5LAXB

Crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
193
Chain Sequence
GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRASSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted alpha-Enolase T Cell Epitope in Rheumatoid Arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5laxB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5laxB01
3DROA 4WEBL 5L2JB 2IBZX 1IAMA 1H0DB 4EUPH 2A74A 1HIML 1U9KA 4ZFOB 3LKOB 3QXAB 2AV7B 2BHZA 5I1EH 2PYFB 1XF4B 3V4VL 4K55A 4J3XA 3GB7A 4NSKB 1QVOB 3OKMB 2ESVD 3ROOA 2YD7A 3OX8B 1BBJA 4NT6B 5EC2A 1E6OL 4M6OH 1LK3L 4OV6F 3MLWL 5EBWB 3MV7B 5KSAA 5GHWH 3LKPB 2R1YB 2KUTA 3HAEH 4JRYD 4WHTB 3S35H 4OLXH 4MNQD 2X1WL 3A6CL 5DQ9A 5C07E 1DBML 2HG5B 3UPRB 1KN4H 4WW2A 3VGEA 4EXKA 3BDYH 3RGVA 3LN4A 4LEOA 2CRZA 5EO1A 5C2BL 4QHMA 3EOAB 3EAKA 1FNAA 1JRHI 1ZXQA 5IR1A 5BZDA 1A14H 4QGYA 4MWFB 5B38B 1RFDL 4BJLA 5JOFA 2FL5B 1GZPA 3AB0C 4Y4HD 4YFDB 1ZOXA 4F7CB 2Q8AL 5I66B 2R0KH 4D9LH 4RA0C 1R3HB 4TNWK 5AUMB 4H26B 4K8RH 1PG7X 3LN5A 4ISVA 2K7PA 2FBJH 2YC1A 2ZP0T 4CMMB 5KVMC 3PWPB 1I1AA 2AJVH 5J13B 1M05A 3QWOA 2FX7L 4PJ7F 1IC4L 1IM9D 1C7SA 1S3KH 4R96A 4LLQA 4JFPB 1ADQL 5C9JB 1N0XL 4PRPB 2YA1A 1NUNB 5DVMA 4OF0A 5EU6B 2V2TA 5C70A 1MIEH 3DIFB 3LS4H 1NC2A 5E2UL 4AL8H 4HS3A 3QDMB 3SDDC 4PJ7B 3ULVD 4JGUA 5GGSB 5E8DL 2VXSH 2CLZA 4M3JA 1FG9C 2QSCL 1ZHLA 4KUZH 3IU3A 4ZD3H 3T2QA 5KJRH 1PW3A 4ZAKC 3VDCA 4M6ML 4WNQA 1FL3B 4CVXA 4FQPA 2ZG1A 1ROWA 5GSRB 3HUJF 1ORSA 3ULUE 3GBML 2N56A 4Y19B 4U7MA 3ZHLA 3NFNB 3V4UH 3S9DB 3BVNB 2EYRB 4Y5XC 4KROB 1OD7A 2AJSH 3K7UA 3C5ZA 1J1PH 1CICA 3HUJB 5J1TC 3PUCA 1O7SA 4QWWC 4M62L 4Z7UB 2IAND 3MLTB 4Y5VB 5KVGH 3VGAC 1IC5L 1P4BL 4CN4A 4RDQG 3ARDC 1HHHB 4UB0H 3SDCA 2YK1L 2EIBA 2C4FT 5J11B 4PTUB 1XGUB 2H26B 4HV8A 1LD9A 2BXZA 3WS3B 4YEEA 3T1FA 2IPTH 4GW5A 4NC2B 5D96B 1QFWH 4UNVA 5C0CD 2ITDA 3W39B 4GXUN 4Z0BH 3VJ6A 1FO0B 3RZWA 4XWGH 1G9MC 2NXYC 1OHQA 5SWZA 1EEYA 3LCYA 1QACA 3NZHL 2EH8H 2I9LB 2X1XR 3IETB 4U1LB 3IDMA 3UDWC 4A2LA 1SMAA 4FFWC 2QADC 5FKPB 3T65B 3FQNA 1NLBL 1DLHB 4OZHF 3PWJA 1EZVY 5D1XD 2P8LA 1MH5A 3JXAA 2HLAA 3UTQA 4AT6B 4OGZA 1WZLA 4LHUD 1B4JH 3BW9B 2HVJB 4JZOB 4AIZB 5E6IB 2FIKA 4OZHB 2ITCB 3U9PL 5GS1A 3U6RB 2P48B 1JNJA 1MAJA 2EIEA 1E4JA 5FECB 3C6LB 5D7JA 3IAGC 2D3VA 4HUXA 3QAZB 3L7FA 5CFHA 3FONB 1IGIH 3B9KA 3SQOH 2FD6H 1YN7A 3T2NL 2F5AH 5BV7C 2R23A 1MJ8H 4S2SB 5L7XL 2R56H 3I85A 3LVEA 1U3ZA 3NAAH 4IIQA 1N3NB 4O2FA 4CL7A 1N6QL 1U8HB 4CRPA 2H1PL 3N1MC 3U0WL 4P46B 4ZAKD 5SWZE 2X10A 5DR5L 4ESKA 4MDJA 4BZ1L 4PB9L 1OTTD 4YZFE 4XCFH 1UADC 3ZT7A 3VXPB 5BQ7B 2QV2A 5DFWH 5HYJA 2C3WA 2ICWJ 2JKXA 3P9MA 4C59B 3QFDA 1LE5A 1T22A 4PJ8A 2P8PA 3ZTJG 2BVOB 2J8OA 4RX4A 2BC4B 4HT1H 2X4PB 4P2OA 5DEGA 4X8XA 3VXRB 5IT2L 4J3SA 2EDRA 4TULL 4G9FD 4G8IB 4WFEE 1YZZA 1A4JA 1MCNA 3SO3C 3GHBL 2VDLL 1EVUA 1MQKH 3O8XB 4ZYKA 1P84K 1INEL 1JGLL 3DARA 1HXYB 4RRPA 1BJMA 2HKFH 2XI9A 1ZSDA 4YX2H 3BAEL 4M7KH 1FLTX 3IKCB 2B5IC 1C5BL 1GGBH 1G9NC 3CLEH 4ODUB 4OQTL 4PTTA 3QULB 5T1LD 5GQBA 4I4WA 3JWOL 1R3IH 4D0BB 1DUYB 2DMCA 4WW2F 4W68A 1YEHL 2YUVA 2XPGB 3X11B 4GAFB 1TNMA 4C57C 3AGVA 2YWZA 4Y4FA 5F1KC 5I19H 2P24B 3RZCA 2R0ZL 5HYJE 5I30L 4EJ1C 1X5XA 3PIQB 1N2RA 5DJDA 1RUKL 2X4NB 2MCPL 3JVGA 1WLHA 3AAZA 4JKMA 2J2ZA 1JNLL 1CGXA 1SBSH 2DIJA 1U3YA 1E4WL 2CMRH 2E9WA 1OAYL 5INCA 4U0RC 5HI5D 3K0WA 3VDAA 4YQXH 4ZS6C 5KS9F 3PP4H 5JW5B 3OB0H 4ODTH 1R3KB 5C0IA 1OQXA 1RK0A 3QRFM 4J1UA 5ITBL 2SEBB 1KYOK 4TUJA 1PKQA 1NDGB 1M1SA 4FFVD 5KS9B 3D69B 1I8IA 5CD5D 1MJJA 2VQ1A 4RFNC 4ZFGL 1VGEH 1X7QA 5DMKA 3VD7A 5I18L 1J8HD 1XZ0A 2CKBB 4Z6AT 5EU3A 2XWBA 3QPQD 1OAXL 1BF8A 1X5IA 1MUJA 1CK0L 3F7VA 3R8QA 5LCVL 5IVXB 2EYTB 4L1DA 1M7IB 1AIFA 1P6FA 3TYFB 1E28B 4YLQT 2FHBA 2WANA 3OB8A 5F9WB 5T3XD 3AMKA 1KJ2L 1T89C 3HNSH 3TP4A 4JPVH 4NJAH 5GRUH 4P9HH 1G7LB 1BOGB 4K94C 35C8L 1JCKA 5IBTH 1SYVB 5F9JB 4CADA 5T5FL 1DP0A 2CUIA 2FWOA 2PW2B 4P4RA 1PKQE 4WHDA 2R4SH 5F1NA 3VFWB 2HJFB 3F5WB 4CDHA 5GRJL 5CEZD 1II4E 1OW0C 1QR4A 3D0LA 3WHE1 4EQ3A 1QRKA 1HHJA 2YBRB 4P23C 4UV7H 5A2FA 3G5YB 1NMCB 3BP5B 4H1LB 3WN5B 2Y5EA 3HI5L 1QFWI 4Z7WA 3L3JA 4NQSA 4B7LA 3DRQA 1FN4A 1JFQH 4PRIB 5F7KC 1EEQA 3KLDA 3VD9A 3V2AR 2YA2A 3VE0B 3LV3A 1ZA3A 2GYSA 2NLJB 1A6WH 2QHRL 4HJGA 1D6VL 1D6EA 4YAQA 4ZUVA 4AQOA 1MRFL 2DLHA 1VENA 1WCBA 3RBGA 2I26N 2W1NA 3H9YA 2IADB 3FO1A 5I16B 3WUWB 1Q9WB 4ALAL 4KKAD 4EEEA 5GS0C 5HGAA 1RY7B 4CW1A 5JNYB 4L8CA 3RWEB 4NN5B 3RL1A 1AC6A 1BGXL 1C1EL 3O3AA 1NCCH 2HT2C 4DW2L 4PP2B 2RR3A 2NXZB 4U1MB 5SV4A 1T66C 3V52H 5HHOA 5TE4H 5EZJA 1F45A 5EOCJ 4LEXH 3VH8G 4Z7WE 3KPOA 2H8PB 3HHRB 1U8NA 1XIWD 1SJEA 4NM8L 5C6TL 3GUTB 4Z78B 1JWMA 3B8YA 5KOMC 4BQCA 4LP5A 4HS6B 2W65B 3O0RL 3TJEL 3ZKSD 1NMAH 1AD9B 4F7MB 7FABL 4TNVK 1IGCL 2Q87A 4KJYB 1OD9A 1I9JL 3GSOA 4MCZA 4S1RL 1F11B 4F37K 1U6AL 2QQNL 3EO0B 5F7UA 1IEBA 4QO1A 4HWEL 4OLWH 2C5DC 2EDYA 4JVPA 4F2MB 3VRJA 2ICEA 3BFOA 4OI8A 2BX5A 4XTRC 1R3JB 3RKDD 3VA6A 3TIEA 5EIQA 3VFTA 1CLYH 5J1AA 4C4KO 5DSCB 1LDPL 4PYHA 1RZIA 1SJVA 3PDOB 3BO8B 1P7QB 3DTXB 4HWZA 3N85L 3WFEH 4FQJH 4OGXL 5FK9A 3TPUA 2R69H 5DRWA 5HHOE 5D1XA 4PRHA 2I07B 2H45A 4LVHB 1A6VH 3AXLB 5HPMA 5JQ6H 1BHGA 4CJ0A 1HHIA 1S9YA 1P4LA 1AXTL 4TQEL 2ZUSA 4I9WD 2B4CH 2XTLA 1NEZA 3P30H 4D9RD 3GNML 5CGYC 3M07A 1QSED 3P0VH 3AM8C 4PGCA 1OAUL 4NQUA 3UJTH 1MJ7L 2AP2A 2RGSA 4KMQA 3RDTB 1U8KA 2HTKC 2XA8L 4Y16C 4Y89A 2AJUH 2XIDA 3KPSA 3CXDL 4OZGA 2F54D 4N0FB 3SDDA 1MLBB 5GZOD 2GSIA 5IMLA 4MZ3A 4ZOBA 1X5AA 1W72B 3SDAC 2AXFB 4KKLC 1S7QA 1JYVA 4GRMA 3GMOB 2CK0L 2ZSWB 2AEPL 3S36H 5DUPH 4ZAKA 3HMWH 5DURD 5D71H 1BZ7B 3STLB 5K59F 3MTRA 2AJZA 2Z93B 1FE8L 3X3FH 2LU7A 1EERB 1QBML 5E8OB 2OK0H 3GK8L 5ALBL 4RSVA 4WFFE 4PRHE 4WI3A 2OR8A 3MCG1 4IEFB 1JZ5A 1MWAH 1RJCA 4NUJA 4U6VL 5E99H 1JYNA 1MHPH 4Y5XA 4XGZB 1JMXA 4L8SC 2HFTA 5B39G 5TH2A 3UZQA 4M4PA 4OI9A 3QO0A 5D2NB 1ACYL 5BRZA 3QIUB 1D5XB 1NUGA 4ZQKA 3FB7B 1ZHNB 2R1XA 1UXSA 1NLDH 2VXVH 3VG9C 3HCVA 1I8LC 3O3DB 5TE7H 3ARDA 4NQXB 5J3HC 3GSXA 1BZQK 2F74B 5ENWA 2NY4D 4KZEH 3D2UD 3KPSE 1CFTB 4HEME 2O5XL 2O61A 3K8KA 3U4EB 2CH8A 4OZGE 1DQQB 1TCMA 2PTTA 1CGSL 2Y1VA 2Q76A 4XC1H 3RU8H 1WBYA 5L6YL 3BKYH 2ESVB 4HCRH 5EBMB 1FFQA 5IHUL 2ZOLB 3H3KA 1QG3A 1F2XK 1RZJH 3K46A 1Z9LA 3QH3B 3UBXG 3MLUL 3T0DA 3UDWA 5FDWA 4RAUB 3RTQD 1WSST 5D7IF 4JRYB 1MCLA 1AGDB 2VDNL 1E27A 1INDH 3PL6B 4MNQB 4GFTB 2EC8A 4ONOA 3X14B 1UACH 1KIRA 4XVTH 5DJ6A 5CSGA 1RZGA 3I6LD 3OKNA 4GBXC 5D7IB 3TBYB 3ARED 3O2DA 1NCAL 1ZV5A 4OUUA 1TZIB 3DETD 3RP1A 5BRZE 4NNXB 1TQBC 3LH2H 4Y4HB 2DWDA 4HIXH 3VXOA 1MY5A 1BVLB 3DO3A 1CS6A 1EVTC 2BVEA 4X7TB 2KBGA 4R26L 3UP1A 3MJ6A 1ZT4B 2WMPA 3QFJB 5ADOL 1XGTA 2COQA 1I9RL 3RVXD 5EORL 2K3TA 4KGJA 4CU7A 4X5LA 5C3TA 3MUGA 5DS8A 3ZYOA 3T8XA 4OIIL 4KAQH 1DQLH 4PR5A 3ULVF 3I2CL 3NIDF 4HIIB 4FFZH 1OM3H 4JQIH 4YHYB 4D0CA 4HWBL 2RJMA 4W70A 3U4AA 5IEHB 1MHHB 4Q7DA 3BKJL 1BPVA 2VZ3A 3RIAF 2W60A 4ONHB 3O3BB 2X6MA 3CFKA 3VXQB 3V5HB 1S78C 5IGXH 4TTDD 4U6XA 3QHFL 5GGRY 5JQHC 3HS0B 4HKZA 5I1GL 2HN7B 4HGWA 2FJFA 5DJXA 4HBQA 4S1SL 3C60D 3Q2CA 1SM3H 3P9WB 4Y2DD 3B2UC 5IM7B 2G60H 4XNQA 2P46B 3PWUB 5J7CC 4OV5A 3PJSB 3QXVA 4N90D 4CU8A 5JDSB 4UQ2B 5JIHA 1JTPA 5AYUH 3BGFB 4OI7A 1C5DA 1G0XA 1AR1C 1QSZA 3ARGC 1A7QH 5DJZA 5T3ZH 4WFGD 1N8ZA 1U3JA 3BSZL 3GSRA 1GCFA 4LSDA 2MFNA 3RWCA 3SBWA 4R7NA 2BVUA 4NM4L 3ARFD 1N4XH 1OP5K 2P8MA 1P7KA 1JMZA 3TA3D 3RL2A 3QUML 2EO1A 4JHWL 5EU4A 1HH6B 4P2RD 2E3VA 2NYYD 2FX9L 5TDNA 4HIHA 4H20L 5C0CB 4GG6A 4DGYH 5B21A 3U9UA 3BH9A 3ZZ1A 1MREH 3UC0H 3RWDB 4G43B 4LVNC 5A2JH 2R2BB 3QEUB 4UI2A 4A6YA 4PS4H 5DC9B 1JP5A 4RMTA 4IRJC 3MCKA 1MCBA 3CFJB 5CZVH 3FCTB 5AWNL 1T83C 1MVUB 5EUKB 2GUOA 3CFCL 5E9DA 3L3IA 4LHUB 1A7OL 2B20A 1QKZL 2JJUA 4JAMB 1FQ9C 1I1RA 2OR9L 2KQMA 4XZUA 5F6HJ 3ARUA 4OZGF 2Z31B 3B6SA 4RGOH 4M9PA 4F57L 5J8OA 2YD8A 4LARL 1UWXK 3EFFA 3WNMA 1BAFL 5FV2A 2NX5D 3GMPA 5JMOC 4O5LH 5FF6B 2Q6WA 1QSVA 4NHUB 3I3DA 4JR9H 1U8PA 4BFIA 5E2WL 5TJWK 4YBLB 1MCPL 4H8WL 3QQ3B 3E8UL 4KK8D 5CLTA 4ZDHA 1Z9OA 5EO9A 5FV1L 3WIHH 4GG6E 1BQHA 1T89A 2JIXB 2VTFA 4TVSa 1YECH 5JW3L 1ZT1A 1GJIA 1AR2A 4QTHA 3T0XA 4O9HL 5EZLB 4POZC 4APQD 3DWTA 3V6BR 5J6HA 1N5AB 4QXTA 1AFVL 4M8QB 4PRDA 1OB1B 3SKMA 3BRGC 5E9DE 4HC1H 2PXYC 4BKLB 1U8JA 3ZYZA 3MRQB 3VCLB 4BH8B 4XCNB 3M8OH 1MCWM 4XMPH 1OW0A 5E2TL 4LSSL 1RUPL 3KWWA 4HXBL 4G9FB 1I7TA 1J0JA 4RIRA 3O9WB 5BO1H 3RX7A 3LEYL 4FN0A 5FB8B 1ZAGA 2C1OA 3L3GB 2ARJQ 5HJ3B 3FFDB 4F58L 4XNUL 2VZUA 1MCOL 2BXYA 2DRUA 3MODH 1KN2H 1HILB 4D8PB 1GOGA 3U30B 5IMMA 5J89A 4HAGA 1T04A 4QHUA 1RIUH 4HH9B 1JHTA 2VR5A 3ILQC 1CR9L 5T1LB 3TLRA 1KUMA 2VLKB 3WL9A 1H15B 2ZUYA 5CILH 1WGOA 4JPWH 4E5XB 1AE6L 1IGYA 3IVKB 3EYQC 4PLKC 1HQ4A 3MRNA 2VZOA 1G0DA 2WWMD 1A7PL 1XF5A 4ZO7A 5J9PB 4ODWA 4QHNB 1JVKA 4ZODA 2Z8VC 5E5RB 3N9GH 1KB5B 2Z35B 2DD8L 3CX5J 3TO2B 1JTOA 3LB6C 3B43A 3LQZB 5IB5B 3IDJB 5IW6B 1X5FA 1PG7H 1XR8A 1MCJA 1FNLA 4I2XA 4X5XB 4O51A 3JTSA 4GMSH 1JK8A 4DVRH 1JGEA 3T4YA 3S5LB 4YHNA 3H7BA 4KRMB 2YWYA 1MFBL 1RUAL 3PQYD 5IB2B 5I1DA 1VKXB 3EOYG 5D7KE 4QHKI 4MLSA 1UJTA 3VFVB 3WKML 2VLMD 2OXHA 2NW2A 3ORJA 4JCMA 3VI4E 3FZUD 1X5LA 4UT6L 4WO4B 3VWKC 4W6YB 4K7FA 4Y0GA 2BFVL 2EDQA 5GJTL 3QJFA 3HE6D 4PP1D 1N6VA 4ODSL 1LNUB 5C08D 5F72S 2VDRL 1T3FA 1DQMH 1SYSB 3OKEB 4OM0L 3D39B 1NGPH 1T5WB 5LGJA 4XP9H 4D9QD 5EZOH 1WZKA 1FNGB 3BZDA 1ZANH 4R2GC 4MD5A 4WFHE 4MQTB 4U49A 2XWJA 1GIGH 1V3MA 3L3KB 5JUEH 5ISZB 1A7RL 4M3KB 3HN3A 4I3SH 4U1KA 2XZQL 4LNVA 4I2XE 3QDJB 4L3EB 3RWGA 3AFLA 1FZJB 1KPUB 2ZUXA 4ZXBD 4OKVB 2CDGB 4LOUD 1SEQL 1IQWH 5F7EL 3DHJA 2IFGA 1F42A 3P77A 3FB6A 5GISL 3F58L 2DQHL 5FXCH 4J3OC 2BY1A 3SOBL 3WDIA 4Z7NE 4F7EA 4K71B 3X3GL 3QQNA 3AM8A 1ORQA 2HRPH 1WV7T 3QNZA 3I50H 3VMOA 5E1HB 3ILQD 2CLRA 4J7RA 5FA4B 3X13A 3CC5A 5KG9B 2FJGA 3S96B 2NTSP 2YZ1A 3G6DH 4Y16A 2JJSC 1KTRL 3EYQD 4HBCL 1P2CA 1S7XB 2EYSA 1U58A 2HJKB 4MHHI 5DT1L 4TNWF 3SDAA 1CIDA 2X9XA 5FYLH 4KTEL 1SY6H 1TVBA 3RI5K 2OJZH 3LB6D 2BP3A 2QHLA 3S98A 1CD8A 1FFPB 1FRGL 3DVNB 5ILTL 2BVPB 5AZ2L 1CVRA 5HI4C 4N9GB 1J5OL 1FORH 3TC9A 3U7YH 1ZGLM 1EBAA 5ICXA 3I6LE 4XT1C 2G5BA 1T2QL 4L8SA 1QP1A 1RPQA 1YJDC 2PTUA 5DHYB 1BIIA 4GT7A 4HH8A 2VE6B 3DMMD 3VI3F 3IFNH 1I8LA 1XGQA 3ILPB 3NCMA 3U7AA 5KTEL 1X3DA 1O5DT 3EO1B 4UQ3A 1ONQB 1UZ6F 2CJUH 1R3LB 2HVKB 3EIFA 5IQ9A 2DQIL 2G75B 4X5WB 1RUQH 3NCBB 5HHVL 1R6VA 3NCJL 5EIIB 1U3HB 4M6NH 4XXDA 4YPGA 1UWEL 1QFWM 4JG0H 3VFSA 3RFZC 3IFLH 2ZUWA 3OKOA 4KMLB 4KPHL 1ERNA 3V0VB 4G8GD 1IC7H 4JFDD 3RWIA 5B4MC 5EUOA 3C6SA 3MZTA 5EULV 2WM0A 5DJYA 1HHKA 4KJQC 4AEIH 4PB0H 2NZIA 4EQ2A 2ED8A 5DFVC 1CFVH 1KTLB 4GBXA 3JV4B 5FKAA 4KRNA 4NZTL 4G3YH 3MLRL 4NKIH 1JBJA 4LAQH 4YNYA 4F9PC 3T0ED 5F7WC 2XT1B 3AMLA 2C3XA 4KTDH 2AJXL 5HDBE 5JHDD 4WJ5B 5DMJB 4DN4L 3DPBA 3QCVH 2ATKB 4GAJL 1L7TL 4JGJA 5B3NA 4KC3B 1CDJA 4NFDA 3MV8A 1H8OA 1PZ5B 4HDIA 1L6ZA 4QGTA 1MJUL 4MXVE 5DJCB 5HGDB 4M48H 4J12A 1KIUA 1UVQA 4KDWA 3ALWA 3FFCA 4WFGE 3MJ9H 4LPXA 1R5VA 4FQCH 1S7RA 4LU5H 4WHYH 3GRWA 2XQBH 2YD6A 1V7NH 3FN3A 1MFCH 2V5SA 4XRCA 1T7WA 5IVZA 4YHZH 4HLZG 4OCRH 4WU5A 2IPKA 4HIJA 3MREB 3C2AL 5HI4D 5KVEL 4JZJA 2MQCA 5EUOE 1EO8H 3EZ8A 3H9SB 1JPGA 2H2SD 2P45B 4NGHH 2OL3A 1S9VB 2A6IB 4BZ2L 3BP7A 3MFGB 2Q86B 5I8EA 5ADPH 3IXTB 3VFMB 5ID0A 1FZOB 3MOAL 4BSWA 3OKDA 4F3FB 3ROLB 1KB9K 2VABA 4PG2C 3S34L 3F6LA 1KIQB 3MV8E 4JFXB 3ARGA 1GH7A 5I2IA 5DO2C 1A3LH 3FFCE 5K93A 3IFPB 4G6MH 4P49A 4HG4J 1HNGA 1F4HA 2DTML 2NY4B 3D2UB 4YK4C 3IDGB 1F8TL 5I1JH 1XEDA 3OKYA 4QKXB 4HPOH 1SEBA 4NQVB 1TTUA 3ZO0A 4G7YH 2A77L 2F5BL 4Y1AA 5I9QC 5DRZA 3FT4B 3RTQB 3BKCL 3MACL 4IRJA 3F7YB 1Q9OB 1ES0B 1S7VA 3UAJC 3FQRA 4YDLC 1JHLH 4HF5H 1T83A 3UYRH 2CUHA 5CINH 2WWKO 1RJZA 3FL7A 4A2MA 5ESAA 3D85B 3S88H 3AREB 1T0MA 1RZ8B 2ZCHL 4RNRB 1LHZA 2E7CA 1HI6B 3P2TA 3PABB 1BX2A 5K9JL 5FM5M 1GZQB 3WD5H 3H42L 2DMBA 2NY3C 5H37H 5F7FA 1FH5L 5IG7B 3ZYIA 2BNRA 5GGTA 3C8KB 1T5XA 4TVPL 2IPUG 2VIRA 3WLBA 2P47B 1B0RB 1NDMB 2IQ9H 1UB5A 1MAML 4JFZH 5EU5A 1N64L 3WDJA 2P44B 2EDTA 1RJLA 4NO2A 2XN9B 1M6OB 1CLOH 5F3BB 3FB8B 1CE6A 1MFNA 5E2VH 1U0QA 1WZ1H 3EO9L 4XNXL 3EUUA 4Y1AE 4QT5B 4OBRA 1Q1JH 3MMEB 1V3LA 5C08A 1DFBH 1KXQE 4MA3B 4JANA 5LAXB 2OP4L 1T1ZB 4CMHC 2B1HH 4I1NB 1QSFD 4M1DH 2XZCL 1RZFH 1DBBH 4OGYH 2YZ8A 4OJFL 5HDBF 2A6KB 2PXYA 1MI5A 1HQRA 4DKFL 4XBPA 5D7SH 3FN9A 3IDUA 1Y0LB 5TDPB 3BZ4A 4YR6A 5FA3B 5A16A 3WUZA 1W72H 3QUYD 3BZFA 1NGZA 4M1GL 4F33B 1MCIA 4QEGA 4GO6B 2BNRE 3UZVB 4HS8H 3B2VH 5EBGA 4FABH 1A3RL 5DHVA 3MLXH 2ZJSH 5IIEB 1U93B 4U31A 5ICYB 4RA3A 3W9DB 2NY5L 2VLME 2AABH 2D0HA 4PJ5D 4OZFH 5MP6L 2PR4H 2AK4D 4XMKH 4IJ3B 1MF2L 4AYFA 1I4FA 1IMHC 7CGTA 1LEIB 4UMGA 1REIA 3P4MA 4ODXB 2X9WA 5C08E 3ZE0F 3ARFB 4XPHL 1B3JA 1CDCA 1CE1L 3TA3B 1FG2B 4MS8D 3P4NA 5MEND 5CHNA 2QSTA 4P2RB 4YHKL 3TV3H 4K23L 4D9QE 1KXTB 2Z91B 3WE6B 3JV0A 4MD0A 1CDBA 1VDGA 1IKFL 4L3CB 3DV4B 3DRTA 1MI5E 1FVCB 3DGCR 3STBA 1UM6H 1KEML 5ESQA 1JGVH 5IHBA 3TVMD 3QWQB 4XCYB 4XP1H 3WFCH 5F9DC 1VPOH 4HQQL 2LU4A 5DLML 2F53D 5MI0C 1WISA 1N7MH 1U8MA 4MNGB 1EXUB 5DK0A 1ZMYA 1ZHKA 2W9DL 3U1SH 4XNZB 1NL0H 1G7IB 5TE6L 5HDLA 3G5XB 3SCMD 2CLVA 2Z92B 3D3VA 2J6EL 3AC0A 1F13A 3CVHL 4XVSL 5LBSH 1ZLSH 5EC2B 3VWKA 4AH2A 4FQ1L 2Y25A 4EUPG 5CBAB 1I3GL 1B6UA 1I3RB 2EH7L 1S5IH 4X83A 5ANMB 5F7HA 2NX5B 4EI5D 5BOZG 1NFDA 4RZCB 1OSPH 2JJWA 5JW4N 5CJBA 4X4YA 3LN4B 5DJ0A 5C09A 4N0YL 4M03A 5SWSD 4NFBA 5IR1B 5BZDB 1GPOH 1GZPB 4K8RC 4PRBB 1Q72L 4APQB 1OGTB 2A2QT 4TNVF 5IESL 4ELKA 4PJFA 4JFDA 1PY4A 2LAAA 5E1AA 2XKSA 4I77L 1Y6KR 4F37F 4P5TB 1MFDH 4J3VA 4F7TB 4LSTH 1NBYA 3BWAA 2V17H 5GJSH 3DV6A 3DURB 5JPMB 5GGQH 2RHEA 4RAVA 3RVWD 3ULVH 3BP6B 1I1AB 3D3VE 3LS5L 5CWSA 2PO6C 4O00A 2V9TA 2WP3O 2VDQH 3BT2L 3DI2B 3HPJB 5JLZB 4QRSA 5A3IC 2V2TB 2JJSA 2J3SA 5D7LA 1NFDE 2P4AB 1DQJA 1N26A 1WFOA 2YMXL 4KWUA 3ARYA 1B0GB 1HE7A 2ADGB 5C09E 3IU3B 4Q6YA 4M7LL 3BJ91 1HSAB 4O4YL 3KLAA 1JN6B 2IBZY 4WNQB 3BEVA 5ACMA 1ZWIB 2HTLD 3T4AA 5KAQG 4PJFE 4JFDE 1KLGA 3THML 4O02H 1OSZB 1MRDH 5EN2A 1Y6MR 4LNRB 1G84A 1OAQL 4U1GC 1CICB 4C56A 1ZK9A 3TM6A 1KLUA 4QRRA 2ID5A 3TN0C 2JTDA 4PY8I 4LVOC 1G7HA 4XP5H 4DCQA 3QRGL 2Z4QB 4KGLA 5F6IB 1QRNA 4CJ1A 1B4RA 3FTGB 3MFFA 1KCSH 1EX0A 2OM5A 2AEWA 4E41D 1EZVX 5D7LE 4GKZA 3HZVA 1HXMA 1UXWA 3PQYB 2VDPL 2E6QA 4HV8B 3CUPA 2I25N 2V2WA 4MB4A 3T1FB 5JORB 3FQUA 1EGJL 5HHNA 5BS0A 3VJ6B 2ZPKH 5HYFA 4PRNA 1QLFA 4NN6C 5SWQB 3CLFL 1UZ8A 3IDMB 4AEFA 4LSRL 4UDUA 4U1HA 1I3UA 3D25B 1MH5B 1P6AB 1TQCB 4I0PD 3PHQA 1CLCA 4OCWL 1T1WA 1D9KC 1CTOA 1JZ2A 4JY4A 4PJCA 2FIKB 3V5DA 3IU4H 3OR6B 3MBEC 4J4PD 4R4FL 4C56E 4QRRE 1RHHA 4L5FH 5D7JB 2R2EB 4LCYB 32C2A 4FHBD 2LAGB 4F9PA 1KLFA 4NYLB 3L7FB 2PO6D 3BPLC 3HPLB 1JNNH 1QRNE 3D18B 1A8JH 3B9KB 2X9YA 4CVZA 5I73B 1YN7B 1AP2B 3CXHJ 4TRPH 4PJHF 2R23B 2OQJB 4XVUD 5CIPA 5TFSL 3C9NB 2FCBA 3DVIA 3L5WA 3FT2A 4IIQB 4O2EA 3FHAA 2CK2A 3QZWB 5F44A 5B3JF 2OMBA 1F58L 3UXFA 2FDBP 4O2FB 4PJHB 4YC2B 4LPCA 5BS0E 4H0GA 4G6JH 3D1MC 2GKIA 4MDJB 3VFPA 3ULSA 4NRZA 1H3UA 5T1KA 3T2OA 1NBVL 2VH5H 4XP4L 5IOPA 1AH1A 4PUBL 4EZMA 4X80L 2F19L 2V7HA 4JO3L 3P9MB 4L8BA 3V7MA 3S4SA 1KFAL 3QFDB 2WIIB 4NUGH 3NMEA 4I3RL 1KXVC 4PJCE 5FOBB 5BVPH 5IVNA 3O6MH 2NY7L 3QDGD 4ERSL 3V9FA 1W8OA 5EPMB 2GHWB 3QEGL 4RMWA 4YE4L 4Z0XB 4V2BA 1HINL 3MRBA 4XMLL 4U1JA 3BP4A 3DX8A 3L9RA 5E5MB 3WHXA 1G9MH 1ZVYA 4Q6IC 1CBVH 4ZYKB 3OWEA 4GAYB 4LSPL 3EFDH 1AKJD 4JM4H 1ZTXH 5F70A 4PG2A 4G42A 4ZFOL 2DQUH 4X6DF 1AC0A 4X4XA 1MNUH 3MRHB 3CK0H 3QXTA 3DMMB 4ONGH 2R9HC 4GSDH 2GT9B 4W6WB 4M1CD 4OFIA 4JRXD 4DOHE 1B2WH 2HFGL 3HR5A 5D1ZD 5HY9B 3ESUF 4AIOA 4JDZA 3NPSB 1BD2B 2FIRT 4IDJH 2GTWA 1T21A 5EZIH 1D9KD 4AENA 3MZGB 5BV7H 3AAZB 1WITA 1NEUA 5IKCB 3OHXB 1DL7H 2AK4A 2I5YL 5E8PA 1K9TA 4K3DH 3KLHD 3H3PL 3QCTL 4X6CF 1LEGA 4FQ2H 1WQVT 4JFFB 2HA1A 4FNLH 1OPGL 3W0WA 4NQEB 4MA8L 3DXAD 5AZEH 5C0RL 3HC3L 3ZKND 1Q0YH 3K1KC 4G8GB 1CIUA 4J1UB 4LLVB 5C0AD 2NY2B 2UZYB 1OP3K 4X6CB 3MROA 1YN6A 1WAAF 2Y6SD 4M7JL 3GJFK 4PJDA 4W6XB 2MKWA 2P5WB 4RGMC 1F4YL 4MDIA 3MC0A 5DQDL 1TETH 4IOFC 3OPZH 3GBNL 4DZBA 1PVHA 3WBDA 3GMRA 5DMKB 3PGDA 1AQKH 1QFHA 4F80A 5T3XH 5EU3B 4CVUA 3RY4A 2F53A 2RIKA 2CIKA 1PD6A 5JHDB 3F7VB 3B3IA 1ZLVK 3UJIH 3QIWD 5ALCH 3FQXB 5D4QA 4NCC2 1LP9B 5DZOA 1YEJL 2BRRH 3VGHA 3IJYA 4EKXA 1DSFL 4N5ED 4X6EA 5AG9A 1PBYA 2AK4E 3QJHA 3INUH 1B6DA 3MA7A 1FL5B 5IBUG 1UWGH 5JIIA 1IGFL 3W5MA 3W0WE 2C4XA 1G9NH 3FAXA 3LQAH 2PYEA 3O4OB 4DTGL 4UOJA 4MJ4A 2FWOB 2NY6B 2L7UA 4KJWC 5E4IA 5SV3A 1JZ7A 5D70H 4LLAA 2GTZB 4PJDE 3EYOA 3KPTA 1NCWH 1TFHA 1IFHH 3BQUC 3DSFL 3GMMA 4MNHA 3VW3L 3B9AA 3LEVH 3D0LB 3UO1L 4OLZL 4IRSC 4QY8B 3TIDA 2D03L 1JNHA 3A67L 4ODVH 3EYFA 1C08A 1EEZA 4KK6D 1NAMH 4P57A 3FMGL 2F53E 2XQYG 3X12A 2AXHA 3QHZL 3QNXA 1LO5A 4JKKA 2W91A 5C0ND 3HMXA 3ZE2F 4OLYH 4PJ9B 4QTIH 3P73A 1LE9A 1ZA3B 4HJGB 4OD1H 2EEAA 2HLFD 2JCCF 4YJZL 5MHSD 4M5YH 1YNLL 3L6FB 3TJHD 3VG0L 5IFJB 3R1GL 1FSKB 1WCBB 3LAFA 15C8H 4PBVC 1FO0L 4WY7H 5D1QB 1HKLH 2PYEE 5GGUA 1CFNB 3F6IA 5HGAB 1D7FA 4YWGH 4TSCH 3C2SA 4CW1B 4XPBH 1FPTL 3QG6A 3U83A 1AGBB 2B1AL 2B0SH 1BEYL 4MAYC 4ZTPL 3RL1B 3O3AB 4UT7H 4JCLA 2GCYA 1WCQA 4IOFD 3RA7L 1KBGH 4Y4KD 5E70A 1KCVL 4U6HA 5D9SB 1A6AA 5DWUL 3MJ7A 3ZKMC 3IFOA 5EZJB 2QR0A 1BZ9A 1SJXA 1TCRB 3GSNL 1MLCA 1FLRL 3GSQA 1AQDA 1KCRH 3KPOB 2I60L 2ENSA 1H5BC 3OGCA 4JY5H 3NABL 5I76A 3IDNB 3MRFA 1UA6L 3OF6D 1JWMB 2XTJD 4PRAA 3HC4H 3VXNB 1CLZH 1XCTA 2YPVL 2UWEA 3HAEA 1P7HL 2V6HA 4K3JL 5IF0B 2E8ZA 2DQFA 1A6ZB 1J1OL 4XPTH 3W9EA 1VEMA 4TVPD 1KT2B 3GSOB 4QHLA 5MEOA 3MXVL 4KKNA 4MCZB 1NJ9A 1YQVH 2EC9U 3NH7H 5AYQA 4QNPF 4M00A 3TO4D 1IEBB 4Q2ZA 4JKLA 4G9DA 3DO7B 2A6DA 3WXWH 1I75A 3KXFB 2J5LC 2AGJH 1U8IB 2UV3A 1JUFA 4OZ4A 1TJHH 3PHOA 1TZGL 4X98B 2AQ3A 4KJWD 3L3DB 4PPTA 3MV11 4UOW1 1QA9A 3REWA 1YMMD 2AI0H 3MLYL 4HWZB 1VFBB 3VRLF 1YY9C 1LO0H 1QNZH 2WQ8A 3CD4A 5E6YA 4IRSD 3TPUB 4O2CA 5DRWB 3G6JF 2E7MA 3ZDXE 1EFXD 1MCCA 5DD6B 3KJ6L 1HHIB 1P1ZB 1A5FH 4C4KT 1J7VR 1HWHB 4MB5A 4YHMH 1NEZB 5I1AA 1LO2H 4PV9B 4I8DA 4QYOA 5GXBB 4R90L 5DVOA 4PGCB 5DD0L 3FRUB 2UWEE 4HJJL 5BXFA 3WXVH 3ZDYF 2PO6A 5ACZB 4UTAL 4RFOL 5JA8B 4E9LA 4LK4A 2ADIB 1OTUD 2JB5L 5IROC 1W0WB 2FO1A 4MGXA 1R5IA 1V7MH 4XPFL 5DD1H 2MPAH 3T04D 5FYJL 4BK5A 4NP4H 4RDQF 2GSIB 1D5MA 5IMLB 1ZGLA 1B88A 3CFDA 3DX7B 3HNVH 3NIGF 1NQBA 4UIKH 4JO1H 4OF5A 2IAMC 1I8MA 3A6BL 5IW1A 3QUMB 4F15B 5I1IL 3LRHA 2I9TB 1XR9A 4H0HB 4WEBH 4WI5A 4WW1A 3Q48A 4QOKA 3PDGA 5MENB 1HIMH 3S5LG 4NUJB 2WINA 2DQEL 5CCKL 4Y5XB 4GW4B 5HTSA 2RFXB 3TN0A 4PBXA 5TH2B 4HXAL 4JDTL 4AEHL 3QO0B 5BRZB 3TVMB 2R1XB 1UXSB 1LK3H 3FO0H 1S5HA 3HCVB 1T1XB 2ZCLL 1AGFA 4NNYA 4OCNC 4K9EL 3RI5F 3Q5YA 3PGCA 5CMAA 2DI9A 2VLLA 3ARDB 3GSXB 4WGVB 1DBMH 1QYGL 3W2DL 5D8JL 1CZ8L 1RZJC 4Z8FL 2X4QA 4LHJB 2Q76B 5I1LA 3G08A 5T1MA 5L88H 2VL4A 5DA4A 3MRIB 1J86A 3GO1L 2Q7YA 1RFDH 3K8MA 2PTVA 1YEKH 2QADB 2R1WA 1WTLA 1EA9C 4EI5B 4XH2B 4LCUA 2Q8AH 1Q9KB 4QOKE 3LKSA 3HG1A 5J06A 1IAOA 4OF3A 4HK0A 4M93B 5I1EL 4OLEA 2E7LC 1NGYA 1D9KA 1RZGB 1A6UH 2YOCA 2Z9TA 2L7JA 3DX6B 2CSPA 2AV1A 3MBEA 2IQAA 5L2KA 4GS7C 4OUUB 2E6JA 4M6OL 1IC4H 3ES6A 3VXUA 3NOIA 1F2QA 5JOPE 2MWCA 3VXOB 2XG5A 4AY0A 5DMYA 2ZCKL 1QFUL 4P48A 5IFAL 4OLXL 4W81A 2F9BT 3U36A 5E2UH 2X09A 2OTPA 2V5MA 1LK2B 5C0JA 4CNIA 1GAFH 4Z7VA 5E8DH 2DF3A 3LKRB 3GI9H 3CZFB 3NFPB 1IC1A 1RQ5A 2QSCH 4LKXA 2JLLA 5DS8B 3IDXL 3PXHA 2A0LD 4I13B 3NTCL 3VWJD 1A14L 2A9ML 4PR5B 2JELL 1CQYA 3JWDC 5FM5O 4D0CB 5IBLD 1IBGH 4L4TA 3GBMH 4MD4A 2R0KL 5CLWA 4GW1B 3QUKA 1HCVA 3CX2A 3HG1E 4FG6D 4ZSOA 4MCYA 4U6XB 4WWID 3L95B 3HNTH 1L0XA 2FBJL 5FM4A 5EIVA 2HT3C 1TENA 2FJFB 3MLSL 5DQJA 4OLVL 3LPFA 2VR4A 5L2KE 1SVZA 2GJZB 1S3KL 4JREC 1WWCA 3VXUE 3KYNA 3CSYA 4XNQB 1IC5H 1P4BH 3MR9A 1TJIL 4JFOB 1JPSL 3KPRB 1MIEL 3LS4L 5DTFA 5SX5H 2YK1H 3HZKB 4Q6IA 4HK3J 1UKQA 2IPUK 1P5UA 1ZHBB 3MRDA 4YHLL 4QXGL 5JA9A 2X7LB 4Z7VE 4KUZL 4GXUM 4ZD3L 3SDXA 5HVHC 3DUSA 1Q9LB 2HT4D 1CDIA 4R0LC 4BUGA 2HJLA 1E6JH 2VKWA 4RQQA 4FTVD 2H32H 3KS0J 3RGHA 5EBLB 3H7LA 3RWCB 4R7NB 4L4TE 5H94A 2BSED 2GY5A 4BK4A 2ICCA 2P8MB 4E41B 3O4LD 4JJ5A 3V4UL 3RL2B 5EU4B 2AJSL 1DN2A 4OZIB 4ZSOE 1J1PL 3OAUL 1ED3A 1PSKL 5I75C 3U9PH 2VXUL 2BRQA 1HWGB 4P3DB 2IG2L 3KPPA 3WO3B 5KVGL 5LXGL 4U0RB 4GUPA 4A6YB 3TBSA 3KDMB 4NZRL 4RWYH 1NFIA 3T2NH 1FIGL 4RBPK 1XF3B 2R8SL 2GUOB 1VFAA 1AGEB 1YDPA 5E9DB 2Y07H 3DGGB 1QFWL 1RUMH 5EOTA 1H8SA 5C9KA 2JE8A 5F1IA 4RGND 3SDXE 43C9B 4XWGL 4PJAB 1N6QH 4LL9A 2H1PH 4RFNB 4EI6A 1FAIH 1U92B 4X7DC 3LD8C 1AO7A 4PB9H 1UB6B 1U8LA 1A02N 4G8EB 2GK0A 2ZUQC 5DI8A 2ICWA 3SJVA 3DX9A 3WDHA 4BFIB 1J05A 1RV6X 1B4JL 1RU9H 4WENB 1ZA6A 3LHPL 3MYJA 3SKJH 5AAMA 1XH3A 1NCTA 5EO9B 1K4DA 5J13C 1BQHB 5IT2H 4W4NA 2J7LA 4TULH 4NQCD 1OGAB 1ZT1B 1IGIL 4QTHB 3SQOL 4P2QA 1INQB 3H6JA 4GXVH 4QRPD 5FOJA 1CFQA 4XCEA 2WQRA 1MJ8L 4C83B 3GHBH 2VDLH 2R56L 1L0QA 1U8QB 1C16A 2VO5A 4LBEA 5J6HB 2R15A 1WWAX 3SKMB 4N8VA 1OWWA 1YMHB 2FSEA 2P7TA 4KK5D 4KJPD 4M7ZC 3BHBA 3BQUA 5C0GA 2WUBL 1W0VA 1UYWH 5K9QI 1JF1B 2HFEB 1YEHH 3HI1A 4P23B 4IRSA 1AO7E 3ARXA 3CDCA 3B5TA 4TOYH 1EFXA 2DICA 2C1OB 1MRCH 1JI1A 3SJVE 1XF2A 4KRPC 4JFHE 1OQOA 2ZG2A 2R0ZH 5I30H 3K74B 5CJQL 3RNKA 3F62A 5A43C 3UTSA 5IMMB 1RUKH 2MCPH 2V2XB 4L29B 1OAZL 3TBWA 4MVBD 1YEIL 4M61B 2AXGB 4H5SB 5D5MF 4Y5VC 2EE2A 5KSUB 4XAWH 4TYUA 5LQBL 4J8RA 3VH8B 4P2QE 3I3EA 2CGRL 5J11C 1MQKL 5D72H 1G6RA 4V2CB 5FUOL 1I8KB 1WUNT 1XF5B 2NY0C 5D5MB 3TT1L 4FXLA 4HIEA 4M7KL 5D96C 1OAKH 1GGBL 3DUUA 5IUSA 5GGTH 3G5ZA 4U6TA 4MAYA 3JV6A 4H25B 4OCXL 4MJ5B 5TDOA 3SDYH 3TNMA 1WBXA 4G7VL 3FQTA 43CAA 4IMLA 1OAXH 2DB8A 5IK3A 4Y7MA 1L7IL 1FVEA 1CK0H 4K3EH 4NQTA 1NSNL 5LCVH 5I19L 5C0AB 4PJEA 4LLYB 3KNBA 3H7BB 1O7VA 4FQLL 4DGVL 1H5BA 4JY6A 1X5GA 5E6IC 4XPGL 3UTSE 1IEAB 3UCRA 3C6LC 1Z9SA 4GLRH 1KJ2H 5SX4H 4B41A 1G7MB 2CRYA 2CDFB 3QAZC 3FOMA 4WGWB 1FL6B 3PP4L 2BOBA 3IF1A 5IHZB 4PRPD 4Q97A 4ODTL 1NGXB 5EU6D 35C8H 2ZOKB 4ZUWA 3QIWB 4Q9BA 3FAWA 2BOCA 3VXTB 3WLWC 2GITA 3QDMD 5DFTA 3BD3A 3T3PE 2Z8SA 2IEPA 2VRAA 5GZNC 3TT3L 1CDUA 2XWJB 1OLLA 4TSBH 1DVFC 5GRJH 4I5BA 4P46C 3RVTC 5DHVH 1N5YL 4NO0D 3MGOB 3K8LA 3C87A 2X4TB 3H8NA 3ELAT 3QUZC 2VDOH 3RWGB 2ZZUT 4FQXC 5EFIA 3VGBA 2Z8WC 4R3SB 2VZ1A 3R06A 5L8KB 3FO9B 4HKJA 3QUXC 4PJEE 4YBQC 3TYGH 3P77B 2YEZB 4KROD 3I3BA 1T2XA 1NCDL 1PYWB 3HC0A 1EPFA 5L8JB 5GRWA 1D6VH 3M45A 4FXKA 3PP3H 1UEMA 4JPVL 3O6FD 4NJAL 5GRUL 1MRFH 1DEEB 4P9HL 5A2KH 1ZLWH 2Q7NA 4MJ6A 3U82B 3UZEA 3VXSD 1G6VK 2DBJA 5IROA 1FCCA 2ATPA 3KAAA 4ELMF 2D7TH 3O8XC 4LPWA 5IBTL 1MCEA 3HTLX 4ALAH 1P2CB 2O26U 5GIRA 3OR7B 3KR3L 4LCCC 4N1CA 1U58B 2X05A 1Q38A 2CKNA 4ELMB 1CT8B 2YPLA 4DW2H 4XC3L 2NY1C 5C0DB 5DEFA 2IAMA 3WYRA 2C26A 5BZWA 4NQDA 4ZUSA 5IJVA 4OIAA 4ORGA 4MJIA 5GPRA 3WIFB 3ZL4L 5CZKA 1R5WA 2P1YA 4U7KA 1JFQL 2VLJA 1NC4A 5CS7A 5F93C 2W0KA 3D87B 4NM8H 5C6TH 2IALA 1A6WL 4LDEB 3UTZB 2G5BB 4L8SB 2BNQD 3TJEH 3O0RH 4F8TA 5HGBB 4PLJC 3HI6L 1J88A 2YD4A 4JFYA 5EO0B 3C6LD 3UBXB 2D0FA 5DK3A 1K2DB 1HZHH 1IGCH 3KHQA 4LIQE 4S1RH 5BJTB 3TFKC 2QQNH 1LO4H 4HJ0C 4AM0A 4HWEH 3LSOA 4DN3L 1F3RB 4K7PX 1BJ8A 3B8SA 4HCRA 2XV6B 5KN5B 1VADA 3GI8L 3PNWB 3VU2A 2A6JA 4V1DA 4LF3A 2IH3B 2ADJB 2KQNA 2YPLE 3FRPA 4FTVA 4P46D 1GC1C 2E8YA 3RVTD 3V52L 3N85H 5J1SC 2NNAA 3UEZA 1DQTA 4NQDE 3O6LH 4OGXH 2F58H 3TO4B 4MJIE 2AKRB 3C09B 4NHCL 1KNOB 25C8L 1YEFH 3RWIB 4JFEA 2F15A 2R29L 4JFQB 4X6FA 5EUOB 2VLJE 1ZE3C 2OR7A 3ZT5A 4N5UA 3MRJB 2E7LA 1HHKB 2DQGH 2FYYA 1JF6A 5F9WC 5IMOA 3UYPA 3V4PL 1YC7A 3EGSA 3NBNA 2VSCA 1NMAL 3ARVA 5KSBF 4GBXB 1YPZF 4XX1E 3ARTA 1OAUH 3O41A 3VXRD 1TQBB 4S1QL 1EAPA 5C0BA 1UCBL 2X5PA 5KW9H 1MHCB 3S37X 2XA8H 2BERA 3L7EB 3AS0A 3VFRA 4XBEL 4HUMB 3UTTE 4ODBD 4BZYA 3L1OH 1TITA 3MV8B 2PCPA 3AS3A 4V1DE 3MJGX 2CK0H 1DUZB 2AEPH 3TGXA 3FFCB 4HWUA 1XGRA 1ZT7A 5FO7A 3T3MF 1S7TA 3PWNB 1NMCC 2J8UA 1FE8H 4HX1B 4LLWA 5FYJD 2R69L 3WN5C 1QBMH 3U2SA 3IYLW 3HA0A 2X4UA 4YHPA 3GK8H 5ALBH 5E8NA 4L1HA 5IVZB 1A6VL 5JQ6L 4X8JB 3RUGF 1Q94A 1UWXH 2CUMA 4JFEE 4MYWB 4D94A 4R7DA 1KF9B 2B4CL 3GMQA 3VFOA 3P30L 1KV3A 1WJ3A 2ORBH 3P0VL 2VAAB 4WHYG 5INDB 4WDIA 2D7NA 5JXAH 3RUGB 4WUUD 2OL3B 4NQCA 3UJJL 3V5KA 5C0BE 5I8EB 3UMTA 1A21A 1HSBA 4BSWB 5I1CL 2XKNB 4GLRI 4UAOB 5K9KB 4KK9D 5SX4I 1EUUA 5IEKA 2VABB 3ZDZE 1ZEAH 4MX7B 2AVGA 5FO9A 1CGSH 2LFGA 2VC2L 4YXKL 4NDMB 4G5ZL 5DUPL 5L6YH 2NXZC 3HMWL 4K3GA 2ARWA 4R0LA 2GJ6B 3X3FL 1QHOA 3MLUH 5L2JA 2J8UE 2A73A 5KOVC 1H0DA 1VHPA 5DVLA 3B5HA 1H8NA 1MWAL 2F8OA 3S7GA 3LKOA 3QXAA 1MHPL 4G80B 2AV7A 2PYFA 1XF4A 5F88B 3CVHB 4OT1H 4B50A 2OYPA 4NSKA 3OKMA 5CIPH 3VD4A 1NCAH 3P9LA 1EO5A 4NT6A 4UUJB 4M8VA 2FRGP 2FO4B 2OTWB 1NLDL 1S7WB 4Y1AB 1JGUL 5EBWA 4NQCE 4LVNB 4Y5YB 3MV7A 3EJZD 1JIBA 3LKPA 2FEDC 5TE7L 5DRZB 2R1YA 2E9BA 4M7LT 4IRJB 2GAZB 2XQYK 3V0WL 4KZEL 4EDXB 3RVUD 3UPRA 3MRCB 2HG5A 4R26H 3AU1B 4UBDC 5CJXC 3BZEB 5T3ZE 5DUMH 5ADOH 1I9RH 1RJZB 2GQHA 4XC1L 3EOAA 4MSWB 4PJGF 1EH9A 3AY4C 4GRWF 4I48B 3AVEA 4MWFA 4QLRA 5B38A 5BOPA 1RK1A 4F7CA 1I9IL 2KH2B 3BKJH 4LVHC 3GIZL 3ZKXB 3WIHA 4PJGB 1T5XB 1R3HA 5AUMA 4KV5F 1V05A 3BH8A 2WWKT 1U36A 4PRID 1OTSD 5LKNA 2JB6B 4NO2B 5EH1A 2M26A 3FJTA 3G6AB 3PWPA 3Q1SL 1FNEA 1CF8L 1OARL 3VWJB 3LIZH 3MRGA 1CE6B 2VZTA 5H37G 3HZMA 3RDTC 3QNYB 3U0TA 5DZLA 4HIXL 5C9JA 4PRPA 1BBDL 5EWIH 1VB9A 3MV7E 2M2DA 5EU6A 4HC1A 3DUHA 3WKNA 3DIFA 1UKSA 4X0KB 2R4RL 4PJ7A 1F4WL 3GJFB 3I84A 5T1DH 3FOLB 5FYKL 4RRPG 2JJVA 1GGIH 2ERJB 2PXYB 1MI5B 1QEWB 4KAQL 5C3LD 1TZHA 4M43L 1FL3A 1BJ1H 5I6XB 5CEXB 5HGHB 3EHBD 4YR6B 2OI9C 1M7XA 5GSRA 4DVBB 1NGZB 1EFQA 4Y19A 2LU3A 2QQLH 3RHWK 3NFNA 1VESA 3QWRD 1ITBB 4IMKC 3BVNA 3QUMH 4JHWH 2EYRA 2LABA 5IGXL 5ITFB 3HUJA 3QCUH 4KQ4H 3PWPE 5D2NC 2EKSA 3MRRB 3TZVD 2D7QA 1QR1B 3MCLL 2CR3A 1NAKL 4Q58C 4I0KA 3IJSA 4Y5VA 2G60L 4PRPE 5E08L 2EKJA 2FEDD 4LGPB 5EU6E 3O4LB 4M5ZH 4AEEA 5AWNH 4PTUA 1XGUA 2H26A 4LCWA 5CHNB 3ARQA 4PJ7E 3WS3A 5C71A 2EDDA 2EEDA 3CFCH 4UBDD 4EN3B 3GSVA 1A7OH 3W39A 1QKZH 3DRTB 5JZ7D 2OR9H 3REVA 2AJ3A 3OMZA 2WUCL 3MNZB 5DD5L 3IETA 3V8CA 4UV4L 5JIKA 3T65A 3BESR 1ZS8A 4HHAB 1DLHA 1EMTH 1N4XL 4Y19E 4Z5RB 3TNNA 3PL6C 1I7ZA 4OGAD 4AT6A 1U8MB 3HRZB 1ZHKB 3QEQB 3BRDA 1MFEH 2HVJA 3U6RA 1MCPH 4H8WH 3HUJE 2ITCA 4OZHA 5E6IA 1PDKA 3B9DA 2OZ4A 1IAKB 3C6LA 1MREL 3UC0L 5C86A 3D3VB 3IXAA 3TCLA 5DJ2B 4Y4HC 3VWKB 2Z8RA 3HZYB 2GSGB 4PS4L 4UU9B 5JW3H 3R0NA 3V95A 5D6CA 3RWJB 5CZVL 1XFPA 1D5BA 4LCWE 4NO5B 1N3NA 2W0FA 1AI1H 1KJMB 4X4YB 5DJ0B 5C09B 5I17B 5HHPA 1DVFA 4P46A 5E2TH 1WWWX 3F8UB 4LSSH 3TBVA 1JPFA 3ZTJH 2XNAB 3MLZH 4HXBH 4RGOL 5FGBC 2DYPB 4HFUH 3QUZA 4LLDB 1MCDA 4YHOL 3NCEB 2HFFB 4FQXA 5D2LB 4ELKB 4O5LL 5BQ7A 4GKNA 3ULVC 4MZ2A 3QUXA 1UH2A 2XZAL 3BWAB 3DNKA 4DK6A 4OZHE 2BC4A 2X4PA 3C8HA 1F97A 1CR9H 1YECL 3QIUD 3F12B 2BVTA 3P4OA 2BNUB 3T08A 1AE6H 5L9DH 1U2HA 2DQTL 2FNBA 2HKHH 5CJOL 3DYPA 3O8XA 2VYRE 4HKXA 1A7PH 1SY6A 1HXYA 2EE3A 3BGFC 2V5YA 1F6FB 4LCCA 3IKCA 4N0UB 2O5YL 1NCBH 4PJBF 3M8OL 3QULA 2XPGA 4YIQB 4NO3B 4MA7H 3BEVB 1HH9B 5CD3B 1AHWB 3D6GA 2C3HA 4KQ3H 4PJBB 1KEGL 1KLGB 3KYAA 3PL6D 3MODL 2DL2A 2P24A 4P5MB 4B5EA 3ZT6A 1MFBH 1RUAH 2KPNA 2N1KA 3PIQA 1BFVL 3AROA 1GVIA 1RIUL 3RWHB 4GG8B 4QRUB 5CILL 4WUKL 2R2HA 1J1XL 4DCQB 1I1FB 2BFVH 2FHFA 3VMNA 5GJTH 3GSWB 1QRNB 2DQCL 4TUKL 5D1XC 1R3KA 2AEQH 4JM2D 2SEBA 5FYLE 4LRNL 1NDGA 1WIPA 5F7MC 3QFJD 5KS9A 4PGEB 3N9GL 3BDBA 2YXFA 3FQUB 4LKCB 5LG1A 2XZZA 5HHNB 3IJHB 3NACL 4PV8B 4JZNB 2UYLB 1QLFB 2Y36L 3NPZB 1A7RH 2CKBA 1UZ8B 3EJJX 1CN4A 2AJYH 4G6FD 5IFHH 4RFEB 3B9VA 2GFBA 3L5HA 1A1NB 1C5CL 2FGWH 4ONFL 3TYFA 1T20A 1E28A 3MUY1 1YUHA 4JY4B 5LWYH 4ZO8A 1NEZG 4U33A 3V6OC 1RHHB 1JWSA 4NO0B 4U3CA 2VISA 3B5GA 32C2B 5C8JB 3HE7D 1F3JB 1G7LA 1OTTC 1BOGA 4E42A 1DQML 3I75A 5FUZH 1NGPL 4U0QB 4PBWD 2IF7A 1SYVA 4HBCH 4XP9L 1V8HA 4Z7UF 4YEFA 3MJ9A 3HB3D 1ZANL 1UGNA 3VFWA 5KS9E 2HJFA 5DT1H 3F5WA 1S9WB 1MVFA 4EXPX 4KTEH 3O6FB 4L8DB 1EAJA 2YBRA 3MV9D 3G5YA 2DMKA 3VXSB 3BP5A 4QXUL 2FH8A 5J6GB 4H1LA 3WN5A 5ILTH 2HRLA 5EG6C 4L4JA 4PRIA 4MXQD 4B53A 5LJYH 3U30C 4NKDB 3L5XL 3VE0A 4XNYL 2EECA 3S4SB 3OAZK 2NLJA 3EJYD 1T2QH 2FJHB 3P3YA 3FB5A 1MCQA 3MGAA 3BPOB 2OSLA 2CIIB 1URLA 3O6KL 3G6DL 1TNNA 2IADA 3K4DA 3WUWA 4U1JB 5KTEH 1Q9WA 3BP4B 3OJDB 3V8OA 4R6UA 4D3CH 3WS6C 5E2JA 5K33A 3RWEA 2BNQB 5HD8D 2DKMA 2CXGA 2OJZL 4U1MA 5MERB 5HI5C 5HHVH 3GSNB 2Z31D 1BQLH 1MFAH 3NCJH 2VN7A 4L4VD 3QIBB 3C5JB 5FO8A 3HR5B 2DWEA 2VUOA 1A22B 1CG9B 2H8PA 4FFVC 4JDZB 1WK0A 4PRIE 4YUEH 3U7YL 5I71B 3GUTA 4Y8DC 4Z78A 3BN3B 5CD5C 2GTWB 2H41A 1JGDB 2VSDA 4HS6A 3BYTA 1F3DJ 1IEHA 1AD9A 3EYSL 4NZTH 5E8PB 3MLRH 2JIXD 4KJYA 1ZLUK 4KKCD 5FCSH 4BFBD 1LEGB 3QPQC 3IFNL 1F11A 4WU7A 5C0FB 3EO0A 5I8CA 1AD0B 3CIQA 1I3VA 5HPOA 3ULUL 5CJXA 1R3JA 2X89A 1D5ZA 5DSCA 4PJDB 4MDIB 1MJUH 2FB4H 3V7AE 2E7HA 4DZ8B 1RUQL 3AY4A 3NGBB 3BO8A 1P7QA 3DTXA 3PWVB 5ESVB 3PGDB 3KPLB 3E1F1 2QQKH 3O9WD 4JG0L 1KTDA 4OF8A 1FYTA 1T7VA 2CIKB 1IC7L 1JHKH 2HWZL 3VXMD 3AXLA 4RISL 2K9UA 2MSPA 3LRGA 3C2AH 3QISA 5KVEH 4OSUL 5F96L 4AEIL 1EK3A 1DEDA 4K71C 4LSUL 2CPCA 5HYQB 3IJYB 1RIVH 3ECBB 5AEAA 4G3YL 4NKIL 3LQAC 4JKWA 2MHAA 4PREA 2VLKD 1L4IA 4I0CC 3RDTA 4UOW0 1CL7L 3MA7B 4KTDL 1KACB 3SBWC 4JO2H 1EUTA 4CMHB 1W0YT 3MOAH 2PYEB 1MLBA 1FDLL 4JN1L 3N0PB 3WCYA 1RAMA 1W72A 3KG5A 3EYOB 4M48L 3GMOA 4KVNH 4WUUB 1BZ7A 4MNHB 4FQCL 3VFUB 2XQBL 3TIDB 1H3TA 1MFCL 4P57B 4KKAC 4OCRL 4LCIH 1FYTE 3X12B 2Q1EA 1LO5B 1S7SB 3MRMB 1I7RB 4IMKA 4OZFA 3VGFA 2VR9A 4XGZA 1EO8L 3BIKB 3P73B 1LE9B 4ETQB 5DMGD 5IVXF 4J3UA 5D2NA 5FFLA 1D5XA 3PWLB 3BRFA 4WO4D 1J9CT 5DJ8A 1MHEB 5ADPL 4OUOA 2E27H 1VFUA 4ZFZB 3MACH 4NQXA 1DQDL 3J8F7 4S1DC 3ZSSA 3D39D 4EIGB 3OXSB 1CFTA 1QLRB 1XIWC 3TBTA 5GGUB 5KBNC 2PUQT 3QEHA 1DQQA 5JTWA 3QG6B 1J0ZA 2ESVA 1A3LL 1FNHA 4P4KD 4EUPB 3K2UH 5TPWH 1QPXA 2ZCHH 2ZOLA 5ISZD 1YEGH 1U3HC 3F7QA 1BM3H 2XKUA 3QDJD 4L3ED 1FFOA 4RAUA 3CFBB 4OAWA 4BSVB 3MJ7B 3H42H 2XWTB 4JRYA 1HEZA 1AGDA 3PL6A 4MNQA 3V0AC 4TVPH 1MLCB 5MI0B 3GSQB 1D5IH 3X14A 3RKDC 5K59E 3OGCB 3P4LA 2WK2A 4NWUL 1JPST 1N64H 3DVFA 5B22A 1FNFA 5L0QB 1RVFL 5D7IA 3TBYA 2DQFB 5D2NE 3NZ8B 1BQHG 4NNXA 3EO9H 4GRLD 4XNXH 2EXYD 4Y4HA 1BQSA 4R97B 1BVLA 1NJ9B 1S7UB 2OP4H 3ZE1F 4PJXB 1IL1B 4HF5L 3UYRL 2XZCH 2YPKB 1ZT4A 1A7NL 3QFJA 5KVFL 1JUFB 1QOKA 2WLYA 4OJFH 4FFYH 5GGRB 2D4DA 3RWFB 1PEZA 4DKFH 1QA9B 5E94A 2ESVE 2EDWA 3REWB 1IM9A 2WZPD 1WC7B 5FGBA 5IV2B 4URTB 3RRQA 1YY8B 4JRYE 5FYKD 2R39A 3V6ZB 4MNQE 5GZOC 3V5HA 2WBWB 1A3RH 4N0CC 5KAQF 3OGOE 4KZDL 3PDDA 3HS0A 4QYOB 2NY5H 4K7PH 1G6RH 1RZKC 1CLOL 1ZVHA 5D7IE 5CP7A 5E2VL 1R24B 3PV6A 1WZ1L 4DFHA 4R4ND 5DC0A 1Q1JL 5IM7A 1DFBL 3PWUA 3QHTC 2P5ED 4XPHH 5H2BA 4M1DL 3PJSA 1CE1H 4OGYL 4S1DD 4UQ2A 4QRQA 4YHKH 3MRPA 1ITCA 3QFJE 4K23H 3SGEH 1E4KC 4Z77A 1D5MB 3BE1H 4JQXC 5J4MA 4EBQH 1ZGLB 1IKFH 3OKKB 3TZVB 1XT5A 1NCUA 1UM4L 1KEMH 2IANA 1XR9B 1U3HD 1VACA 5BMFL 5ERWB 4ZUTB 1AGCB 2NY4C 4QOKB 1NGWA 2Y72A 3B2VL 1A7BA 2FR4A 3MLXL 2ZJSL 4Z18A 3ULVE 5E03A 3NIDE 2WINB 1U8OB 3S37H 2W9DH 2DLEA 5C0CA 4JG1H 5TE6H 1YEEH 4X6BB 1KPRA 4XMKL 4LVOB 1OCWL 2R2BA 3QEUA 2WBJB 4GAGL 4FQ1H 1G7QA 4P59L 3EW3B 3RTQC 2EDEA 5DXWA 1CXIA 1I3GH 2EH7H 4UINH 3CFJA 3FT3B 4KKBD 2VLLB 3FCTA 2E9JA 3E2HC 4TSAH 5JW4M 3TV3L 5EUKA 1RMFH 3DBXB 4LHUA 4MB3A 2DQJL 1KPVB 4JAMA 3AREC 2VDKL 4N0YH 5A2IH 3DETC 2X1PA 1JGVL 3ISWA 5IW3A 1ZVSB 3T0VA 3BEWB 3GSUB 3BIBX 3RVVD 2IANE 5MEQA 4XP1L 3WFCL 4DAGL 4M4RA 1VPOL 1Q72H 5IESH 1IGJB 3ABZA 5FF6A 3LKSB 4NC1C 4LIQH 1IAOB 3RVXC 1JV5B 3EBAA 4NHUA 4N0CD 1NGYB 2IC2A 3QQ3A 4IRZL 5FGCB 3H9SD 3CDFA 1EHAA 1E4XL 5C0CE 3SY0B 4GRWH 2WLZA 2IQAB 5L2KB 3V6OA 3LS5H 1ZLSL 1A1MB 5JO5B 3VGGA 3RBSA 3SKUD 1S5IL 3BPLB 5EZLA 3BT2H 3AS1A 4OF6A 4LSQL 4TTDC 1N5AA 4Q9RL 2ED9A 4KMTH 4M8QA 5EOCH 5C0JB 3I02B 4BKLA 3MRQA 3VCLA 4XCNA 1OP3H 4G8FA 1A4KA 4IS6B 3GJFH 4M7LH 3C60C 4O4YH 4NCC1 4G9FA 4Y2DC 3NIFE 3MBXL 1M71B 3SPVB 2ZUVA 5CZXC 1RZ7H 2X4RA 4L4TB 4KUCD 5FB8A 5HJ3A 2O5ZL 4X99B 5HYEA 2ICWI 5D93B 3QUKB 4U1SA 1FIEA 2VOTA 1HILA 4D8PA 2V17L 4MCYB 2X4OB 2X70A 4HH9A 5T1LA 2VLKA 4IJ3C 5DQJB 1H15A 1G7PA 3BN9D 5JXED 4KHXL 3V6OE 4ZTOL 3QRGH 3OQ3B 2XY2A 4E5XA 1A2YA 2VDQL 3IVKA 3ARFC 3TA3C 4F8QA 1T2JA 5TGBA 5DTFB 1T0NB 4U1NA 1FC2D 2JF1A 2NYYC 3CU1A 3STZA 2VDPH 3E6FB 4QHNA 4ZO6A 3WS6A 3CAFA 1KB5A 4JM2F 3TO2A 3KYMA 4MMXC 3SDXB 3LQZA 3D85D 3DUSB 5IB5A 3IDJA 4GKSA 5IW6A 1X5JA 5KANI 4HZLB 3SKOA 1KELH 4NOBA 3K2MC 4X5XA 2HJLB 2W9LA 4G9FE 4N0RA 4L3AA 4OF7A 3CLFH 5IB4A 2VXQL 5CGTA 1DR9A 3P0GB 4LSRH 4JM2B 1BOYA 4NKOB 5H94B 2BY3A 1LGVA 3ARBB 5ETUB 4ACPA 1VKXA 4NRYB 3WFBH 1IGMH 2PW1B 1ED3B 3FQWB 3VFVA 2XN9D 1QLEH 4KI5F 3H0TA 2UY7A 1DLFH 2VLKE 2DDQH 4XP5L 1GYAA 1J8HA 4N8CL 2C3GA 3KPPB 4ZNCD 1LNUA 4G6FB 4GUPB 1NFIB 1KCLA 1SYSA 3VFGL 4ZOEA 3D39A 1T5WA 5TFSH 4JZJC 3JWDH 1FNGA 2XXCB 4KK8C 2MQ0A 2EO9A 5EOTB 5M94B 5F1IB 1F58H 2B7DT 2ZPKL 3LEXA 3RAJL 5IBUB 3VA2C 1A1OB 3HE7B 4WV1C 3IDYB 3QDJA 4APQC 4NKMA 3SGEI 4YDIL 3CH8A 3UYOD 1FZJA 5CZXD 1KPUA 4OKVA 5E0QA 3SJVB 4XP4H 3QXDB 1MSPA 4PUBH 4P5TC 4X80H 4JO3H 4J3TA 1IE5A 1KFAH 3R8BB 3IU4L 1K4DB 4HUKB 2M8XA 3WV0A 2Z0BA 1CTNA 5FA4A 2NY7H 4ERSH 3MV9B 1J8HE 5KG9A 5CP3A 5FAAA 1JNNL 3QEGH 3S96A 3WNNA 3LPGA 4WTZA 4P2QB 2DI8A 4XMLH 5ACLA 1LVEA 1S9XA 3D39E 3LKQB 3KPQA 4BH7B 1K85A 2IFFH 1S7XA 5C07D 3VFNA 4XI5D 4PD4J 2IWGA 4NPYB 3JWOC 2HJKA 2EIZA 3BGMB 1J10A 5T3XE 4NRXA 1NAMA 2Y7QA 4PGDB 4G6JL 1FFPA 4H88H 1A6TB 3DVNA 2D7MA 3MNVB 3QDJE 1KJVB 3SE8L 3HI1B 1VERA 2BVPA 2XY1A 2A1WH 2HFGH 2WWMC 2VH5L 1DBKL 4N9GA 1DANT 1Z0NA 2EZ0D 5GRYA 3W11D 3NIFF 2J4WL 1HYSD 2EDKA 4NN7C 5FCUH 5L8LB 3VD3A 2EXWD 3HFML 4GMTL 5DHYA 1MCSA 3RKPA 3I6KB 5CEZE 4HUWB 5BVPL 4Z76B 2VE6A 1X4XA 1EJOH 1FZKB 3V79C 1CDHA 2H9GB 4L4VB 2UUDH 3ILPA 1YYML 1OPGH 2KKQA 4MA8H 3HC3H 4J8RB 2Y06L 1U2CA 1CBVL 5K9OA 1G9ML 3ALXA 1I7UB 1XIWA 1I1YA 1ZTXL 2YD5A 4WI9A 1R3LA 3RHWF 2HVKA 4M7JH 3MRLB 3FZUC 3RGVD 1F4YH 2G75A 1EHNA 2DQUL 1K6QH 4X5WA 1MNUL 3GBNH 4MAYB 3BPNC 1E0OB 1QBLL 4HMCA 4XHJD 4OFYD 5LGKA 3FQTB 3HE6C 4PP1C 2XYCA 3M17B 5EIIA 5I1KL 1U3HA 4U1IB 4OB5L 3ULUD 3V0VA 1FBIH 3O2DL 5FYKE 3SHSA 5HBBA 1TQCC 1G9EA 3MA9L 3KNBB 4P5TD 5CKAA 3MNWB 2XICA 2XFXB 5EZIL 5BV7L 1GXEA 1KTLA 3JV4A 5EOQH 4HGKC 3ARZA 1DSFH 4JRWA 5FHAL 4UDTB 1I1AD 3O11B 3U46A 4UT9L 3R4DA 4FNLL 2VLRB 2V5RA 2BOBB 1MCFA 4ZXBC 1J18A 5I73C 1Q0YL 4LOUC 4MLIA 3VXMB 4ZUWB 1NMBL 1NC2D 5HDOA 4DTGH 2ATKA 3GHEH 2ZNXA 4F7PB 5KVDL 4HLZH 1PZ5A 3VI3E 1FCGA 1QSEA 4IHOB 5DJCA 3OPZL 4YC2C 4ZPTA 1K8IB 4QF1B 3DSFH 5AD0A 4MQXC 1AQKL 1UZ6E 3O3EB 1HCFX 4WIQA 4X7FC 2OBGA 2UY6A 5EFIB 1T1YB 2BDNH 3FMGH 3R06B 3QHZH 3MXWH 2F54A 3MREA 1VCAA 2AEIT 2NCMA 3H9SA 4XWOC 3C5ZD 1IAIL 3FO2B 1EIBA 1CICD 3HC0B 2X41A 2A38A 4I18B 3K4ZA 4MQ7B 1A0QL 1JPTH 3CMOL 4KFZC 1V5JA 1S9VA 2IJ0C 1HOCB 2X4SA 3VG0H 2Q86A 3O2WL 4MJ6B 4XBGB 3IXTA 1G9NL 1J0IA 1FO0H 2RAMA 2NZ9D 3SDCD 5DD3L 3ROLA 1GGCL 1IARB 5GIRB 2Y4SA 4I9WE 1E4KA 1FPTH 2FH6A 3H3BC 4JQXA 1BLNB 1KIQA 4D9RE 2BSRB 4OTXH 1QSEE 2B1AH 4ZTPH 1IFHL 4ZPVB 2YPLB 3DMMC 4KHTL 5HHMB 1K5NA 1F90H 1MWAB 5SWZD 2IAMB 1KCVH 3IFPA 4ODVL 5ID1A 1XGYH 4NQDB 2OZ4H 4ZUSB 2NR6D 2ENYA 4ZMAT 4LASL 1S8DB 3D2UA 3GSNH 3LZFL 1R5WB 1FLRH 1Q0XH 3NPSC 3IDGA 4OLYL 2F54E 2OJEB 4A6YL 2I60H 1NC4B 4QTIL 3NABH 3WO4B 3H9SE 3I9GH 4IDLA 4NQVA 1UM5L 2X1QA 4P4KB 4K3JH 2FBOJ 4P2CG 5D7JD 5DVKA 3U48A 1J1OH 4HEPG 3GDBA 4WFED 15C8L 3MXVH 3RTQA 3B9KD 5JMRA 4OLUL 5T5NG 3F7YA 1Q9OA 1ES0A 1TPXC 4AM0B 4JE4B 3D9AH 3UTTB 3T2PA 4KY1H 1TZGH 2H3NB 3CU7A 5F9OL 3HLAB 2B0SL 3AREA 4WWKB 4P3WA 4Z95L 1RZ8A 3GMNA 3T0EC 4RNRA 1KBGL 3P0YL 4GRLB 5GSVB 1HI6A 1NBZB 1A9EB 4MQXD 4ZS7H 4EOWH 1QO3B 4GJTB 1Z2KA 2NNAB 1QUNA 1FZMB 3MX0A 5IG7A 5F8RC 2BCKA 1J11A 2JK5A 1RJYB 5B8CB 2OLDA 4YO0B 1B0RA 1NDMA 5HYJD 4YDVA 1C12B 1G7JB 4K94L 3HC4L 5IMOB 3LDBC 1ADQA 4PJ8D 4XWOD 3EGSB 1BFTA 1M6OA 4RX4D 1NFKA 5F3BA 3FB8A 5DD0H 2FECI 4HJJH 5DA0B 3SN6N 4P2OD 4WTWA 4GS7B 1F4XL 4QT5A 3MOBH 3QPXL 4UTAH 4RFOH 3MMEA 1YQVL 3NH7L 5C0BB 2X40A 5LAXA 3U0PA 5C7XL 2JB5H 4HGMA 1H3WM 1OF2B 3WXWL 3ESVF 1U91A 5FYJH 4YDKH 1RURL 3F7RA 2A6KA 4RBPH 2H2SC 2D7PA 3D0VA 4PJIF 1IGTA 2OTUB 5EU7C 4Z7QF 5F7DB 1Y0LA 2X42A 3C60A 2AI0L 4Y2DA 5TDPA 5IB1B 4LLUB 5FA3A 3CDGB 2J8UB 5I1IH 1TJGL 5I0DA 4F33A 3QQ9D 2P5EB 1MEXL 4MJ2A 3SGJC 2X4UB 4L9LB 1CGUA 3JTTA 1FJ1A 4PJIB 5GS3A 2VDML 4YGAB 1Q94B 4PJ9C 4NC1E 5IIEA 1A5FL 1CI5A 1GGUA 3RZCD 2DQEH 1BD2D 4R7DB 3GMQB 3VFOB 3W9DA 4WDIB 4UIMA 3MOQA 3P40A 1Y18B 5GS0L 4JDTH 1BVKB 3RX5A 1FSKC 1DN0B 4JFFD 4NQED 3ARFA 3Q3GB 3QA3B 4K9EH 5E8EB 4PGBA 1V7ML 3TA3A 1FG2A 5JR1L 3SGKC 4K7PY 5I0ZA 2W59A 1HSBB 4P2RA 5C6PB 1GC1H 2NY2D 2CKBH 1YYLH 2Z91A 4NP4L 1OOAA 3IRPX 1YNKH 1QYGH 5IEKB 2DN7A 1CZ8H 2VQTA 2H32A 3WEXA 4Z7OF 4L3CA 1FV1B 3DV4A 4Z8FH 2P5WD 1FNSL 1CXEA 4XP6L 5HVHB 1WBZA 4JO1L 5BVJB 2Y5TA 1KGCD 3LMJL 1CU4L 3GO1H 4R0LB 1PEWA 3VRIB 4XCYA 2ARJB 4YXHH 2A73B 1T0PB 1MOEA 3OZ9H 3RPKA 1UEYA 4N90E 4MNGA 1EXUA 1QTYT 1G7IA 2RCSH 3CFIC 2W9EL 3G5XA 3EOBB 2Z92A 5I75B 1VGKB 2G2RB 4JLRB 2UZXB 3KJ4B 2HYMA 4JPIA 3P9LB 1HDMB 3FO0L 5CBAA 1I3RA 5ANMA 1X4YA 5HHQA 2NX5A 2YKLL 4EVNB 12E8H 4JVWA 4RZCA 2V7NB 2ZCKH 1QFUH 5IFAH 4ENED 4MAUL 2BJMH 4NCDA 4P2RE 4U05A 2QTEA 1UQSA 2NY6D 4H1LH 4XB8A 2IH1A 5F6HI 1AXSA 1KJ3H 3ZE0E 3IDXH 5L88L 4OFYA 2R0LL 3NTCH 4OIBA 2A9MH 2JELH 5ICZB 2BZDA 4WV1A 1RK1B 1RD6A 5I8OL 3E6HB 4XPAL 1YEKL 4PRBA 4APQA 1OGTA 3LD8B 5H35B 2ZUQB 2BVQA 4MNGE 1MAKA 4P5TA 3BH8B 4F7TA 2VB5A 1H3PL 1NKRA 4PJ9D 3L3OA 1A6UL 4KUCF 4GH7B 3CZJA 1H9VA 4JN2B 3DURA 4K3HA 3S4SG 5JPMA 4LLMB 2APFA 3BP6A 1FNEB 4FZ8L 3MLSH 3OL2A 3MRGB 4OLVH 8FABB 3MRKA 3HZMB 3CNKA 3U0TB 3QUYC 1YNTA 5DUBB 4OD3H 1YEDB 1CWVA 3HPJA 5JLZA 1TJIH 4HFWB 1CXLA 3DVGA 1JPSH 4HK3N 2NX5E 5ANME 4BA8A 3FN0L 5D1QD 4OQTA 4QRTA 4OFDA 2HAZA 1GAFL 5DK2B 3GIVB 3GI9L 4YHLH 5CEYB 4QXGH 1B0GA 2ADGA 3SKNB 1U42A 5MEPB 1HSAA 4JVUA 4M7ZB 4XCCL 5TQ0L 1TZHB 4F15C 1JN6A 3OXRA 1IBGL 1ZWIA 5DMIH 4HUVA 4ZUUB 5HHOD 4DGIH 4MS8C 2A9NH 2E5EA 2MMXA 1OSZA 4LNRA 4KRPB 1IT9H 3QI9B 1XF1A 3HNTL 1A9BA 1I1CA 2HP4A 3OAUH 4FP8H 2W92A 1EV2E 1PSKH 4HUNB 4AMKH 3BXNB 2VXUH 3I6GB 4FMKA 2EKSB 3TVMC 2IG2H 4IOIA 2Z4QA 1VSCA 3IJSB 4U3HA 5LXGH 3FTGA 3CVIH 4NZRH 4X7EC 5D6DC 5J12B 4RAHA 1UJ3B 1XAUA 1FIGH 3KXFD 2IMMA 3PQYA 4LCWB 1XCQA 2CR6A 2R8SH 4YDJA 3QQ4B 2LTQC 2DS4A 2NY0B 1OLZA 2C1PA 2G9HA 3SCMC 5JORA 3GSVB 1VFMA 3REVB 3CH1B 2AJ3B 3IDIB 3GGWB 5IB3B 4TPRH 1E6JL 5SWQA 3HE6A 1CFSA 1PJ9A 3WSQL 1ZS8B 4EI5C 3T1WA 4H8WC 4WFFD 3D25A 4U6YB 4PRHD 3TNNB 1I7ZB 4Q74A 1KJ2A 4M93C 1L6XA 2FHCA 1PY9A 2D2OA 5GGVL 3WFDH 2A83B 2AK1H 3LHPH 3OR6A 1LEKB 1NH6A 4HKBA 2R2EA 2C4FU 3A6OA 4LCYA 4LMQE 3IXAB 3TCLB 4JHAH 4NYLA 3DECA 3AS2A 3HPLA 3D18A 1IM3A 4RWYL 4ZXBA 1AP2A 5D6CB 4HUUB 5IQ7H 1Z5LB 5F21B 2OQJA 5DYOA 3C9NA 3KPSD 5JHLH 1D5BB 2NTFB 3GRWL 3QO1A 3PQYE 2H6PB 1FFNB 3SDDD 2Y07L 2W0FB 1RUML 3QZWA 5CJ5A 2ADFL 5IMKB 3RVWC 4C54A 1A47A 9CGTA 5HHPB 1BWMA 4PJHA 3GMLB 1DVFB 1KCKA 2WUBH 3TBVB 1FAIL 1JPFB 5EC1B 3SE9L 3EYUL 3QUZB 1DE4B 1KOAA 1SMOA 2DM3A 3PXJA 4FQXB 4BSJA 2BSTA 3OTTA 2OL3L 3ET9F 4OBSA 4GKNB 1J8KA 3BPCA 5C07B 3QUXB 1CGVA 1TVDA 3T0WA 4MQSB 4OCSL 1RU9L 3WNOA 5CJQH 4DQOL 2WIIA 3SKJL 5HVWA 5HXMA 1OAZH 1F6AB 4LVEA 4NWTL 3CCHA 5FOBA 1YEIH 1IZKA 5BRZD 1BFOB 5EPMA 4QWWD 3DROB 1CDGA 2HTLC 4FQIH 3P4OB 5GRZA 2FX8L 4AG4L 4GXVL 4Z0XA 1HYRC 5LQBH 4C58B 3T09A 5E5MA 2CGRH 1CCZA 3ARDD 2A74B 5FYJU 4GAYA 4HKXB 5HHXL 3OSKA 5FUOH 3UROR 5FIEA 4PLNC 3S3PA 4LCCB 3TT1H 3TH4T 3N06B 2FEEI 3GB7B 3MRHA 4OCXH 2MJWA 3DI3B 4PJHE 4WI7A 3TH3T 3DMMA 3ROOB 1FP5A 1BBJB 4G7VH 1UYWL 2NXYD 2GT9A 2NY1B 3BKML 5KSAB 1F5WA 4TOYL 4FFWD 2QADD 5HY9A 1MRCL 2GEEA 5B3JE 4X6DA 1L7IH 2K7QA 1NSNH 2GK2A 1BD2A 5DQ9B 4FQLH 4DGVH 4WW2B 3ULUF 3UPAA 4XPGH 3RGVB 2GY7B 4LEOB 5EO1B 5IKCA 4QHMB 3OHXA 1NGQH 4AIXA 3OG4B 2XRAL 3HAEG 2R2HB 5JOFB 4JFFA 4XAWL 4NQEA 3N50A 4PGJA 1PKOA 4G8GA 5D72L 4HPYH 4MA1C 4LLVA 3T0AA 4I0PC 4LDOB 1RIHL 5E4EB 1JZ8A 4X6CA 5TF1L 3LN5B 1OAKL 4Q9QL 4ISVB 3TT3H 2P5WA 4GOSA 4J4PC 5GGTL 2YC1B 3WFHA 1JE6A 2ZSVA 3SDYL 3T0EA 1M05B 3QWOB 1N5YH 4S0TD 1WEJH 4LPYA 1Z0MA 5EA0L 4R96B 4LLQB 1WAAA 1HK6A 4OM1L 2H2PC 4LQFL 4YGVA 5JHDA 1FAKT 4FRWA 4K3EL 4XVUC 3IAQA 2GFBB 3NFSL 1NC2B 4X6DE 4HS3B 5DJAA 3FQXA 1LP9A 1BD2E 1WTGT 5HYSA 3Q6FA 1T20B 2CLZB 5J57B 1NANH 1NCDH 3W81A 1YUHB 1ZHLB 5F3HA 1AY1H 2Y23A 4G6KH 4PG9A 4OCMC 1JWSB 3RPIA 3UTPD 2VISB 4HSQA 1PLGH 4R8WH 1FL5A 4D0DA 3NCFB 4L9DA 5SX5K 4CVXB 4JFFE 5T33L 1PAMA 4NQEE 4E42B 1ORSB 5HDQL 3I75B 3KPRD 3V6FA 4G8GE 3MLVL 3MGTA 1GGYA 1H3VA 1WFNA 5GGSY 3IGAA 1N59A 3KR3H 4X6CE 3C5ZB 2DM4A 2GTZA 2P5WE 3Q6GL 2QLVB 1IJ9A 4TSBL 1OVZA 4NJ9L 2VITA 1KGCE 4XC3H 3T0EE 4X9FA 2VDOL 4QY8A 1N6UA 4XVJH 5TQ2L 1WAAE 2B8OT 3EYVA 4LGSB 3BD4A 3ZL4H 4Y2OA 3KPNA 3SGJA 3IS0X 5JHDE 3SDCB 4JB9H 3TYGL 1PGRB 3QXUA 4PJ9A 1LD9B 1LP9E 1T4KA 4YZFF 2QQQA 4GW5B 3MUHL 2ITDB 5I1HL 3FB5B 3JV5A 3HI6H 3L6FA 4FZEL 1UC6A 2OSLB 4M1CC 5SWZB 1EEYB 5IFJA 3TWCL 5LGHL 3FQNB 2Q3ZA 5D1ZC 4ZS6D 1DBJH 2D7TL 2B39A 3PWJB 3S3JA 2JCCA 5D1QA 2P8LB 3SGKA 4EDWH 4DN3H 4KXZH 1CFNA 2HLAB 2B2XL 3UTQB 3GI8H 5E9DD 4KU1A 1AGBA 3C5SA 5GS1B 3GJEA 3JZ7A 3KLHC </