC 4JB9H 5FOBB 2GITA 2R56L 4CDGC 1Y6KR 5ITFB 2GK2A 2MPAL 3QQNA 3VFTA 3O4LA 1FVCA 1TXKA 2HN7B 3ALWA 3IGAB 1P5UA 4LSPH 3KLHD 3VFRA 1UJTA 3RKDD 3C09C 1F3JB 1QFWM 3RVVC 4FFZL 4M7KH 1G7IB 3MRLA 3VXRA 3OAZK 3DX7B 4JKKA 5CGMA 5HVGB 3C9NA 4WWKA 1V7NL 1NDMB 4Q9BA 5MEND 4GUPA 5MP6H 1OARH 5E2UL 2IJ0C 1NEUA 1BF2A 1MIEH 3WFBL 2IPTL 4M62H 3M45A 5DURD 3PV7A 4JY5L 2X4PA 2MKWA 1IEBA 3P0VH 5LAXB 2KL6A 4WO4D 4UDUB 4E41A 5D72L 5CP7B 2R0WH 4NCC2 1LGVA 1FPTH 3DMMC 1I1AB 1OAYL 3QRGH 5GISH 2JJWA 4NKIH 3WDIA 4L3EB 4TOYH 1J1XL 3L3GA 2H8PA 4LPTA 5DHVH 5GRVL 3TZVD 2QKIA 2GIYA 4OFDA 1QSFA 1KCRL 3QUYB 3RNKB 1FGVH 1Y6NR 4FQIL 1HQRA 4HMCA 4HJGA 2DM3A 3MREB 3QUXC 4YQXH 4O2CB 1EZVY 1K8DB 1EVUA 5IMLA 3MACL 3SO3B 4LBEA 1LO5A 1WLHA 3L95B 2HLAB 2XNAB 1V5JA 4UIKH 5F3HB 1XGPB 2OR7A 3VFMB 3VE0A 1FHGA 5D7IA 4E9LA 5JPNB 3GHEL 5I1KL 1BIHA 3VD5A 4P48A 2ESVA 2JIXA 1CCZA 3G5XA 5HHPB 3D2UA 1DJSA 3AREA 1HHGB 3SDAC 2DM7A 1XF3B 5SWQA 3REVB 3UBXB 3CCHA 4OFPA 1PQZA 3W11C 3MRHA 5DMGD 1EH9A 3BO8A 1YC7A 3QDJB 2EYSA 1QFUH 1P7QA 3CNKA 3W0WB 4HWZA 2NY4B 3D39A 1IC7H 4PRHB 1EGJH 4GXVL 8FABA 5K59E 3WMSA 1Z9LA 2MHAA 3BZ4A 5D7JB 5GGVH 1D9KC 4NO5A 3T4YB 1K5NA 1OGAE 3O6LL 2AQ2A 1EJOH 4OB5L 4CRPA 2XTJE 4WUKL 1QPXA 1MCRA 1KJMA 1FH5L 4QXTA 3S8WA 2OL3B 4OCYH 1ZMYA 3QDGB 5DT1L 5LKNA 5IBTH 5DMJB 5BZDA 1N3NB 3DPBA 3UC0H 1QRKA 3RPIA 4FXLA 5I2IA 4E5XB 4CKVX 1PSKL 4ODTL 5C0CA 4F37F 4QHMB 5GRZA 1NDGB 3FQRA 1LWRA 1ES0B 2DYPA 2BNRA 2IPKB 3QG7L 3OJMB 5ICYB 4C56D 1C5BL 5CJOL 5BVPL 1SYVA 2HFGL 3FOLB 2XQBH 4LSRL 1ZA3B 1CE1L 1VFMA 1KB5L 4KI5F 5GGTH 4XNUL 5DD5L 2BNUA 4U4BA 1IGJB 1ZK9A 3MRFA 2YMXH 4LHUD 3F12B 5EA0L 3GJEB 2PNDA 1KACB 3EYOA 1I7TB 4GKZA 3IXAB 3QZWA 4GFTB 1HQ4A 2KKQA 3V6OE 3FJTA 3T0EE 2EDXA 4J2XA 5ALCH 1DBAH 2BY0A 4RISH 5E6ID 1IKFH 2IWGA 3P4OA 1EV2E 5JW4R 5AYUH 5HYSA 4P2OC 5GPRA 1CDUA 3HS0A 4HG4J 1N8ZB 2VH5H 4XP4L 1U8LA 4PB9L 2ERJB 3KHQA 1FSKC 4PJAB 2XWBA 2FIRT 1GSMA 3EYQC 2MSPA 4FQQA 1ITBB 1K4CA 4TSBH 3VXTB 2X42A 5HHQA 1KEGH 3EHBD 1NBQA 2O5XL 5C08A 5EH1A 4J3UA 1MI5A 1DLFH 1RUMH 2YHGA 3CVHA 3BVNA 3TT3L 5FECA 5A3ID 2DWEB 5FDYA 2QSTA 4NZDA 2XTJC 2YZ8A 4KKBC 1MFNA 4CDHA 3ELAT 4Y4HA 5I16A 4P2RB 4FQ1H 4LRIA 4NP4H 2J8OA 1T03L 4I2XB 2WWMD 1IL1A 3SE3C 1HOCB 2Y36L 4JO4H 3WBDA 2EZ0D 4EI5C 1MCFA 5MEOB 1KFAL 3EO9H 4H5SA 2IGFH 4RX4A 1VEMA 1YEJH 5ICXB 3NCYP 5AEAA 1PEWA 5F7DB 1BAFL 5DEZA 1MCNA 4NYLB 3ARDC 1S5IH 2X10A 3EYFB 4Y16B 4JRXD 4RBPK 3RX5A 4OZHB 4AMKL 2EO1A 3NN8A 2I26N 5LGHL 4LSUH 5IB1A 3LPFA 4GRMA 3FFCA 5EIQA 4HDIA 4JM2C 3BI9X 4LRNL 4MGXA 3KLDA 4MJIA 3MBEB 3A6OA 2FHFA 4C4KT 4PJAF 5HJ3A 1TZIB 2GY7B 3QIUD 1UACH 2AI0H 5KVDL 3GNMH 4OKDA 1JHLH 4JM4H 2UWEA 3O0RH 3U0WL 2R29H 4X0KB 4GRLC 5EO1A 5DK2B 5F7WC 2A74B 1FDLL 4GKNA 2GUOB 3FO0L 4XVSL 4Z7QE 3V6OC 1OSPL 2MFNA 3T0EC 1ADQL 3EFFB 1Q9KB 3UTQB 4GBXC 1F3DH 5C0EB 1WAAE 1NKOA 1F4YL 4POUB 1H3GA 4NNPH 4D8PA 1M7XA 2AK4D 3VXOA 4NO3B 4EIZC 3DO7B 3CFEA 3CJJA 4DGYH 3W9DA 3OZ9L 4XZUA 1MCHA 2CIKA 4OD2A 1MPAH 4OZHF 4KJQD 1MFBH 2HFEB 3ZE1F 5FYKD 3FB5B 3LN5A 3BUYB 4P5KB 5F1NA 3GIVB 4R96B 5F96L 5FB8A 4OCSH 5IWLA 1U8PB 5SV3A 1FIGH 5CZKA 2IMMA 4M8QB 3BWAA 1TVDA 5FKPB 1YC8A 1XGQA 4FZ8L 1CGSL 2X41A 4PJ9C 4WCYH 4YHPA 3RTQB 1H8NA 4MXQD 3MLWL 4K94L 4I0PA 2X70B 1P9MC 2FSEA 2OL3H 2P49B 5DJXA 5FV2A 4N8VB 4ETQA 4K3DH 3LB6D 4OI7A 4PBVC 4OUUB 3O8XD 1QHPA 2BSRA 3ARFC 5C2BH 5KSAC 2DL9A 3IU3B 1RV6X 2BOCA 4JPKH 3K8MA 1FYTA 2HT2C 3PIQB 3G6AA 3P4MA 3B9EA 3DURB 1WEJL 2FIKB 3FB6A 5CINH 3IJHB 5MERA 2AXFB 3QCVL 2XFXA 2ATKB 3MLTA 1EMTL 3HKFA 3P4LA 1W0WB 5D2NB 3WFDH 1WC7A 3OAYH 1RZJH 1YNTB 1GJIA 4JZJC 4HIHB 1RK1B 1HI6A 2XN9D 15C8L 2QR0A 5D6DC 4OSUL 1AFVH 4EDXA 3BN9D 1SJVA 1FZMA 4NHCH 2I24N 4WFED 1SY6A 3V4UL 4N9GB 1EFXD 2C9AA 2EDYA 2FD6H 3GI9L 3MZGB 3QEQE 4J4PC 4FMKA 1G9NH 5MENB 5BRZD 3PGFH 1QEWA 3SPVB 3H3PL 1MHHA 2Q87A 4L29A 5FEBA 3HC4H 4M61A 4ZXBD 2VLJA 5IBUB 3FZUC 5DURB 4DOHB 3KJ6H 5FM4A 3DUUA 1DVFA 5I76B 3D0VA 2ADGA 2XZCH 4UT6L 4RA3A 2A9NL 4RIRB 4YFDB 3DVGB 3UTPE 1OAZL 2WV3A 4XNYL 1U58A 5I71C 4WFFD 1MUJA 4P9ML 4WI2A 1KPUA 3H9YA 5HVWA 1IGIL 3T3PF 1DL7H 3QWOA 4BZ2H 1ACYL 1A3LL 3IDJA 3PHOA 5IVNA 4GLRI 3TZVB 3ZL4L 1FJ1A 1X7QA 4LOUD 3QJHA 3RWGA 1TETH 4I5BB 4YBQC 3J8F7 4DW2H 1T04A 1IGMH 3ULUE 3TWCL 4PJFE 3M17B 4UAOB 1ZHNB 1LDPL 4WW2C 3RZCA 4XCNB 1PAMA 4PJBB 2BDNL 5INCA 2ICWI 4RA0C 5T3XE 2O93L 1BBDL 5EOQH 2F9BT 3VFNB 43CAA 4MB3A 1WWCA 2NNAA 2YBRB 3ARQA 2CDGB 2PKDA 4ZUVA 1KPRB 4HCRH 1RJYB 2VNCA 4YWGL 3EOYG 2J1KA 1VA9A 3TBWB 3CFIC 3BEWA 4RGMB 2CKNA 1I7ZB 4TVPE 4OIBA 1VFBA 1N4XH 1X4XA 1YUHB 2Q8AH 5F93C 5DSCA 3T1FB 1FG9C 3L3HA 3WNPA 1YEFH 1U8QA 1UCBH 2EE2A 4YNYB 5IVXE 4KJWD 4NJ9L 3SEPA 4U33A 5L88L 5F7KC 1KIQB 2A83A 3DIFB 3GGWA 1A21A 1N5AB 2QEJA 2XZQH 2BSSB 4YHIA 1A22B 4HFUL 1F58H 4MDIA 3ECBB 4L1HA 4S1DC 2Y07L 5E5MA 3QIWC 5T1LB 5F70A 1AXTH 3HZYB 1M1SA 2HLFC 4PJBF 3UMTA 3QPXL 1H15B 1QSVA 5DQDH 5HI5D 5DQ9A 1S7RA 4EDWH 1JTOA 3WFEH 3OB0H 5E2JA 2ICEB 4DUXA 3HPLB 4QXGH 3IDGB 3OKOB 4TULH 4X4ME 3ULUC 3T8XB 3VXSA 1T20B 1IAKA 1QO3B 4DKFH 4GAJH 1T2JA 1MHPH 1W0YT 4FQCL 4I1NB 5DDHA 2VKWA 5J9PB 4JN1H 3L5JA 5AWNH 1QRNA 4QTHA 1G6RL 2IANE 2YC1A 3ARPA 4JFXA 3EKCA 4QHNA 4BQCA 5JA9A 4Y4FD 1CR9H 3PABB 3ULUL 2WM0A 3K4ZA 3DXAD 3K4DA 3KYKH 3VRJB 1CXHA 3ALPA 4HKXB 3RFZC 4DQOH 2Z31B 3U0TA 1CGVA 2P5WA 3JV6A 1ZHLA 1UWEL 1LE9B 4AL8H 3I84A 4OZIE 2XOTA 5J11B 3MRRB 4AYFA 5B38A 1XGTB 4DK6A 5ILTH 1X6NA 1L7IL 4NGHL 4WENB 5I0ZA 3PWPE 1SMAA 8CGTA 2DQTH 3SY0A 2P44B 2NY6D 3TA3B 1P2CA 2NX5A 4Z7UE 3KGRA 4PRID 1OT1A 4TVPL 3VWKB 4EBQH 2J6EH 1DDHB 3S96A 2PTTB 1RK0A 1MJ8H 2BC4A 1KTKE 2FX9L 3CU7A 3BT2L 4LHJB 2PYED 3RGHA 1FO0L 3KPMA 1A6UH 5JHDA 2P5ED 2A1WL 2UYLB 2R9HC 1SJEB 3NFSH 4M6MH 1TIUA 4Y5XC 4ZSOE 3G5VB 4PY7B 4JDVB 1RJLA 2GJJA 2C1PA 1IEAB 3OXSA 2OSLB 1T3FB 2P24B 4ZPVA 3S3JA 1DUYB 4F9PC 3FHAA 3TH2T 4TSAH 2RQ8A 3TJEL 3HG1B 3K8KA 1HH9A 1UWXK 3UJIL 4N5ED 1WCQA 2NQCA 3LIZL 2YPKA 5SWSE 1GAFL 1SYSB 2ESVD 2B5IC 4JJ5A 43C9A 1I7UB 3FO2B 4R8WH 1T66C 4LLVA 4UV7H 3L7EA 4XMLH 4KUCD 4GG6B 4LSVH 1DQJA 1W0VA 5FA3A 5KSVA 1UQSA 3UEZA 2VZUA 1W8NA 2X4OA 1RVFL 2CK0H 1BD2E 3QRFM 4DN4H 3GSVA 1LO2H 3IKCA 2F5BH 3OXRA 5AZEH 1NCBH 2EE3A 1NKRA 2NY0D 1C12B 3TNMA 1ZS8B 3BPOC 1OP3H 3TN0A 2EEAA 2NTFB 5F1IA 2VL4A 5DMKA 1X5AA 1GVIA 4N0FA 3CMOL 5CSZA 1F4XL 2E7HA 2NY2B 4HMDA 1I8LA 4CBPA 4JB9L 3OKNA 3RDTD 2JCCB 3UYPA 4LIQE 4OAWB 4QCIB 3U46A 1BMGA 1KSRA 3TP4A 3CVIH 4OFVA 4LSPL 3ZE2E 2CLRA 4YHZH 5FXCH 1TPXC 1WWWX 2D2OA 4M7KL 5SWZB 4X6CA 4NUJA 2VDQH 3N1MC 4ZO7A 4RMWA 2DYPD 4FQJH 1DBMH 1AO7A 4MMXC 4XNQA 3UBXG 2BNRD 2H2PD 2FHBA 4U3CA 2C3GA 5MP6L 1OARL 3O8XB 4OCLC 4QGYA 4Y2DD 5JW4M 4GG6F 4PJIB 5CBAB 5I8EB 1OL0A 1MIEL 1VADA 5H94A 2EIZB 4ZD3H 4M62L 5F9WC 4OI8A 2UZIH 2ARJB 5IKCB 5DVLA 2A38A 2FGWH 1XCTA 3P0VL 4F2MB 4XTRD 3WEXA 1E28A 2R0WL 3X3GH 1FPTL 5HTSA 5HVHC 5JUEH 3QRGL 2GFBA 5DRNB 4YHNB 5ID0B 4N0UB 4NKIL 2RB8A 4TOYL 2HVJB 2JCCF 3DTXB 3K2MC 1BJ1H 5B8CA 1I75A 1CE6B 5F6IC 4AY0A 3O9WA 2K7QA 1FGVL 3QFJA 4NNYA 4YC2B 1E4JA 3K1DA 3WL9A 3HE6D 4QHKJ 3MFGB 3WUWB 4OV6F 4YQXL 1UZ8B 3EO1A 4APQC 1EJ6A 2X1WL 2OTUA 2C26A 2WUCH 4U1GC 5D2LA 4I4WA 3QEGH 4O2FA 4UIKL 3VGDA 5C08D 1T1ZB 1UJ3A 3MUJA 2VZVA 1KCLA 2VITA 4C55A 5BRZB 5FK9A 3ARGC 2FEDD 3UYOD 5TH2B 4ZXBB 4CVUA 4PJIF 3R06A 5JOEA 1JPGB 4HFWB 4LVHC 1WJ3A 2ADJA 2BY1A 2Y23A 1QFUL 4ORGA 1U2HA 5IMOA 1HZHH 1IC7L 5D1ZA 3PJSA 1EGJL 3CDFA 4JANB 4F9LC 2OXGA 4JVWA 1QBMH 4JVPA 5IVZA 5T1MA 4NQSB 3KPPA 3O2DA 4O4YH 5GGVL 5E08H 1I4FB 1EJOL 4O5LH 1FL5A 4MVBC 4PGEB 4BKLB 5I9QB 3RY4A 4PJHA 1F6AA 3AY4C 5EU5B 5TDPA 5CHNA 2APBA 5K9QG 4OCYL 2Z92B 4OF3A 5C6PB 4L3EE 5IBTL 1QSEA 5IJVB 5CAYB 1AGBB 3UC0L 3FRUB 5JQ6H 1T7YA 4JN2A 1NBZB 3UTSD 1RJZA 2PN5A 1JJUA 3DETC 2XWTB 3IB4A 3PP3H 5DK0A 1I7RA 4NKQB 4GH7B 3RUGA 2AV1A 1ND0B 3K81A 5DS8B 4X5WA 1AGDB 3SQOL 1Q9WA 1ZKAA 4CN4A 1NFDB 4MCZB 1C7SA 2X4TA 4PTTA 2W0FA 4MS8D 3QQ3B 2XQBL 5JOFB 3BD3A 1Z5LA 2Y5EA 4XCCH 4UTAH 5K9KB 4KK9D 5GGTL 2HH0H 3BIAX 4PJ7A 3MRMA 2YMXL 1T21B 3REWB 2R2HA 5C0BA 5EZIH 3RY6A 3DGGA 5J1SC 3QDJE 4I18A 3KPRD 2WLZA 3W0WE 5A43C 4G5ZH 5ALCL 1DBAL 1E27B 2XY2A 4RISL 4PRHE 5HI4C 1HHJA 3MYJA 1IKFL 2X4NA 2CO7B 5AYUL 3STLB 3OHXA 5FYKH 2GW5A 2CGRH 2VH5L 3WFZA 1Q9LA 2V5RA 5I18H 1IFHH 3ILPB 4TSBL 3EOTL 1KJ3H 3DV4A 4XPAH 3VG0H 2C3VB 3W39B 2F8VA 1DLFL 1RUML 3QDGE 3FTGB 1NFDF 5KOVC 4WY7H 4X6BB 5FYJU 5FGRA 4E0RA 3D0LB 1MAJA 4ZFOA 2I9LB 4LFHD 3VH8A 1I1AC 5EFIB 1EEZB 3MLUL 2VZSA 4WFHE 3P3YA 4JO4L 2FJHB 2CDFB 1C08A 3EO9L 1AKJA 2IGFL 1YEJL 3I6LE 3SBWC 1ZT1A 2LVEA 4NQED 5IROC 1S5IL 3QUYC 4PJ8B 5JLZA 1S7SA 4HV8B 5E03A 2W60A 5GGUB 4HUUA 3IS0X 4Y4FB 4Y89A 4LSUL 2R1XA 5EC1B 3DXAB 2HFTA 2VKXA 3FT4B 4Z77A 1S7WA 2YXMA 4AIZA 3DVNB 3IETB 5IB5B 2ITDA 2PCPA 5I1LA 2AI0L 3ULSA 1WT5A 3PGDA 4N8VG 4ZDHB 3GNML 1JHLL 1NBYB 3CXDH 4JM4L 4WU7A 3O0RL 3V6FA 4H25B 2XKSA 3L3DA 4IRSB 2R29L 5BXFA 5D1QA 3JV4A 5C9JA 3BMVA 3OJVC 4PJAE 3HC0B 5JOPE 1G7HB 1HHKA 5DRZA 2NY4C 5FKAB 4WI6A 1IGCH 4PRIB 4M03A 3MRKA 2SEBA 1JRHH 2VLRD 2NW2A 2V2WB 4Y19A 3CD4A 1EEYB 4NNPL 3TCXA 4WTXA 2PYEB 2VUYA 4F57L 1WVZA 2P45B 1DUZB 4XP5H 3FT2B 4PLKC 4KROD 2P5EB 4OCMC 2X4QA 3WFHA 4DVRH 5CCKH 1MPAL 4P2RE 3QXTA 5KVEH 3OKKA 3MGAA 1MFBL 2YRLA 4DVBB 5GGSA 5FV1L 4M6AA 4DZBA 4OCSL 2J3SA 4NUGH 1UM6H 3RPKA 5FHAH 5IT2H 1FIGL 3JTTB 1CS6A 2V7NB 1Z6JT 4OZHE 3OV6A 1UB5A 3PWJA 1LK3H 4WCYL 4Z7VB 3ZE1E 1TTGA 4PUBL 4TPRH 4U7KA 2OL3L 3HNSH 4X6EB 1YQVH 2EXWD 2DLHA 5E8EB 4K3DL 2P47B 3V5DB 1YPZA 2ED9A 3NZ8B 1AE6H 5C2BL 1M05A 4PP1D 4URTB 4DGIH 4NRYB 1GGBH 1QLEH 4U0RC 3H7BA 4JPKL 4Q9RH 1RZJC 1ZGLA 5CFHA 3VFSA 1NGWA 1QFWI 2FL5A 4IMKC 3KPQB 3G08B 4NNXB 5CINL 5DEGA 4ZS6D 2NY0B 1T5XB 2EC8A 4JKMA 1CF8H 1P84K 4PRDA 3Q5OA 4DEPB 4YDVA 3N9GH 1AQKH 1CDCA 5FA4A 2QADC 3P40A 3GMPB 4DAGH 2IEPA 1TJHH 5EIVA 1T7XA 3RDTB 2EYRA 3WFDL 1RZJL 2ERJC 4NPYB 2H1PH 2R1WB 3CFBA 3OR6B 1G9NC 5CGYD 5K9JH 5DVMA 2VWEC 1OTUC 4W4OC 3LPGA 3U4EB 4ISVA 2FHCA 4WEMB 1AFVL 2EEDA 4TN9A 3D85B 2VDOH 1CU4H 1XR8A 4Z7VF 1C5DB 1P1ZB 3DMMA 1R24A 2LU3A 5E8DH 4YXHH 2FD6L 2Q86B 4TRPH 5JQHC 1CDGA 4FQXB 1QVOA 4EI6A 1G9NL 1J8HA 1IM9A 4JO3H 3PGFL 3IF1A 3LKSA 4KUCF 4Y2DB 5GRUH 3HC4L 5JW4Q 1CFQA 5ISZB 3QQ9C 3HR5A 4U1KA 3QUXA 3IRPX 1EO8H 1DR9A 4ZNCD 4WUUE 3KJ6L 4OQTH 3MRQA 3VGEA 4TTGA 3V0VA 3DI3B 5I1IH 3LRGA 4Y16C 2NZ9D 4HD9A 3K80A 4NO0A 2A6IB 32C2A 2DD8H 1FLTX 2J8UA 4P5MA 1A7RL 4BZ2L 3SDAA 3MBEC 4KVNH 2UV3A 1AGFA 1S9XB 4QYOB 1TETL 4YDLC 3LKQA 2HT4D 3HE6B 1LEKA 3QYCA 1IGML 1H8OA 1MRFH 4U1JA 4X7DC 2WLYA 1T0PB 3B3IA 3RAJH 3TBVB 4F15B 2QSVA 4LLYA 5D2NE 2AXHA 1I3RB 2DJ4A 5EUKB 1NAKH 1D9KA 1C1EH 3QH3A 5FYJH 4FQPA 4YHKH 4JFQA 3QULB 1T1WB 2H6PA 4LMQI 5EOQL 3JVGA 4JDZB 4OLEA 3JTSB 5F71A 3MA7B 2NX5D 1RZ7H 3V6BR 1JYNA 3ZE0F 4HCRL 5B3JF 4LHUG 4JY4A 5MENE 3TYFA 4LU5H 1T4KA 3SGJC 2AGJH 2R0KH 1N4XL 2WW8A 1AJ7L 1KB5A 2Q8AL 1A9BB 2APFA 5DD0H 1CT8B 2Y9RT 4KRMB 4U7SA 1A6ZA 4FP8H 2YPVH 4DOHE 1E0OB 5C1MB 2Z93B 1T83C 1YEFL 3ROOB 4XCEA 4F7TB 1UCBL 5EC2A 1LO4H 4FN0A 1CFTA 4WI5A 4I8DA 4RZCA 1X5YA 2BCKA 3S37X 3AM8C 3VFUB 5ACZA 3RTQC 5IB2B 1R3HA 4IHOB 2XZQL 3N0PB 3GDBA 2P7TB 3STZA 1F58L 4R2GD 2LU7A 1AGCB 1XGRB 3DRTA 4P57A 1ZLUK 4OF6A 1AXTL 2EDRA 3EZ8A 3HRZA 3UTSB 4KK8C 3VWJC 1CXIA 5DQDL 5D1XC 3B5GA 2ZSWA 3SKOA 2YWYA 4ETYA 1WITA 1UZ6F 4EDWL 4PIRF 5DZNA 1MWAB 1RUAH 3GMQA 1NGZB 2Z0BA 3AB0C 4AH2B 1KLUB 3MLXH 3AS0A 4P2OA 5T3ZD 1RU9H 3D48R 3KJ4B 3GB7A 4PJBE 2HFFB 5JO5B 3DWTA 2I9TA 5KG9B 4QXGL 4G6JH 4XI5D 4U1NA 3MO1A 4QXUH 4DKFL 4GAJL 4U6HB 1MHPL 4UT9H 3MRDA 2KDGA 1GZQB 1W72B 4JN1L 1OAKH 4HJ0C 1S9WB 2CLZB 3L9RB 5AWNL 4J3OC 2ZOKB 1OGAA 3O3EA 2FBJH 4P9HC 1MCEA 1J18A 3KPNB 3KLHC 2VABA 1K8IA 2BK8A 4QXWA 2BVQB 1CR9L 3KYKL 3C5SB 1TNMA 3DUSB 2E3VA 4V1DB 4UQ3B 3SE3A 3SGEI 4DQOL 4EI5A 3L3KA 2OJEA 4G7VH 4N90D 3GJFK 4MAYA 3ARDA 4AL8L 3D69A 2BVUA 4S2SA 1U42A 5KSBE 2QQQA 4XWOD 4NCC1 2DQTL 3WIFA 4JM2A 1T0MB 2XIDA 1C16A 4WO4C 1ADQA 3TH3T 5HYJD 4EBQL 4NQXA 2J6EL 2X05A 5EU6D 5D5MB 1JNHA 5E5RB 1K3IA 5LBSH 4FMFA 2AEQH 1MJ8L 4O58H 4GRLA 1U93A 2YR3A 3TZVC 4JG1H 5I1EH 4NQEB 1JGLH 1JPST 2KZ1B 1X5XA 2P8MA 3UTZB 3V6OA 1GGIH 2VQ1B 3T0EA 4QHUA 3NFSL 4M6ML 3O9WD 4GBXA 1KIPA 1LD9A 4UAOC 1I3UA 2GK0A 3R1GH 4X83A 4AEHH 4WV1B 1YZZA 4M6OH 5DD6A 4TSAL 5TE4H 2GTZA 4XAKD 4Z8FH 2NXYD 2IC2A 4ONFH 1MVUB 4CVWA 4RRPG 5F89A 1LEIA 4BUHA 5DMGC 2J88H 1CIUA 4R8WL 1E6JH 4UV7L 4B7LA 4XMLL 4NRZB 2VE6B 4LPCA 3G04B 1B0RB 3QNYB 1NEZB 4BQ8A 4WJ5A 2E6PA 4KC3B 2VLRB 5D5MF 1CVSC 2DMBA 2CK0L 4PJ9A 3GSRA 5J8OA 2BMKA 3I50L 4DN4L 1LO2L 2F5BL 1P9MA 5AZEL 1S7VA 3WIIL 1KIUA 1NCBL 3I02B 5C70A 4PJ5D 1ED3B 5B3NA 1P4LB 1SM3H 3MV9B 3ARFA 5D9SB 5KSAA 5DEFA 5FO9A 3U9PH 3RI5K 4L5FH 3E2HC 3PWNA 1N0XH 1XZ0A 3IS1X 1HNFA 4M93B 2DBLH 3T2QA 4R7DA 4S11A 3CVIL 3ZTJH 2LE9A 4ZG1A 5E24E 5ACLA 1II4E 2VDKH 4YHZL 5B21A 5GJSL 1G7LB 5GIRA 2HTLD 7FABH 2ENYA 3BPLB 12E8H 2VDQL 3BKCL 4NFDA 3LOWA 1CGWA 4FQJL 1DBML 4KZDH 3WXWH 4HIXH 4JZJA 1AC0A 4G8IA 1U3ZA 2Z4QB 2WBJD 1Q72H 2VN7A 1L6XA 5D6DA 3SKNA 3ARBD 1WAAA 4JGUA 3WLBB 1TQCB 1CD1A 1PKOA 4ZD3L 1WBYB 3WN5B 4HIIB 1MWAH 2UZIL 3NCCB 4LSSH 4XBPB 3CSYB 1ZT4A 3LV3B 2FGWL 4J4PA 5DZOA 4GG6E 1L0YA 3B4NA 1F6FB 3WE6A 4UOW0 1L9NA 4N8CH 3HMXH 3X3GL 5JUEL 4MWFB 4MNGB 1N6QH 2VAAA 5C0GA 1NGYA 1OAUH 3BGMB 5E8NA 5INDB 4ZO6A 1ZHKA 2KZWA 1ORSA 1ZTXH 5E7BA 5I66B 1SBBA 4J1UA 3MOQA 3EHBC 5AUMB 5HHNB 4KKCD 5FYKE 4WGWB 5C0JB 4ODUA 3H7LA 1U95B 3ZO0A 5IEHB 2ZCKH 2OTWB 2WUCL 5LGJB 1FRGH 1IGYA 2JCCE 3ME0A 4YEFA 4Z78B 4Z76A 3QEGL 3RVUD 4MD5A 3MA9H 3KNBA 3TA3C 4ELKB 2XY1A 1J05A 2P43B 1JCKA 2JE8A 3DYPA 3Q2CA 4LSDA 5HPMB 1JZ3A 5MI0B 2WWMC 1FFNA 3WHE0 5JW3L 1HKLH 4ODXB 2EZ0C 4IMLA 3VXQB 4EN3A 1MFAH 2X2YA 3NA9L 4YDJA 1LNUB 1B3JA 3BPCB 4WW2A 3U2SB 1F45A 5DFTA 4HZLA 1JZ8A 1OGTA 1HZHL 3G6JB 4PJIE 4G8GD 1X44A 3HMWH 1QBML 5C0DA 5MEQA 3L3IB 4O4YL 1T5WA 4P3DB 5E08L 2P42B 2P8LB 1OD9A 1IAOA 2QLVB 4O5LL 1KXVC 3K1KC 3QIUC 4RQQA 5L2KB 1WCBA 1S5HA 2CXKA 1EHNA 3TBTB 1M7IA 3D25A 1XIWB 4N0UE 3GMRA 3DRQB 3QBTB 3HB3D 5DRWB 4LCIH 5JQ6L 3QEQA 4OKVA 3CDGA 1ODAA 4QF1B 3WO4B 4TUOB 4CW1B 3DUHA 2WIMA 1RZ8B 2QSQA 3E6FA 1JYWA 4LAJH 1QR1B 2FX8L 5C09B 1J0KA 4UDTA 4HUWA 5IV2B 4HIEA 5I1JH 3DV6A 5BRZE 3KPOA 3QIWA 3UTTD 3EJYD 2A0LD 4XCCL 4UTAL 1UEMA 2D0HA 5GHWH 3G6JF 2HH0L 2X9XA 4KJQC 1FCCA 4J3TA 4U6VH 1BJ8A 4KI1A 2DQDH 3UJJH 5EZIL 2BFVH 5E8PA 5I30H 1G6RA 4LDLB 4G5ZL 2E9BA 5BCAA 4WFFE 2NY1D 5EIIA 3DX6B 4LLWB 4OFKA 3RP1A 4PJFA 5FYKL 4YK4C 1FNHA 3SDYH 1T2QH 3CX5J 3LB6C 3NFNB 5I18L 3I6GA 1Z9OA 2G2RA 1IFHL 2BHYA 1A02N 3O8XC 3W9EA 1KJ3L 3VG0L 5CBEA 2VXSH 3MLSH 3KHOA 5EU3B 4MXWH 1HXMB 4BQ9A 3B8YA 3S6CA 1MOEA 2VZTA 3BQUB 2BNQD 1A1OA 4WY7L 1MQ8A 3W2DH 4HGWA 4OLZH 4KRPB 4EUPB 4JPIA 2VB5A 3FCTB 5DZLA 1ZSDA 4DCQA 1G6VK 5LJYH 4XC1H 3SOBH 2BXYA 4OCXH 1NH6A 5K9OA 3HE7D 1NFDE 2XV6B 3FQWA 1FO0A 2J2ZA 2X1PA 1SJHA 2DQGH 2ARJQ 3CLFH 5IVXA 3BN9C 3SO5A 2FRGP 1U8HB 4R6UA 1Z3GH 4OF7A 2J12B 4CVZB 3GUTA 4EKXA 2PW1A 3A6CH 3LKRB 1RD6A 4QRUA 1I3VA 1DFBH 5EO0A 3CXDL 4ZXBC 2GCYA 1BFTA 5JA8B 1X3DA 4Y5XA 4RAVA 2R1YA 1PJ9A 3KDMB 5J6HB 2DQHH 2YRPA 3QP3A 1CG9A 3RWFA 1U8OA 4F9PA 1IGCL 1F4HA 5F9JA 5HGAA 3NCFB 1X5LA 3HI1B 5EU6B 1JRHL 4X4MA 1ZLVH 3SDXB 1MCKA 2VIRA 2WINA 3MMEA 4ZMAT 4HG4K 2BP3A 1R5WA 4FXKA 2BVOB 5I75C 2IFGA 4M1DH 2BRQA 4B53A 2AV7A 4XP5L 1A4JA 5T5NF 3BP7B 4LOUC 4UILH 5B22A 1E4XH 1N59B 2P8PB 3F58H 3CPLA 5I9QC 5FO8B 1BHGA 1PG7H 2EDHA 4DVRL 5CCKL 4X6FA 5GZND 5IIEA 2IANA 5KVEL 2ICCA 1AD0A 3MTRA 4YHOH 1CFSB 2GSGA 1DN2A 5J0BA 1HWHB 1UM6L 2FYYB 4NUGL 5FHAL 3SCMD 1KN2H 4PY8I 5IT2L 4POYA 4X7EC 5IHZB 1D5MB 2FBOJ 2VRAA 2Z8VC 2CIIB 4NQTA 2NXYB 3HNTH 5GZOC 4XPBH 1LK3L 3WXVH 4TPRL 4OZIA 3DXAE 2IH3A 4WNQA 3FB8B 5AYQA 3HNSL 1YQVL 5F9OH 3PWPA 1DN0A 2Y5TB 2X5PA 1IGTB 3RL2B 3CH1B 1AE6L 2VERN 4Z7UA 2DLGA 3RY5A 2YPLD 5J1AB 4DGIL 1GGBL 1QLEL 2F74B 3SDXF 3T77A 4Q9RL 3EGSB 1MJJA 4MCYB 1S8DB 4LKCA 4S1QH 5E95B 2AXJA 4EIGB 2F53D 3QUZD 4KJWC 1HN1A 3QR2A 4LLDB 1UENA 3I75A 4LLUA 4PJ5B 4Q0XH 1CF8L 4PRIE 5HYSG 4LLQA 1BEYH 4DKEL 5BJTB 3CIQA 3N9GL 1FAIH 3TCLA 1AQKL 3PNWA 4JY6A 1WTGT 5IW6A 4ZSOA 3EO0A 1TJHL 3X11A 4DAGL 1CICD 4EOWH 5K9QI 2PYEE 3PXJA 2H1PL 1BLNA 1KTLB 1RSFA 4PGBB 3NBNA 1YN7A 5DHVA 4IBLT 5K9JL 3SKJH 2P5EE 4BSJA 5HI5C 1NGXA 2VDOL 1F8TH 4X4YA 1N7MH 1CU4L 2HMID 2OQJA 5IFJB 2I60H 4F7PB 5SWSA 2XG4A 4LQ1A 1NLDH 5E8DL 4YXHL 4TRPL 4JO3L 2C3WA 4P2OD 3KPLB 2DQUH 5C86A 3AC0A 5GRUL 4JFDB 5DUPH 4Z7VE 3MXVH 1BOYA 1EO8L 4J3XA 5J06A 3QO0B 4UQ2B 4OQTL 4NKMA 4APQA 1BD2A 3HTLX 4LPUA 3OR7A 5GGQH 5I1IL 1T6WA 3WD5H 4PJ8C 2R2EB 3NIFF 2IBBA 2DQIL 3WNOA 4EUPH 3ARGA 1EGJA 3ARSA 4RNRA 4MNHA 4Y4FC 3ZTJG 2FECL 2XTJD 2UVEA 3JZ7A 3MFFB 4ZAKD 4PRBA 3WNLA 2NPLX 3BUTA 4KVNL 4R4BB 3LQZB 5KSUA 2Q7YA 4HHAA 5BVJB 4M7LT 2WSKA 4IRSC 1PX3A 1MRFL 3UTOA 3GMMB 3RAJL 2HG5B 1VHPA 4MAYD 4F9LA 4PP2B 1OCWH 1OTSD 2WQ8A 1DQQB 1NAKL 5DC9B 1XF5B 1T1XA 2NY6C 1C1EL 4JGMA 5FYJL 4YHKL 2X4RB 2ZG1A 4WHTB 4J3WA 4O51A 3IDNA 5L6YH 2L7UA 4QRTB 1RZ7L 3AY4A 3MCKA 3UZQA 3L6FA 1QNZH 4X99B 4B5EA 4LU5L 1YEEH 3SHSA 1YECH 2R0KL 2C7UB 4X9HA 1KUMA 3W81A 2EIEA 5GGTA 1I3GH 1A1NA 5ISZE 1EHLH 1JWUA 5DD0L 3BRFA 2YPVL 1TZHA 3ZE0E 4ZO8A 3TPUA 5B3JE 3BD4A 4MX7A 5ACMA 1LO4L 1M71A 3K0WA 1FG2B 4YFLF 2AJZA 3OJDB 5SX5K 3ZLQC 1PW3A 4J8RA 4N5EC 3C6LA 1AGEA 3H0TB 4UBDD 3FO9B 4P99A 5B39G 4X4XA 4X9BA 3PWLB 2IFFH 3AROA 5ITFA 2J7LA 1RHFA 3IXTA 1T7VA 2HN7A 3IGAA 3OKLB 5D7LD 3CFDB 5F6HI 5D6CB 1A7NH 1U0QA 2VQUA 1RUAL 4HMEA 1F3JA 4WIQA 4LFHG 4I13B 4ODWB 3MLXL 1G7IA 3L1OH 4AEIH 1RU9L 3DX7A 4LKXB 4N0CC 3D3VB 4L4VD 2PXYD 2NY0C 3BISA 3HHRB 1NDMA 2F58H 4IEFB 3U30B 1MCPH 1FVDA 4G6JL 4DEPC 3GFUA 5E1AA 4QXUL 5CZVH 5DLMH 1J88A 4UT9L 3NCJH 3B2VH 3RDTC 2E7MA 1OAKL 5KSAD 2GTWB 5E4EB 2FBJL 3LKNB 5LAXA 4HXAH 3WDHA 1UADC 4PRNA 5TGBB 3OKDB 4EXKA 4UDUA 5CP7A 4CU7A 1I1AA 2APVA 4GMTH 3B5HA 1BOGB 2IBGA 4TTDD 4L3EA 4G7VL 2H2PC 3VG9C 2W0LA 2W91A 4ZFGH 2P4AB 5KZCD 3SBWA 4Y2DC 4Y5YB 4AIXA 3QUYA 2WK2A 1CI5A 4X7TA 3PHQA 3MREA 4X6DB 2BHUA 4YR6B 3WO3B 1IAIH 1K8DA 1KENH 3ZKND 3L95A 1BVLB 2DKUA 2DLEA 2BNQB 2HLAA 4IOSD 2XNAA 2ZPKH 1HSBB 2F5AH 3O3DB 3UTSE 3VFMA 2ZWLT 4XTRC 5IHBA 5JPNA 2J5LB 4J4PD 1BFOA 1J1OH 2A2QT 4XNMB 1A7QH 2AEQL 5LBSL 5DYOB 5E6YA 2OI9B 3HE7B 1HHGA 3REVA 3UBXA 4JG1L 5I1EL 5C92A 1JGLL 3QDJA 4P49A 4JHBA 1GGIL 2OLDA 3HE6C 3UPAA 4KXZI 3W0WA 3W5MA 2WMPA 1U8KB 4NSKB 2V2XB 5HHMD 2OS7A 4PRHA 4Z0BH 3KXFD 3K7UA 2QQKH 5D7JA 3R1GL 4AEHL 4IDJH 3P9MB 1GZPA 3KPRE 4MD4B 3IJSB 4M6OL 1H3WM 2FEDC 5TE4L 4N1HB 4R4FH 4Z8FL 3VU2A 4M6NH 3KLAB 4ONFL 4JR9H 1HYRC 4X6DF 2XKNB 4X80H 5AD0A 4LRIC 4PJDB 2OL3A 3AMKA 5H37G 3QDGA 3ZKXB 2J88L 2YWZA 4EN3D 1E6JL 2RAMA 3EYUH 3O6FD 4K3GA 4MSWA 4E5XA 4ZPTB 1BZ9A 5EBWB 4QHMA 4H0IA 1NDGA 4F8TA 3Q1SL 4GO6B 1ES0A 2YZ1A 4AQ1B 4B50A 4L8CA 2IPKA 4U1LB 5ICYA 4D0CA 2FWOB 3B6SB 4QEGA 3FOLA 2XZAH 4UB0H 2JELH 1OP5K 1ZA3A 1YYMH 3GIZH 1MY7A 1QLRB 1SM3L 5D5ME 3MRLB 3HLAB 3VXRB 1L0XA 3U9PL 1IGJA 5HD8D 4PLJD 4L5FL 4WWKB 1N0XL 1JPFB 3F12A 2DBLL 3GJEA 5DO2D 1I7TA 1NMAH 4JRYD 4G8EA 4NQEE 4IMKA 3IXAA 2H3NA 3MROB 3QAZB 2VDKL 3VDBA 1FQ9C 4MXVE 3U36A 4QTIH 7FABL 4HEME 5DMIH 4MS8C 2CJUL 4PJDF 1N8ZA 4KZDL 3WXWL 5JPMB 4PJAA 3G5ZB 1TZGH 4KK9C 1O5DT 4FFWD 7CGTA 1Q72L 2YPLB 1PKQB 1HINH 4H26B 5H2BB 3VXTA 1PGRB 1MWAL 4MA3B 3DLQR 4LSSL 2QKIB 3S35H 1QSFB 3MV01 5J1TC 2F53B 1T0NB 3QUZB 1CFBA 4HJGB 4L4JA 2X1OA 5IFAH 1TJGH 1B4RA 4N8CL 1XF4B 3HMXL 5DI8B 2VLRE 1LO5B 4JO1H 4P2RA 2DOCA 5C07D 1CICB 1VESA 3DX9B 5GRYA 3VJ6B 1N6QL 1HOCA 1QFPA 5GGSY 3LH2H 1OAUL 4P5TD 1U8MB 1GIGH 2O26U 1ZTXL 5B38G 2JIXB 5F7DA 4KDWA 4NYLA 3G5XB 3D2UB 3EYFA 4Y16A 2AAVA 1CBVH 5ETUA 4KGJA 4OZHA 5SWQB 3KG5A 1QLFB 2VO5A 2ZCKL 3MRHB 1FRGL 5E6ZA 2EYSB 1P7QB 1FV1B 3MA9L 1CD0A 1EERB 4HWZB 3MBEA 1TZIA 8FABB 3QHZL 3ARWA 4MA1B 4UIMA 3BZ4B 2W9DL 3IYLW 5J57B 1TTUA 1HKLL 5F3BB 3SQBA 4X0KA 1MFAL 4HCRA 5ESVA 5DK2A 2V6HA 5E2UH 1ZANH 2A74A 1VACB 2GUOA 1Z0NA 1AQDB 1MCJA 4MJ6B 1AIFB 3EFFA 1Q9KA 3UTQA 4QXTB 5C0EA 3HMWL 1WFUA 3V95A 2QL1A 3L5WB 5BZDB 1U2CA 1UFUA 4AM0B 3WIHH 4ZAKB 5I2IB 2MCPH 4ZUSB 3BDXA 4WV1C 3QDMD 4L3CB 4NO3A 4B41A 1OSZA 3X3FH 3QFDB 3X14B 3DO7A 4N1CA 3W82A 1YYLH 3EYVA 1P69B 2CKBB 3SGJA 3RU8H 4HT1H 2HFEA 3FB5A 3F65A 3CFJB 3BUYA 2R9HD 4P5KA 3GIVA 1G9EA 2HKHH 1T83A 4R96A 3QUMB 4LCIL 4WI8A 1U8PA 5D93B 2AJVH 1UEYA 3N1QC 3AM8A 1G7PA 3BW9A 3RTQA 5DD1H 1INQB 3RWHA 2X70A 1D7FA 4WUUA 3D18B 3RHWK 5I1JL 4KROC 4N8VA 1L7TH 4HLZH 3O4OC 3CC5A 4KHTH 1ZVSB 3P4OB 3IDMA 5T5NG 5GHWL 3HUJB 3BZEB 4OUUA 1BQHB 5IB3B 2LABA 1U8LB 4U6VL 4XP1H 3IU3A 2IAND 2DQDL 3UJJL 1S9YB 4RWHA 4M93C 2YA1A 4HS6B 5C0ND 1RZKH 1FLRH 4P2QD 5I30L 4JKWA 2FIKA 4YFLI 5HHQB 2AJSH 3IJHA 4P3WA 5E2WH 4NBYB 3GKZA 3B83A 4ESKA 4JREB 1MI5B 1BJ1J 3CVHB 3BVNB 1IKNC 2ATKA 3BPLC 4Y4KB 1OT2A 4H0GA 1W0WA 1BIIB 3VMNA 4HH9B 2EXWC 5D2NA 3SDYL 1T2QL 5ESQB 2ADIB 5IF0B 4PTUB 4HIHA 4NKDB 5I16B 5L2KE 2HA1A 4JRWA 3FONB 5IR1B 4PP1C 1TQCC 2VXSL 5F7FA 3MLSL 3BN3B 4MXWL 3QXDA 4QKXB 4ODTH 5D7KD 5LVEA 1IAIM 4N9GA 3TJHD 3W2DL 2I27N 3QT2A 4OLZL 2PXYB 4UTBH 2E7BA 4ZS6C 2DICA 4RMUA 3LPWA 1CTNA 1TCRB 4QHLB 5MENA 5F9DC 5FGBC 3BXNB 3SPVA 1GGTA 2J6EA 2HFGH 3HUJF 4XC1L 4ZTPH 4LSRH 3O81A 1PZ5A 4JHZA 4OCXL 1NC2D 2KPNA 3C8DA 5HJ3B 1KXTB 1GC1H 5CGYC 3QI9D 1BBJB 3LDBB 5GS2H 5I76A 4ZOEA 2DQGL 3U79A 4RIRA 3CLFL 3DVGA 3TESA 3ZKMC 1IT9H 1I1CA 1QBAA 5DTFB 1Z3GL 3RL1A 4HSQA 2DM2A 4GKNB 4QOKD 5EBMB 4GKOA 2OK0H 1T7WA 1LHZA 5HHXH 5HI3C 3A6CL 4G80B 3TZVA 5SWSD 1WICA 1X5HA 4P2YA 5KZCB 1DFBL 4Q74A 4I5BA 5MI0C 4HK0B 4D8PB 4ZYKB 2RCSH 3VXOB 4X5XB 3VI4F 1ONQB 3KWWB 4CGTA 1ZVHA 3KYOB 1ZHNA 2DQHL 1YEGH 2CIKB 2RBLA 2Q76B 4WW1B 4G9FD 3BHBB 4PJBA 2NZ9C 1BD2D 2ZJSH 4ZUWB 1X4YA 5FCUH 1KG0B 5GRVK 4FFYH 3LN5B 3VFNA 1MNUH 3LN4B 3LSOB 1SVZA 2YBRA 5JDSA 3ROLB 3PP4H 2CDGA 3ARGD 2HVKB 5HGDB 5T3ZE 4M1DL 1KPRA 2VMFA 1RJYA 3QIBB 3WS6C 3ZDXF 4TUKH 2WBKA 3OGCB 4UILL 1E4XL 4FNLH 3F58L 3TBWA 4YHPB 1PG7L 4AENA 1I7ZA 5HHMB 1U92B 4I0PB 1WIPA 3KXFB 4YHOL 2ZZUT 1XIWC 2Y1VA 3T1FA 4EZMA 3O11B 1JYXA 3AU1B 1K2DB 1KN2L 2OX5A 2EDEA 4R90H 1SMOA 1Z9MA 4YNYA 2BSRB 3WO4C 2UUDH 2WBWB 3HNTL 3EDJA 4XPBL 3FB7B 3DI2B 3WXVL 1KIQA 1M7DB 3DIFA 1KYOJ 2CKBH 3G6AB 3P4MB 5I1GH 2W92A 4MVBD 1K3ZA 1N5AA 5F9OL 3ECBA 5KSBA 4D3CH 2IPUK 4QO1A 4N90E 4FABH 3O6FB 3HZYA 3QUMH 3HZMB 3MV11 5BS0D 5C6TH 1P5VA 3MJGX 1B6UA 2AK1H 3IVKB 1KC5L 1OSPH 4NO2B 5JORB 4WHYG 2JB6B 3WDJA 3EBAA 2AS5M 1GHFH 3WJLC 4S1QL 5D96B 3DSFH 1HI6B 1NSNH 4YIQB 4EDXB 4Q0XL 3HPLA 4G8FB 1B6DA 1FZMB 5HYJE 2VLMD 5EU6E 3IDGA 3OKOA 1FAIL 3MQIA 3SDXE 1XF2B 3T8XA 1PG7W 1QO3A 4DFIA 4EOWL 1UYWH 1ZT7B 3C6LD 4LHUA 3ULVF 3BH9A 3STBA 3FT3B 1IRAY 1QEWB 3SKJL 4JRYB 5J9PA 5FM5O 3DX8B 1EAPB 1PD6A 1F8TL 4LEOB 1N7ML 3BD5A 3DUUB 3PABA 2ADGB 2I60L 3VRJA 3BP6B 4OCNC 1NLDL 3VXUD 5A16A 1OLLA 4PPTA 1U58B 4K94H 2W9LA 5DJCB 3VH8G 3BE1H 4OD1H 1KTDA 2DQUL 4XAKE 1A3QA 4XI5C 2GQHA 5DUPL 1NUNB 2DTMH 3MXVL 3WJJC 4LCCB 1CFNA 3MRRA 2Q6WB 5JMOC 2OP4H 1G7JA 5GGQL 4W70A 5KS9B 2R0LH 3WD5L 1T04B 3O41B 3TA3A 4ELME 3MNWB 4YXLH 4KK5D 3LN9A 1NUGA 5FFLA 5EUOB 5T1KD 1DDHA 1HE7A 5DJAA 1RZGB 2RJMA 2PTTA 3BRGC 1YY8B 4AG4H 5INCB 5DJ2A 4JFYA 2VISB 3BRDA 3NIFE 4Z7WB 3D9AH 4PJ5E 1MCDA 1XGYH 1AC6A 3EZJB 3NVQA 1FGNH 2UYLA 2V9QA 3U7AA 1SJEA 1OCWL 3G5VA 2GY5A 4PY7A 2AKRA 3P73B 1UH2A 4JDVA 4XWOC 4EJ1C 2XQYG 2OSLA 1T3FA 3NOIA 3WNKA 2P24A 3SDCD 3V4UH 1DUYA 4HGKC 3UJTH 4POZC 4O2EB 1DSFL 1OAXH 2QQLH 1FZOB 3TGXA 5CIPB 1FZJB 4GRWH 4JQVC 5L6YL 4X8XA 1NCWH 2NY3B 1KJ2B 1QG3A 4CN1A 3KLSA 1I7UA 3BJLA 4JFZH 4WEBH 2ZUSA 3FO2A 2A83B 4RWYH 5KS9F 1YEEL 2PTUA 3GGWB 1YECL 3DROB 2F8OA 4GG6A 3O9WC 1I3GL 4YHIB 3QDJD 1EHLL 5EUOF 1F42A 3NAAH 3W0WD 5E5MB 2Z8SA 3DVIA 2RIKA 5AAWA 4KI5D 4PJEB 3QDMB 4DGVH 1T1YB 4P0DA 4IRZH 3V52H 1BREA 5D7JD 4Z7WF 2NXYC 2MCG1 1MLBB 1JP5A 4HW6A 1C12A 2V5SA 5FGCE 2GKIA 1ZS8A 2NTFA 1VKXB 1J5OH 2QBWA 3B5TA 1NUFA 2HWZH 3ULVH 2JCCA 4HLJA 2IFFL 5HVFB 2FR4B 1A7NL 3RQ3A 2FJFA 1U8IB 3GHBH 4PG2C 3GSOB 1JMZA 3GBMH 3L1OL 4AEIL 3BIKB 1Q0XH 4UNTA 4JFXB 3OX8A 3VDAA 2F58L 4I48B 1LP9B 1MCPL 1WZ1H 5K33A 2ZUWA 4XNZB 4RRPA 3O8XA 4HWNA 5CZVL 3I6LD 4PJIA 5CBAA 3P9LA 5I8EA 3NCJL 3B2VL 3SJVB 4MQTB 3H8NA 2EIZA 4LF3A 3DYOA 4PJEF 4U1MA 4CU6A 2ARJA 5IKCA 2DMCA 5IG7A 2VAJA 2NR6D 5H8DA 4HXAL 4G8GE 2LVCA 2IBZX 2HTLC 3N50A 3FAWA 4C57C 2BVYA 4GMTL 3SY0B 2E8YA 4YHNA 5DRNA 5JNYB 1VERA 4N0UA 1FNSH 3CDCA 3EDFA 2HVJA 1JZ2A 5BMFH 4ZFGL 1CLZH 2X09A 5E4IA 3S96B 2Y07H 2WBJC 5IW3A 2NY7H 1UG9A 4FOMA 4HLZG 2JK5B 3ARBC 3EDEA 5JIHA 5KAQF 3TPKA 2R2CA 3WUWA 1UZ8A 1FORH 1IAIL 4OTXH 1KENL 1HK6A 2ZPKL 1KELH 2F5AL 1T1ZA 1VGKB 1V3LA 4ZUUB 2FCBA 4BELD 5BRZA 2DTSA 1J12A 1LP9F 1I8IA 1EA9C 2OMBA 4MJ2A 4TVSa 4TNWK 2O5YH 3OXSB 1J1OL 1YN6B 1IQDB 5TH2A 4U1IA 1A7QL 2DS4A 4ZXBA 2DM4A 2ZG3A 1NC2B 1JPGA 3ES6B 4HFWA 3LVEA 2W07A 3QQ9D 2GJ6B 4PFEA 3S4SB 3UTTE 2MNUA 1N26A 2V9TA 1WZKA 5CP3H 1GGCH 4X98B 4KKCC 4Z0BL 4JANA 4JJ5B 4HBQA 5ESAB 43C9B 4QOKB 1HXYA 2ARWA 2JJSC 4Y16D 3BKYH 4NQSA 3RVUC 4LLVB 5I15H 2E5EA 4IDJL 4FA8A 3ARRA 1DQJB 1W0VB 5KJRH 3SGKC 4JFPB 3NIGF 4R4FL 4BKLA 4PGEA 4M6NL 3PG2A 4JR9L 2MQ0A 1MH5B 4Q9QH 3BGFC 3OXRB 1NCDH 1FC2D 1AR2A 1QYGH 2ZOLB 5IJVA 1LDSA 3EYUL 4G9FB 3TN0B 1L7IH 3FRUA 4KWUA 4U2YA 5CSZB 4F3FB 1NBZA 2X89D 4NZTH 4N8PA 2HJLA 1AR1D 2XWTA 5CJQH 4Q2ZB 1QKZH 4X6DE 5CIPH 2RHEA 1ND0A 5EO9B 3U46B 5DS8A 5JTWA 2BNQE 1FL6B 1NFDA 1KJ2H 4RGND 3QQ3A 2XZAL 1F97A 5JOFA 3MGOA 5CSBA 1L4IA 1YYML 3GIZL 5K9KA 2MQCA 4E42A 1NGPH 3CDYA 3RGVB 4NHUB 3REWA 1T21A 1AO7B 4XNQB 3HB3C 1NMAL 4C83B 4BM7A 3L3OB 5H94B 2EC9U 1E27A 3BP4B 4A2MA 2X1XR 3MRJB 4YJZL 1BF8A 1XH3B 3BEVB 4DTGH 1VFAB 3STLA 2Q3ZA 1JK8A 5DMIL 1XCTB 3PQYB 4JQIH 2DF3A 3VFWB 3A0OA 3VFOB 3EJYC 2A0LC 5BS0B 1TZGL 1UXWB 4WTZA 3U30C 4PYGA 4OFYD 2VXVH 3ILPA 1HINL 2PYFB 3TT1H 4KK8D 3W39A 5EZLA 2OR9L 4XBEH 5B8CB 4X4ZA 3S35L 4PJDE 1H5BB 2FLBT 4OQTA 3MLPA 1S7QA 5E4EC 3QFJB 3D0LA 3WS3A 3VRIB 2NY1C 5IFAL 1TJGL 2D31A 2JJVA 3GSNB 5I19H 2I9LA 4JO1L 4U1SB 5D2LB 4I4WB 2YEZB 2DWDB 3P30H 2B20A 4JHAH 1A6TB 2FJHA 3MGTB 2CDFA 3LH2L 3TVMD 2OYPA 1GIGL 3FO1A 4Y5YC 4FTVD 5GQBA 1P4IH 3HAEB 4KHXH 4PJ8A 1CBVL 4HKZB 4HJ0D 3VGAB 4HV8A 4Y4FA 5EC1A 1TTFA 1RIHH 3ZKSD 2VOTA 3DXAA 4PGCB 5SX5H 4ORGB 1BP3B 2ID5A 3VXUB 3FT4A 4U1HB 1MHCA 2FLRT 3DVNA 5D1ZB 5IB5A 4XRCB 2I07A 2J5LC 4G42A 3RWJB 2ICWB 1NBYA 2J8HA 4H25A 4IRSA 1F2XK 4M4RA 1G9MH 2CLVB 3HE7C 3P4NA 1OPGH 1ZANL 1NCTA 3ZYJA 4PJHB 3QWRA 5HDOA 2DQEH 1G7HA 2K9UA 5FKAA 1V7MH 3U0PB 2YPLE 5CHNB 4PRIA 1PKQE 3U6RA 5T1KB 4Z0XA 3TIEA 3MC0A 4LDEB 5D2LF 3MJ7A 2V2WA 1EEYA 3WIHL 4UUJA 2MCPL 2F53E 2PYEA 1PBYA 1HH6B 3X3FL 1DUZA 3FT2A 3NTCH 3VD9A 5ICZB 2P5EA 2BY3A 3UPCA 1YYLL 5IOPA 4X5WB 2NXZB 4L8BB 4R26L 4WDIB 3RU8L 3MZTA 4HT1L 4B7IA 3ZHLA 3QXWA 5F1KC 2APWA 3ZKXC 2HKHL 2IG2H 3SDCB 3L3JB 5TE6H 5E2VL 1MCSA 3NFPB 3JTTA 4HBCH 2V7NA 2AJVL 1X5ZA 1CGXA 4Z7VA 1D5IH 4GSDL 3GSWB 5DD1L 4KJYB 2D7TH 3V7MA 2ED7A 2QTEA 4X6EA 3MLRH 1R3KB 2OR8A 1L7TL 4OF8A 3MYJB 5E8EA 4PJHF 4KHTL 3V5DA 5GZNC 4HX1B 3MV8D 3OHXB 3NZ8A 4NWUH 1TMCB 5L8JB 1DANU 5C7XH 4XP1L 4CJ0A 4XB8A 3SDDD 4MAUL 1DEDA 5GGVY 3SCMC 1RZKL 4PREB 1FLRL 3KPQA 3G08A 2AJSL 2PUQT 4NNXA 4JO2L 5E2WL 2YSSB 3RBSA 5GGRY 4PJGB 3JVGC 2OZ4H 5HHOB 2WNGA 4NZJA 3GMPA 4E0RB 1NAMB 2DB8A 2H26B 3RDTA 3VXPB 3WLWD 4NPYA 1FL3B 2R1WA 3RIAK 5H35A 1V3JA 1NMCC 4M1GH 3U4EA 5T1LD 2AJ3B 4HWEL 3F7QA 1C5DA 1P1ZA 4J7RA 1GC1C 3DBXB 1ZT1B 3QUZC 1DQLH 2AP2A 4K7PX 4L8DB 1NJ9B 4IRJD 1YEHH 2EDNA 4HK3J 2Q86A 4UTBL 1GPOH 1S7SB 4YPGB 2FJGB 2NYYD 2W60B 3ZDZF 3SQOH 4ZUTA 1YEIH 1JI1A 1HILB 3NPZB 4Y2DA 4ZTPL 3LRSB 3WCYA 3MRPB 5IQ9A 3CLEH 5ISZA 4Z77B 1CICC 3T2NH 4AIZB 3MLZH 2CRMA 3I6KB 2ITDB 4Y5VB 5CZXD 1GC1L 3P77A 5I1LB 1BZQK 1YMHB 2G75B 3RX7A 3V6FB 3PGCB 3AVEA 1K4DB 5BXFB 1IT9L 3HUJE 3RIFK 4N68A 1MIMH 2HMIC 1DZBA 2NCMA 3GSNH 4KTEH 5C9JB 5DRXA 4PJGF 3T0XA 2OK0L 1DE4B 5GRJH 2VL5A 5HHXL 3N1FC 3HC3H 4UT7H 2N56A 4XPTH 1CDIA 2SEBB 3D1MC 2Z31D 4MA1C 1NC4D 3HE6A 4GLRH 3HAEH 2RCSL 2A6JA 1ZWIB 1EXUA 2YUXA 3VFGH 3IDUA 3RRQA 3TBVA 4OD3H 3EOTH 1YEGL 1I3RA 2CUIA 1OF2B 3NABH 1GYAA 1UM5H 2ZJSL 2JF1A 1ZV5A 4PLOB 3QULA 5D7LE 5FCUL 1A6PA 5GGSB 5F7NC 3OKEB 4FFYL 1TJIH 3RWCA 3TA3D 4ZQKB 3EAKA 1MNUL 3JTSA 4JDZA 4JG0H 3VI4E 3PP4L 1SBSH 4DZBB 1RFDH 3GM8A 4ZAKC 2XTLA 3VWKD 3GZKA 1J8KA 5ERWB 4YXKL 3CX5K 3MLUH 4TUKL 4L4VE 2CRIA 4FNLL 5FCSH 5GSRB 1MFDH 3VI3F 4MAYC 3OPZH 1A9BA 1OTSC 5JXED 1EX0A 4JHWH 2EIDA 3ZDXE 5CLTA 3ROOA 4F7TA 4W6YB 4WHDA 4R90L 5FYLH 2CO6B 1D5BB 2XZZA 2J4WH 4MJ5B 5DFWH 3H7BB 4XXDB 1ZGLB 5ENWB 3VXNA 2CKBL 3VFSB 3VFUA 1NGWB 5I1GL 5IB2A 4GW5A 4QT5B 3HG1D 2P7TA 3MYZA 1AGCA 1XGRA 4D3CL 5I6XB 4FABL 1QQDA 4U6YB 3QUML 2OBGA 5C6TL 4K8RH 3UTSA 5GS3A 2Y7QB 4GRWE 5FGSA 2AK1L 4L9LB 1MWAA 1GHFL 1NGZA 3RBGA 4AH2A 2ZCHH 3DSFL 1KLUA 4Q58C 4ISVB 1NSNL 4RGNB 1AHWB 2VR9A 4TNVF 4XWGH 2HFFA 5JO5A 2VLLA 1OHQA 1XR8B 4JKPH 3QUKB 4F57H 3DMMB 3HMXA 4JREC 1EHXA 5DVNA 1SHMA 3QCUH 4UBDC 4MNQD 1OD7A 5C0AD 2VR4A 4KY1H 4U6HA 1UYWL 2VXTH 3QNXA 1IM9B 4K94C 1GZQA 1WF5A 1S9WA 2CLZA 2NY2D 3L9RA 1AY1H 4DZ8B 2ZOKA 3KPRA 5HDLA 1DTUA 1U3JA 4G43B 5FDWB 5HHME 4D94A 4G7YH 4HAFA 4M43H 3C08H 3KPNA 3KXFE 3SE9L 4I3RH 2EDDA 2BVQA 1JNNH 1F90H 3CVHL 5E2TH 5ADPH 3C5SA 1YJDH 1GGUA 2WWKO 1XF1A 4UQ3A 1NAMH 4PUBH 2DLFH 4H8WH 2PXYC 1PG7X 1Y18B 4NO0B 3BE1L 4OD1L 5SWZD 5EOCL 4L8SB 2FEEL 3WHXB 4P5MB 2DTML 4HKJB 2ZSVA 4KMLB 5B39A 3B43A 1WFOA 3KYNB 2H45A 2ZUTA 2OP4L 5E0QA 1UVQB 5TE7H 3ET9F 4LCUB 1LEKB 2R0LL 1M4KA 1QA9B 3TO4D 1T0MA 5C0FB 4YXLL 1CL7H 3HZVA 3B3IB 4XMPH 2UZYB 2I25N 3CUPB 5I8CB 1R5VB 2CRYA 5D5MA 1IARB 1D9KB 4AG4L 4TTDC 3TVMB 1HEZB 4JFQB 1U41A 4YFEA 4IOFD 1FFPA 3D9AL 5JXAL 4FTVB 2W0KA 1XGYL 4NQEA 1RPQA 4ZNEE 3ABZA 1VCAA 5C0IB 1FGNL 3UTZA 2L7JA 3O2VH 3AXLB 1ZLSH 4EVNB 4ODSH 4TUJB 3MV7D 2B4CL 2JTDA 1HSAB 3ZKNC 5KAQG 1U8NB 4R4ND 4JY4B 4YBLC 3QHFH 1ZGLP 3O45B 4BFIB 4JRYE 4WV1A 1IZKA 3U7YH 3UJTL 3ZHDA 1ZLWH 1OAXL 1A6ZB 2QQLL 5JW5A 2E8ZA 1U9KA 2LAGB 3INUH 3ARTA 1MVUA 5KVFH 5EC2B 5JDJA 2XXMB 1NCWL 2GEEA 1CFTB 4WEUD 3H9ZA 3V5HB 1QUNA 2Q20A 2M8XA 4TYUA 4JFZL 4WEBL 5T33H 2HRPH 2B2XH 4RWYL 1Y0LB 3F8UB 2H2SD 4PB0H 5ACZB 4NRZA 5F7MC 3UP1A 1R3HB 4GXUN 4C54A 2VE6A 3G04A 1B0RA 4IIQB 3NAAL 2VLRA 4WVRA 3MPCA 3GMLB 1FCGA 3OKMB 3C5JB 2QV2A 4PJCB 5CJBA 4Z95H 4DGVL 5KS9E 4IRZL 3V52L 1A7RH 3RVXD 1R5IB 4QRSB 3ZTNH