3BXOA

Crystal structure of streptomyces venezuelae desvi
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
236
Chain Sequence
b'YEVDHADVYDLFYLGRGKDYAAEASDIADLVRSRTPEASSLLDVACGTGTHLEHFTKEFGDTAGLELSEDMLTHARKRLPDATLHQGDMRDFRLGRKFSAVVSMFSSVGYLKTTEELGAAVASFAEHLEPGGVVVVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRMEVHFTVADPGKGVRHFSDVHLITLFHQAEYEAAFTAAGLRVEYLEGGPSGRGLFVGVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N,N-dimethyltransferase
publication title Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Transferase
total genus 78
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.1.1.234: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.10 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases CAC2371-like domains 3bxoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bxoA01
2BZGA 5GINE 1NW7A 3TRKA 5EKUA 4R8RA 4E2WA 1KPHA 4M37A 1UWVA 2VDWA 5E8RA 4G56A 2IIPA 1ZG3A 3EVZA 3M6VA 3FUXA 4E32A 2AN3A 3P2IA 5CCBA 2PXXA 2O57A 5DTQA 5U4XA 4RTJA 1VBFA 2PX4A 5LQAA 5IKMA 1AV6A 4WXHA 3F4KA 2QM3A 4RTMA 2ZVJA 3X0DA 2I9KA 4YV0A 4EQZA 3DR5A 3EVDA 1XCJA 3LHDA 4YMHA 2OY0A 3R0QA 5KS2A 4DA4A 3OU6A 1JG4A 2CMGA 5T64A 3CGGA 5HZMA 3KQOA 4DM3A 5EOVA 3HEMA 4QTUB 2PKWA 3SSNA 5E9QA 3BKWA 4OQEA 4ER3A 5GM2A 2XVAA 3MERA 4RVGA 1XVAA 2HMYB 4YUYA 3A7DA 2NP6A 1D2HA 1NW8A 5CCXA 2IPXA 4PGGA 3MGGA 2EJTA 3BZBA 3HVIA 4BP1A 4CKBA 4M36A 3KPWA 3HCCA 3I64A 1KYWA 5EHIA 1XDSA 2G71A 3NW9A 1HMYA 3GRUA 1R00A 1HNNA 2VS1A 3R9XB 3SGLA 3EGIA 2YQZA 2PT9A 1U2ZA 1UFKA 4GC9A 4P7FA 2JJQA 4QPNA 4GF5A 5BXYA 3D2LA 3OE5A 5JUWA 1SQGA 5DX0A 3I53A 4DZRA 4RTPA 1G55A 4E2XA 2UYQA 3KQPA 3SM3A 4C05A 3C3PA 4HSGA 2IP2A 3LGAA 5EEHA 5P8WA 3DULA 2Z6UA 3NVKI 3O4FA 4FT4A 4PYOA 4ATNA 5DLYA 1QANA 3SXJA 2I6GA 1WY7A 1NV9A 2WA2A 1RI2A 4P7JA 5FUBA 4POOA 4RTSA 3QOXA 4RTOA 4C07A 2ZZMA 3C0KA 3KQTA 4BY9E 4P7KA 4R6XA 3VSEA 4HC4A 2B2CA 5HILA 3BGIA 3FTCA 3KR1A 3DOUA 2AOWA 2NNWB 5EMKA 4Y2HA 1F3LA 1RJDA 2K4MA 3SVZA 2Z6AA 3LKZA 2ZBPA 1KIAA 3PVCA 3PTAA 3KQQA 3P9NA 5C9ZA 2NXJA 3EVEA 2P40A 2WA1A 4X41A 3HVJA 4RTQA 5BW5A 5K0LA 3EVGA 3A25A 2UYOA 4F84A 3TMAA 3GDHA 5CVEA 1XDZA 3FZGA 3A26A 1Y8CA 5E8JA 3EVBA 4EKIA 1NW5A 2PT6A 3UJ6A 2KW5A 1H1DA 5GM1A 2NP7A 2A14A 1JSZA 3AXSA 5GOZA 5C1IA 2PV0A 5DPMA 4CTKA 3A27A 3G8AA 2VZ9A 5ICCA 3I58A 1BKYA 2P3OA 3BWYA 4A6DA 3G89A 2XYVA 2CKDA 2R6ZA 5DM2A 3I5UA 1Z3CA 3SMQA 3KQSA 5E1BA 5K0EA 5HIMA 1M0EA 3FPFA 3ANXA 3EGVA 4FGZA 1SVUA 4PCAA 5MHTA 2P3QA 1SQFA 3MAGA 3C6MA 3NVMB 3GIWA 1JG1A 3KQVA 5H02A 5DTMA 1P1BA 3KHKA 1G6Q1 1RI5A 2PX8A 5FHRA 3UZUA 5K05A 1R18A 1VQ1A 3TM5A 1SG9A 1JTEA 4ER0A 4P7GA 4RTRA 3TPZA 1QZZA 2ZWAA 2BH2A 3THSA 4E2YA 2NXCA 1AQJA 3M6WA 4IWNA 3LECA 4RX1A 4CKCA 3S68A 3Q87B 3NDIA 4RWZA 4ER6A 1WS6A 2O06A 3IHTA 3LCVB 3CJRA 4P58A 1NT2A 4IV8A 3FPJA 3MTEA 2JH8A 3T0IA 1QYRA 2E5WA 3HCBA 3P8ZA 3SR4A 1F38A 2GA9A 2V74B 1TPYA 3GXOA 3KKZA 4X60A 4CKEA 3ME5A 3G2QA 3O7WA 2I62A 3HA5A 1KYZA 3UJDA 3MCTA 4H0NA 3PX3A 3HM2A 3FYCA 1EAMA 3TKYA 3G8BA 1NV8A 4YV2A 3P71T 4MIKA 3REOA 2YUIA 5EZSA 1R6AA 3DXXA 2YXEA 1X1CA 3OFKA 4FZVA 3TLJA 7MHTA 1FJXA 1NE2A 9MHTA 1EQAA 3G5LA 3KPJA 3ER8A 2OB1A 2P1DA 4HH4A 4KDRA 3DMHA 5FQNA 3UA4A 5K0FA 1O54A 2GAFA 3R24A 3R6TA 4RVHA 4QTTB 5FA8A 4OX9Y 4C08A 5E9WA 3UWPA 2BM8A 2QYOA 4EMSA 2Z6QA 3NMUF 2PGXA 2ZW9A 4EKGA 1M6YA 1SUIA 3KQWA 2GLUA 5E2BA 2FYTA 3G2OA 1RI4A 3LDUA 4AZWA 5EMMA 2AOTA 3ERCA 2PLWA 2QE6A 4KVZA 4WVLA 4FR0A 1NKVA 3R3HA 3QOWA 5FQOA 2ZBRA 4GBED 3SSMA 2FK8A 3FPEA 4FT2A 1RI1A 1EJ6A 4E30A 2N47A 3ER9A 3LBFA 4NECA 4CTJA 4OBXA 4UOEA 2ZZNA 3B3GA 2VDVE 4PYNA 3AXTA 3KR0A 3HCDA 5EEGA 5FHQA 5F2NA 2GS9A 2B78A 1YFLA 2HWKA 3M6XA 3TR6A 4DF3A 4YV1A 2PXCA 3H2BA 2PY6A 3CC8A 4PYIA 4V0QA 4V0RA 4ZTBA 3CKKA 2CWWA 4IKPA 1D2GA 3CJTA 4JXJA 4O29A 5DRTA 5EGSA 1JQDA 2GH1A 3LL7A 4EK9A 1NBHA 2FHPA 2OO3A 3FRIA 3K0BA 1P39A 4X63A 3FUUA 5CIYA 5F2KA 3LX6A 1L3IA 1JQEA 4AX8A 5EMLA 3M4XA 1AF7A 2VDUE 3JWIA 5FA5A 3TKAA 3G88A 2AVNA 5DM0A 5DXJA 3ORHA 1SKMA 1VLMA 5DX8A 2PSSA 2PWYA 3OZRA 3V8VA 1L3BA 2AZTA 3EGEA 2ZWVA 3EVFA 5CVDA 3B89A 3O31A 3CVOA 2O05A 4DKJA 3LBYA 3M6UA 2YXDA 3IYLW 3TQSA 4CXMA 5DM4A 4AZVA 3EPPA 3CCFA 10MHA 3C6KA 4IV0A 4QQNA 2IH5A 1DL5A 3OE4A 5BP7A 2JHAA 3NWBA 3E05A 1UIRA 1B42A 3BWMA 3T7TA 2YTZA 4R05A 4BLVA 1VL5A 3HVKA 2EJUA 1ZKDA 2JHPA 3G2PA 3ID6C 4YUVA 3RW9A 3UJAA 3CBGA 4DMGA 1Q0TA 2HR1A 3ELYA 3TM4A 3BGDA 1QAMA 3E7PA 2AS0A 4YMGA 4YUXA 1P91A 3BXOA 1RI3A 2BM9A 2PXAA 4KWCA 1EJ0A 4OA5A 4FS8A 4ISCA 4X61A 2C7OA 3UJCA 4LECA 4KIGA 2BR4A 3PT9A 1ORIA 3DMGA 2XBMA 1R8YA 1X1AA 2AOXA 3BUSA 3KPYA 4L7VA 4LG1A 5LQKA 3GCZA 3GU3A 4KIFA 1X1BA 3HNRA 2OPBA 5ICGA 5CVVA 4X1OA 2WK1A 4MQ4A 5ERGB 1JG3A 3HCAA 3UJ9A 2JHCA 4PYQA 1N2XA 2YXLA 3JWHA 3NJRA 4RV9A 1SUSA 1WXXA 3OPNA 2ZSUA 1DUSA 4LWPA 4XCXA 1X19A 3FRHA 3E8SA 5K09A 2AOUA 2I7CA 3HVHA 4QDJA 1YZ3A 2AN4A 3JWGA 2UYCA 3AJDA 3LSTA 2OZVA 2PVCA 1AQIA 2ZLBA 3KPUA 4M38A 4RTLA 1TW2A 3MHTA 5EHGA 5FWAA 1L1EA 5DSXA 3KR9A 5CM2Z 5EQJB 3EVCA 5FTWA 5HIIA 2ZTHA 3UBTA 1NBIA 2IH2A 3NTVA 2O07A 4GC5A 4XUCA 4E33A 1M6EX 3P2KA 4QVKA 3UJBA 1RJEA 3CJQA 4C03A 1YZHA 1VP3A 3FPGA 3SX0A 5CVUA 3IEIA 3U81A 8MHTA 3BWBA 5DSTA 2JG3A 5LSAA 3PFHA 1PRYA 4KRGA 5LQNA 4RTKA 5EPEA 5LQUA 1FP2A 5E2AA 4BP3A 5G02A 1Q0SA 2Y1XA 2C7QA 5FADA 3SSOA 1L3CA 1R74A 1KXZA 3KR2A 5KQSA 2FRXA 5K0NA 2P3LA 4C4AA 3EEYA 4RTNA 2F8LA 3I9FA 1XTPA 5E1DA 5BW4A 3HA7A 3BGVA 2Q41A 1G8AA 1YFJA 5K01A 2NXEA 5DM1A 2PX5A 4PYLA 5FULA 2EG5A 4GUAA 5T67A 1EG2A 3KU1A 3Q7EA 3UFBA 1XCLA 4RYLA 4PYKA 4B17A 4PNEA 3BKXA 4LWOA 3DTNA 4C04A 4ER7A 4EVIA 1WZNA 3DXZA 4YUZA 4Z2YA 2FCAA 1I1NA 4HGZA 4QPPA 3GRZA 5ICFA 5GP1A 5KYGA 3VYWA 1BHJA 4GOOD 2P41A 1KPGA 1KPIA 3GRRA 5EKXA 4OQDA 3GO4A 5FWDA 1MHTA 2B25A 5HOQA 5JR3A 2DPMA 4FSXA 5HIKA 1I4WA 3GGDA 5E1MA 3GWZA 2CMHA 3RODA 2B3TA 2OKCA 4HG2A 5LQCA 3EVAA 2ZFUA 1YUBA 2AOVA 2GPYA 1IM8A 1X1DA 3LCCA 2G72A 4RVDA 2VP3A 1MJFA 3IV6A 1QAQA 5HEKA 1ORHA 5E1OA 2QRVA 2UYHA 3GRYA 3T7SA 3G5TA 2IBTA 2YVLA 3LDFA 1VPTA 1JR4A 2G8NA 1ZQ9A 2IBSA 3TOSA 3VC2A 2ZIEA 1ZGAA 2IDJA 2OB2A 3OU2A 4KDCA 3G2MA 4PYMA 3P2EA 5GIPE 1D2CA 2ERCA 2O0LA 4PONA 5DT2A 5CD1A 2YX1A 3V97A 3GJYA 5DRYA 5D1HA 1I9GA 2Y1WA 3MCZA 2QY6A 5E9JA 2IFTA 1O9GA 1RJFA 3P9IA 5EZQA 1JSXA 4HTFA 5K0BA 3JWJA 4DCGA 5T6BA 1NW6A 3E23A 2AOUB 4M7RA 1DCTA 3PS9A 1FP1D 2G1PA 5LQRA 3M70A 3QV2A 4GOND 1G8SA 2HV9A 5CUQA 2XYRA 5IH3A 1WG8A 1TW3A 3KQYA 4YUWA 3C3YA 3B3JA 3BT7A 4K6MA 2EX4A 2ONZA 2OYRA 2YR0A 3DLCA 3HCFA 3EMBA 1FBNA 4E2ZA 3FYDA 3UA3A 1QAOA 3P9CA 2ZZKA 2G70A 1KHHA 3LPMA 2HNKA 3EEOA 2OXTA 1KP9A 1VE3A 3PLAE 5M5BA 4GOLD 4F85A 5EMJA 5CVJA 4HRAA 4RVFA 4KW7A 3UJ7A 3GRVA 4PIMA 1EIZA 4XUDA 4QVGA 1P1CA 2AN5A 5GIOE 1JQ3A 1O9HA 3KPVA 4MTLA 4U7TB 5C0OE 2OBFA 3DH0A 3M33A 5KVAA 5EIFA 3TFWA 4CWAA 2IDKA 3NDJA 3P9KA 4MHTA 1T43A 3B5IA 2ZULA 3DMFA 3B7PA 3HCEA 4PGHA 3G7UA 3DP7A 1WXWA 1ZGJA 1XXLA 3OZTA 3WSTA 2IH4A 5EVJA 4C06A 2ZBQA 4QQKA 4AUKA 5EC8A 2PWPA 3A7EA 3HTXA 5DX1A 4GQBA 3MTIA 2EFJA 2H11A 2NYUA 4FP9A 3T7RA 3OU7A 3DXYA 2LD4A 2C7RA 3LKDA 5B1SA 4BLUA 2BR5A 3K6RA 3GNLA 4XUEA 1KR5A 5KQRA 3BWCA 2AOTB 3EMDA 3MQ2A 1JTFA 5K0GA 3FUVA 4DCMA 3PB3A 3THRA 3DLIA 1ZHFA 4GEKA 1VP9A 1YB2A 2ZCJA 3AWIA 3PFGA 3FTDA 4PIPA 3NWEA 2FPOA 1RJGA 4AZTA 3KQMA 5K0CA 1BC5A 4R8SA 2UZ4A 1IXKA 2P7IA 3FPHA 3FUWA 4FSDA 5K8VA 2NXNA 5DXAA 5LR6A 2CL5A 2R3SA 3UJ8A 3ELUA 1YF3A 4MWZA 3DUWA 2C7PA 4OA8A 2P7HA 2DULA 5D1NA 2XVMA 2V7EA 2BR3A 1XJ5A 2PBFA 2QRVB 1L9KA 1PJZA 1INLA 3HP7A 4DQ0A 4F86A 3VC1A 3FUTA 2HTEA 3OZSA 4BLWA 3PX2A 2ORED 5HFJA 4PCLA 3OFJA 5K0JA 2AR0A 2ONYA 1R8XA 4Y30A 3RIEA 5EG5A 5DWQA 2ADMA 3P97A 1VIDA 2B9EA 3HA3A 2FK7A 5GWXA 4GOMD 2ZIGA 5F2OA 2PJDA 5DTRA 5K03A 3A4TA 3L8DA 4HTFB 1NW3A 4PINA 1G60A 1IY9A 4RSRA 4A6EA 2P35A 2IGTA 3FTFA 3ELDA 2GB4A 3B3FA 4E31A 2JH9A 5FCDA 2ZIFA 4ER5A 2P8JA 4R6WA 1N7JA 2H1RA 2XYQA 2PX2A 4QDKA 1N7IA 3AY0A 1JG2A 3MB5A 5EIWA 5HIJA 5ICEA 1V39A 4PWYA 4AZSA 3LCUA 1OR8A 3OCJA 1BOOA 2H00A 4OBWA 3LDGA 4HGYA 4PYJA 5LQJA 1FPQA 1XDUA 4E70A 1G38A 3FTEA 4U7PB 3ELWA 2ESRA 2AVDA
chains in the Genus database with same CATH superfamily
2IEIA 4P5DA 4HDSB 3ONDA 3H9UA 4DSAA 4XYEA 1XO1A 4BKUA 3D0RA 4K9MA 4EHBA 1FP4B 5D87A 2O8FA 3H5AA 1J07A 1BHQ1 1ZG3A 1BVYF 3SE7A 2RGYA 1LDYA 2OHXA 3HI6A 4TQ9A 1AOXA 5D5HA 2RC6A 4ARVA 1BE1A 2XRMA 2ZUTA 4OI4A 1N2CE 2GBIA 3BMQA 3NHYA 3R3JA 5TARA 2RGBA 4YCAA 5LZ5A 1Q20A 3NHPA 4ENSA 3KG2A 1XTSA 2A7QA 3PGA1 1W25A 5SV2A 3UAVA 1OTYA 2O0KA 5IAEA 1A4XA 4UHJA 5KKCA 3BIWA 4JVNA 1OBOA 5KS2A 1E0SA 1U0HC 3CG4A 4LOHA 1QVVA 1ADJA 4XJXA 1N25A 1GSHA 2XUFA 2V6MA 4QTUB 4B43A 1NY5A 5TT0A 4A4DA 3O0TA 1W59A 2FPGB 1UJ5A 2IRWA 3VYUB 4ZMRA 1DC8A 2KMLA 3K2IA 1GDHA 3R77A 1XZBA 4N8SA 4GKJB 3F7TA 5A5FA 4JA0A 4MQLA 3RRZA 2RH5A 2EWMA 4MQEA 4OH1A 4KQXA 1YS6A 1ZSVA 1GSOA 1ZN8A 3OEHD 3R6WA 3QVXA 1XDDA 3O75A 1ZAYA 1RZUA 1J49A 3L4BC 1ZH8A 2GEVA 2VJAA 4LNUB 5ALXA 2PUWA 3OE5A 4EKEA 5AUPB 5DYWA 5IS2A 2Q3HA 4H27A 2VPZA 1AIPA 3JQGB 2QK4A 4FQ7A 1YVEI 3EC2A 3UK6A 2ZM6B 4UNIA 4IJKA 2VDJA 3WX0A 4YP1A 3GH3A 1OY1A 3F5DA 5JPIA 1KJNA 1QANA 4AY5A 5LD2C 2NUPA 4HQ6A 3UWMA 1M8JA 1U1FA 3GVCA 1N1MA 3L4BA 3VSCA 1Y8QB 1EX6A 2P68A 3IAS1 3KB2A 4MQ6A 2JFBA 4C4RA 5JYBA 1X7HA 1I7QB 1T1SA 3R3WA 4BPBA 4MITA 1LLDA 1WCWA 4PR3A 3ZXYA 5JADA 3THWB 5C34B 3M6LA 3EHDA 3A0RB 5KKNB 1TYEB 4QSMA 3ABZA 4PZYA 4RH0A 621PA 1E0KA 3NALA 3SZLA 1Z63A 3VV2A 1MRSA 3V2IA 5PGMA 2JPDA 3VOTA 2O8DA 3WB1A 4CU5A 2HA6A 4JQYA 1MIOB 2YY5A 4BCDA 4OHYA 4LQLA 1QYCA 4P3YA 1YTLA 2ZYAA 4DSTA 1IWBB 1P3Y1 3PENA 4UD6A 5GM1A 1JSZA 3IIMA 1ETUA 2F43B 2JZNA 3GDGA 4TL9A 2AXEA 1KK0A 5TQ0B 1KU6A 2CL0X 1J09A 3HDTA 4H16A 3ZU4A 3LQRA 1V2GA 3E9DA 3G89A 1L7PA 1ST2A 1R9JA 1EG7A 2AGVA 3X1MA 1P18A 2O2GA 5EFOA 4CM5A 2G80A 3UCEA 5ALSA 3AR9A 4ZGWA 4V0MA 2BM1A 4RQBA 2NX2A 3GIWA 2JJ2A 1KWKA 2QTRA 2ORVA 3IQFA 3FOAA 3IT3A 5LYJF 1YHNA 1ZM3A 1Y8ZA 4WLNA 5K05A 3RQIA 2AFIE 4MWEA 3KXPA 4JR0A 5GV7A 4RF4A 3HU1A 1GAQA 2J9FB 5CM9C 2VTBB 2R87A 2UUCB 4K81B 5DDIP 3RS2A 1AQJA 3R7NA 3LECA 2Y76A 3D7MA 5LJIA 2P9BA 1D4FA 5DEOA 3A1FA 3BPSA 3OZEA 5JSYA 3TE6A 1UBJS 4QUJA 3DTTA 3QTBA 4R7TA 4XJVA 4IV8A 4OAQA 5EXDA 3V4VB 4F1KA 3H7IA 2HZ7A 2WIFA 4IDNA 1Q5PA 2HIHA 4B0PA 5BO5A 5JDIC 4HH0A 1Y9EA 4HI0E 1T8UA 4GPAA 4KQJA 3ZDYB 1Q15A 1WVGA 1JVGA 3TTWA 3BE6A 4XR9A 4U7DA 2JAHA 2WNHA 4H0NA 2VH5R 3HM2A 3RUFA 1JXMA 3FYCA 3LQQA 4N7RA 3I5YA 3QBVA 3MUFA 1V9LA 1Y9ZA 3CZPA 5DBGA 1FQJA 2O19A 1ZXLA 3IP8A 2BM0A 3AHHA 4N9WA 1PWZA 3R1IA 4Q19A 4RAQA 4NQRA 1R15A 3FPCA 5JDIA 2JLBA 5J3JA 1PT7A 2HLPA 1Z37A 2W71A 2PQ2A 4IZOA 2MOKA 4UHEA 4NF2A 4HH4A 4MIYA 5JD3A 3ER8A 1SBNE 1VL0A 2BMAA 3DMHA 2J59A 4LJKA 5EQTA 1KI6A 2ZJ5A 4EMSA 2FJUA 5CEEA 2HRBA 3CX6A 1ADYA 5E2BA 1XTIA 2FYTA 2FMXA 1W0KD 3QPVA 1OV4A 4L7QA 4Q3DA 2O3SA 4QOIA 4X7BA 2SCUB 3HJTA 2J0QA 2QE6A 1G2PA 3F0TA 5AKEA 4QOHA 3T5GA 3VGJA 2UZ0A 2JAOA 2UZ1B 4FOPA 4OK6A 2XF2A 3OCXA 3QUTA 4JR1A 1W581 5JQGF 4LBWA 3UMSA 4NR0A 3EBLA 3SS8A 3U1BA 1XXHA 3D4IA 1EJ6A 4YQFA 3ZXXA 4UNSA 3V4SA 5JVDF 1G5RA 4IOMA 5C37A 3TLGB 2BGGA 1KIMA 1YRLA 4NNPA 4OK5A 4PYNA 1N77A 3B53X 5TGDA 1F3OA 1IRXA 1BJRE 1DBPA 3LK7A 3C1AA 4IQFA 5I5EA 3EHEA 3OZCA 4B84A 5HZGA 3UKJA 2GN1A 3A4VA 4E5NA 4OBBA 3FYUC 2ZT6A 1XT6A 4EEXA 4G0WA 2PZGA 1B7GO 1C3LA 1FNMA 1H1LA 4IKPA 3G8YA 2J3JA 1G66A 3HBLA 1UC4B 2GEJA 2PPLA 5AQEA 1NKTA 3VNBA 5JV5A 8ATCA 3ADCA 1IEXA 5AKJA 4U6SA 5CT4A 2AG6A 4R69A 4YI3A 4MCJA 2HJSA 2OWEA 3JAWB 2C59A 2YFHA 2C07A 4LI3X 1MW9X 1IHPA 1J1IA 4KIJA 4UM7A 3FYUA 3ZE8A 2PWAA 4C9BA 4OYLA 3EC1A 4J3JA 5IKPA 4ALMA 4WFIA 2ATXA 2WWTA 3W8NA 3QH4A 3GFQA 4YMWA 4CQMB 1J2UA 4KQFA 1EUCA 3AUYA 4BQNA 6REQB 4C2UA 1WEKA 1CIJA 2HIAA 1I2MA 2ZJZA 5FOBB 2BVNA 2YHUA 2Z1MA 2VDKB 3E7FA 1DEAA 1T2CA 1KY2A 2I80A 4QQ8A 2QGNA 4TSRA 4CXMA 5ALPA 1LLUA 3CBQA 3IOMA 3GHHA 3AO0B 3O1HB 2JGLA 1F0KA 4A8JA 1JFRA 1I80A 2IY8A 2IY7A 2AZXA 1BXRB 4HWKA 4CMEA 3IAS6 3LUHA 3VRHA 1O6ZA 2JBAB 1B42A 3DBLA 5IJ9B 2PMDA 5EWLA 1S2DA 1ZKDA 4P54A 4C7XA 3X3HA 1ZK1A 2QENA 2DKOA 5BN4B 1HM5A 5DYTA 4B4KA 4D6YA 1NVBA 1JXOA 5F9FA 4EVSA 4NULA 1YUMA 3UH1A 4EPWA 2B61A 1BXGB 2W7TA 3L43A 2J4FA 4EQ6A 2FF5A 3ED1A 2ZBEA 3OHMA 4RNDB 5LBIA 1JHXA 4J1SA 4LDPA 5DWDA 3J80A 5I51A 3S2EA 1QDUA 1QFSA 2VAMA 3S8EA 2WKPA 3DV0A 2VF5X 4X1OA 2DBYA 3DT6A 3H2HA 3NEPX 1JYSA 4MQ4A 1AT1A 4M1OA 4W7SA 2XE4A 2D1QA 4WW0A 3N6XA 2JHCA 4LTMA 2C2GA 3CLTC 4OJNA 3COWA 3B3QA 4PG5A 1EVKA 4JZYA 1VHJA 4IZ6A 3MD9A 5CBKA 5JMTA 3NT2A 5M04A 3EIFA 4HMOA 5JISA 4G1EB 3ICOA 2EP7A 3WRVA 5IWCA 1BMQA 3PYMA 4RULA 1I4OA 5IZ4A 4ASUA 3KR9A 1N34B 1MO6A 1PSDA 3ZQJA 5EQJB 3I4FA 1N1EA 2W2LD 3UICA 2HCTA 1N0UA 1U2GA 3PQ7A 3VVBA 4CV3A 2BFEA 3OECA 4EPYA 1VSUA 1A96A 3CPEA 3D3KA 3QPWA 4YJ3A 3UJBA 3X1JA 4CKWA 5JZSA 3DHWC 3PQFA 5CVUA 3B2EA 2B9VA 3DZIA 3OCVA 4CF3A 4DCJA 2QUZA 4EW1A 1EB8A 1T5LA 3L0CA 4MIEA 2CLFB 4RH3A 3EZFA 1H85A 1MVOA 4HRYA 4FFRA 4J2HA 1XAJA 2IYVA 2XQVA 4Q9DA 4LYJA 3B1KA 4MINA 4Q12A 2V7PA 3W2EA 4D0NA 3CH7A 5C32A 2IXGA 4IO1A 3ECCA 1A27A 5IP5A 1P2GA 5FBVB 1JHOA 2BP7B 2YINC 3AHGA 1AB5A 1Q12A 3T4PA 3KXLA 3KT6A 3WO0A 3MQ4A 5K6AC 1KFKB 1SHZA 4LYFA 1EFAA 1H5NA 2CUNA 3M81A 2XB9A 4RA9A 4WAUA 4WFKA 4ZOBA 3H6HA 3P0RA 2EYQA 1Z5GA 2B34A 4KOAA 3UMVA 1A8QA 2PRIA 2WKWA 1PNOA 4Z54A 3DXZA 3U7JA 1SCQA 4IDGA 3TCXB 4FXKB 3AEYA 3RCBA 1H94A 3PEFA 5I7FA 2FPPA 4QYXA 1G5PA 2BZ0A 5KEIA 3DL4A 3GRRA 1SXJE 4TMWA 1X80A 3OLWA 4KAXA 4TSFA 2DT8A 1CZRA 3TLKA 3V33A 2JFGA 2ZRAA 3ZGVA 1M83A 4KMMA 4YXFA 5HIKA 3OP1A 2O1WA 1I32A 3H0CA 2EL9A 5EMNA 3T3EA 5A0FA 4QIHA 2BUAA 4AJJA 1YUBA 2GPYA 4D9MA 3DOCA 3U3RA 4C29A 3PDCA 4LFBB 3WYFA 1NZFA 4XJSA 4EYEA 2VDQB 5DCWA 3L8CA 5DE3A 3FCAA 1I6LA 2MMGA 2MHCA 4OP3A 3VNAA 4LYEA 1T9CA 1JR4A 5JBQA 1UBUS 3VC2A 4OL0A 4C0KA 3ZOKA 3KZXA 1K08A 5DT2A 2QJTA 2OCYC 4MSUA 3CMMA 3D8RA 1O97C 2IFTA 3BE4A 4C89A 4EATA 2XCOA 4LF6B 1YKGA 3HFRA 1U9IC 3ICVA 4N5IX 1EVZA 4R7ZA 2G5GX 1ACMA 1EM8B 1GPMA 2PKRA 4GE0A 3VU9A 1HNZB 3EJ6A 3TZKA 4L76A 2Z8ZA 3MUEA 1TCUA 2NPIA 2VYND 3PQ4A 2H4JA 2GYVA 4X54A 3WYDA 3ZK7A 2Q28A 4MKRA 4B09A 3QKUA 4CV2A 2FHSA 4DHEA 4K6MA 5DGXA 5DCLA 4ZQIA 1VFPA 3G02A 2G1UA 1IVYA 1TUIA 1U9IA 1W5FA 5EJ7A 3UA3A 5CT9A 4Q3CA 1QAOA 3BRSA 4YP9A 3X44A 1PWHA 2B4YA 3BL5A 5ITZB 4DYHA 2W2QA 2OXTA 1XMOB 3MUNA 2GTIA 2F64A 4RM2A 5EMJA 5B1YA 2V96A 3KM0A 3UJ7A 7REQB 1NXOA 1Z56C 3UMCA 1AHNA 4MTLA 4Q1BA 3ESAA 3THXB 1EWKA 2B21A 3IP9A 5JZ9A 4XA8A 5JXGA 2IDKA 4J9UE 3I6ZA 2YWBA 1ICIA 2BGJA 4R8VA 3V1LA 4EAQA 3GLVA 4LE1A 1KI9A 3I42A 3PUVA 3HCEA 4JI1B 1QK5A 1CUIA 2H7VA 4OMUA 3PX7A 4D8VA 4P2BA 4DR2B 3RJZA 3VA7A 3LCMA 1RAGA 3OCUA 5EE3A 3O3CA 4BQSA 5ENVA 4GQBA 3KDSE 1R0ZA 4X20B 5CJ2A 3CZMA 1SEPA 1KAMA 3T15A 4L02A 3E22B 2V3CC 2O2CA 4QBIA 3NHAA 3ZTTA 5CFRA 1PNRA 4IXMA 3MRVA 3BWDD 4C2TA 2FWAA 2CNBA 1SCDA 1UDAA 1CQZA 2Q5EA 2R1TA 2F1IA 2PJRA 1UEJA 4R1QA 1UWLA 3EXHC 3LF2A 2F1RA 3NWEA 3H86A 5EXXA 1PJ2A 4KQ2A 1MJGA 4LY3A 1WHSB 4FX5A 1D9ZA 4XOIA 3QU2A 3R3UA 4ZQBA 4JLSA 4BFTA 2Q5OA 4N3NA 3DMPA 4N7BA 5HA5A 1ZNZA 3ICCA 4HR7A 4MWZA 4RW0A 2AFHA 3FHOA 4K9RA 5DHQA 2QJWA 4B2PA 3NHFA 3H9JA 3DQZA 3U4GA 1L9KA 3FHLA 2EX0A 3KE9A 4IOJA 3ZXIA 4O4HB 3HCWA 2VT7A 4LVUA 1U63A 3KK0A 3RTGA 1USVA 3PFFA 2ZSKA 3SYRA 7ABPA 1XHFA 1PFQA 4A1OA 1KC3A 3M0EA 4Q4HA 3L1JA 2ZIGA 4U2DA 5AJZA 3K0CA 2LWIA 3R6DA 4KNYA 2PMEA 1DKNA 1Z4LA 2X6TA 1XZIA 3LT5A 4QUIA 4ENQA 4RHTA 5FI1B 2QVBA 5IVHA 2Z58A 3IEVA 4JLJA 4RSRA 4CDGA 3V4ZA 4DBZA 1ABFA 2GB4A 4DMHA 2PO5A 4DAEA 1JLRA 2VF7A 3NTXA 4PLVA 2YIMA 2DPHA 2M6SA 2NXWA 3NTRA 4EHDA 3B9RA 2CDBA 3QMMA 4KIUA 3SHTA 4YPOA 1N7IA 2LGJA 1OWNA 5LQDA 2NZ2A 1RWNA 2VPPA 1DCMA 3DFFA 3KP1A 3A6ZA 2I3BA 4HGYA 1WMEA 1YBVA 3FETA 2IV2X 4M46A 1JJIA 3HRZB 4D9BA 4GPIB 4EKNB 1MC1A 2H7XA 2ZTVA 4ZCPA 3ZE9A 4C0HA 4HWTA 3KJHA 2Z1NA 3ORSA 5IPFA 1U65A 4LHVA 4LJLA 1ZRSA 4W1SA 2JHGA 3RFTA 4AMGA 2VHJA 3T3MB 4DCOA 1VLLA 3FI9A 3MPUA 3TW0A 4BVKA 3PYXA 1RC8A 4J4BA 1DQZA 3D1VA 2XECA 3O4VA 1E3DA 2OSVA 2ATCA 1EK2A 2JGRA 4HDMA 1KQNA 4IWYA 1G19A 1M0SA 4ND8A 1IN6A 5M2QA 1MO3A 2P2YA 3C6QA 2WB4A 1VHTA 3VR3A 4CCAA 5JLAA 1MX3A 2NUAA 3EVDA 1VG0B 4N3BA 1TAHA 3TQTA 4ODIA 4EECA 1MIHA 3CLUD 1YZNA 4JOQA 1J0EA 3NHUA 4F8JA 4BFWA 4HXYA 5CT6A 1R12A 4EY5A 2DWUA 4XIGS 2GDZA 2Y1OA 1PEDA 3I01A 4ZZ1A 4C4SA 2O7NA 2O4UX 1QLHA 2Q2QA 3GGSA 1UBEA 3GVIA 1PS9A 2BHLA 3OBIA 2HCFA 1E7RA 3MWEB 3QJ5A 3HVIA 3RLIA 2TMDA 3SY8A 4ACBA 1H2HA 1ZMOA 3WY9A 1TUBB 3CW2A 3E8XA 1G3RA 3IAM6 1G291 1QONA 1NVUQ 4DE5A 1GGHA 5EE5B 4HDQB 4IRMA 1GCAA 4FNAA 4QPNA 4IXDA 2ONJA 1C3JA 1G42A 5BXYA 1OLOA 5IEJA 2YVAA 2ZATA 4V02A 2G9ZA 4BNHA 1ULTA 3FWPA 5GZ6A 2JEZA 3CVUA 2C54A 3TEMA 1M54A 4WCDA 2K2WA 1XN1A 5DBFA 3RRBA 3N53A 4OHWA 5P8WA 1F0PA 2JGJA 3PSHA 1B43A 3VBEA 1ZU5A 3PPYA 4JQOA 4KG7A 2I6GA 3O8OB 4QYTA 1RI2A 1MOZA 1V8DA 1VDMA 4HRVA 3VPHA 4P0PB 2M9MA 1JLMA 3GX1A 4FXPA 1ZAKA 2IYOA 2J5XA 4RVCA 5HW0A 4MDYA 4BQQA 4EYQA 5LP6F 1E77A 2NNWB 3MBKA 2PKCA 1OYOA 4H6WA 1SKYB 4RQTA 2IYAA 5AJTA 1R6VA 1GNVA 5G2OA 1XZNA 1QCYA 5L6LB 4J7XA 1FFXA 3Q0TA 3DM5A 3EVGA 3N3AC 4D8XA 1WUHS 1GARA 2OC4A 3LXXA 1RWMA 4OQ4A 5K8TA 3EGWA 4BVGA 4E5PA 1XEXA 1I4TD 2QHXA 2ZDQA 3DZJA 5CR9A 3L41A 5E8JA 3SICE 4URUR 1ZICA 3G8CA 1Z25A 4OKSA 4AY6A 1JS1X 1NVEA 1YMQA 2P69A 3QUQA 1ZL2A 2B35A 2XNJA 3C5HA 4HWRA 2YHBA 2BLLA 2ZUCA 2X6QA 4FYWA 3I1FA 1KMQA 2AZ4A 1RRCA 1PJCA 5F2EA 4L5AA 2BPOA 3I5UA 1OREA 1GG2A 3O2SB 4HJRA 4L4XA 3TSZA 2PUCA 5EP3A 4R8KA 1A1SA 2EBUA 4QQRA 5I3CA 3AONB 1ZH2A 3C6MA 1I2ZA 1WCV1 5KNCD 2DTXA 4OQMA 4DW8A 4U3JB 2WPDA 4RHEA 1V6SA 1PCXA 3B5EA 4TL7A 4WLFA 1AKTA 1FIUA 3SVLA 3JRNA 4PO8A 2PVSA 3AKEA 4IGIA 1NNSA 4WZBE 2RHCA 5MN6A 2Z9CA 2FEAA 2NSHA 3JQBA 3DTYA 4PFQA 1XNGA 3IDOA 3RAGA 4AX4A 1NX6A 1U9CA 4M0FA 1ZOSA 1X9GA 1XMXA 4MJ7A 3OICA 3K6SA 4X62B 4NBRA 3HCOA 4EO4A 1PK9A 3FMPB 2FN4A 2IJGX 2H3HA 2DSTA 4IH1A 4ZAWA 3ME5A 1UZMA 1Z5PA 3EVNA 4M7WA 2PGNA 3PIIA 4TQGA 3NGMA 2FJ0A 4G5SA 1KYZA 2FN8A 1X77A 1RR6A 3IOEA 5TQ2A 5KPDA 1EAMA 3UCFA 1DQYA 3A6JA 3P71T 3EMKA 4OF4A 2WG0A 4B40A 2DM6A 5CNKA 1PFKA 3BSFA 1QGUA 4KLNA 1M33A 1NE2A 4LXUA 4HX2A 4FYMA 3GUUA 2V9CA 3SQLA 1A5BB 1WLSA 1HBJA 2OB1A 4Q4LA 2QROA 1E6CA 3CEJA 3JD2A 3P0FA 4ZN6A 2DHDA 4E6EA 2DWOA 1GRNA 3UMBA 5E9WA 3N2YA 2HLDA 1SOUA 2NZVG 1DKQA 1EHCA 3OJLA 4GMGA 2QEQA 3EXIB 5TPZA 2W2PA 5M29A 1E32A 3E58A 5AHKA 5LJLA 4Y6LA 1Z5ZA 4MAMA 2GNOA 5FUWA 1QFJA 1PJAA 5AT1A 3Q6IA 3NWJA 3SSMA 5JWHA 1XC7A 1GPLA 4G97A 1A7AA 1TMGE 3DVAA 1GNPA 5H4HA 3RSHA 4EZIA 3IELA 2FN9A 3JZMA 4GZ5A 1KEKA 4MEJA 3OKPA 2SNIE 1OQAA 2IP4A 3HZHA 4O0LA 4P83A 2W0MA 1TM7E 4ZDJA 1F2VA 3F67A 4OBXA 3VDQA 1ZR4A 3OH8A 4EF6A 1XEAA 4UCXA 5JSKA 1BCRB 5GMOA 1IZYA 1XMJA 2QAIA 1QV6A 2VYCA 3BAZA 2E87A 2C1ZA 2A58A 4I1YA 3DPSA 4NDAA 5A6SB 1ZVJA 2B1GA 4GH5A 4IZHA 2OXFA 3LY7A 3DEYX 1TT5B 1DRUA 2ZJBA 3KBBA 2ZXFA 3W7AA 1H0SA 3LT4A 3GFGA 1ENPA 3EISA 3WQSB 1MUUA 3SJBA 3NM4A 4INZA 4YXWA 1T2FA 3IVMA 5JS1A 5JTWA 1DAOA 2QX8A 3GFRA 3PRYA 3T1QA 3W2IA 3ZCSA 5BSGA 1GA4A 2HPZA 2OXRA 4CT5A 2HQ1A 1AKUA 1WXGA 3UWOA 5A4KA 3MGKA 1AKEA 1DX9A 2X5NA 3HDVA 4F45A 5DX8A 1NUPA 4YALA 4PM4A 3DZGA 2OM2A 2GAAA 5CP8A 1E1DA 1NVXQ 4PQEA 4OXNA 3ESYA 3W34A 2YXDA 5T5QA 4XZ3A 5HQ3B 1RLTA 4LSGA 4YV7A 3CCFA 2ZYRA 10MHA 1ZL0A 3VHRA 3GOHA 1NXPA 2ZEJA 2IDMA 5GONA 1LF5A 2JLQA 3WLPA 3IPLA 2FA9A 1U1DA 3V1NA 1JKFA 2PSEA 3FNIA 4NH0A 4E4RA 2WZBA 3OCCA 3AM5A 1VL5A 3AH8A 4HAOA 1PVDA 2EKPA 3RFCA 4DMGA 1Q0TA 1VCNA 2JLYA 4LV8B 3TTSA 2PA3A 1LPMA 2D74A 1J4AA 1A0OA 2AS0A 3HL0A 3DFZA 3FMIA 721PA 3C4VA 3P1JA 1VKNA 4AF7A 4QT0A 3K31A 4YY3B 1S5PA 3CW8X 3BXHA 1CEXA 3A9UA 3GLIE 3SF0A 4KIGA 5JQGA 2X7XA 3WRYC 1C5KA 5HP4A 2WTMA 2EJWA 2J9GA 2NO7A 3CH6A 3JATA 3I5XA 4L7VA 3EWAA 2R47A 4D4JA 1JHUA 4FFVA 1W46A 2ZT5A 4JOSA 4BNGA 1HDRA 3HK2A 1GV1A 1JG3A 3OHSX 2CFRA 2IL1A 1YAHA 1DTSA 1LZKA 4KGDA 3NJRA 1PQ4A 4WOKA 3AVQA 3GP8A 1ACJA 2ZSUA 3RNLA 1DFHA 5LUBA 4PLHA 4DQVA 3MZ0A 1IM2A 1QK3A 2CK3D 2PVCA 5H5JA 5EJ5A 5LUAA 1YB7A 1FCJA 3L9XA 3PNKA 3DLHA 3RBAA 3ZBTA 3OZVA 6AT1A 4D8TA 1NBIA 2C8VA 5AESA 4FW9A 3NTVA 2Q1WA 1ISMA 2RGUA 3AUAA 3GCXA 3KAPA 2C04A 2O4CA 3BDAA 1STOA 3OIDA 4YONB 4B85A 4PG8A 5BMOA 5C35A 1V41E 7MDHA 2I67A 1PJ4A 3C6YA 4AWBA 1G8KA 3OIVA 1NL3A 1NJ2A 2Y1XA 4DL9A 1XE3A 3P9RA 5FADA 1A8HA 4DJ5X 4EFLA 3FIJA 4N0QA 2QUHA 5JSZB 2LE0A 1ZS9A 2A1TS 3D54D 3DDNA 4F12A 2WF5A 1SRRA 3ZQKA 2CCKA 2C92A 3R7FA 4ZK2A 3B7WA 1OJLA 1X94A 1CUBA 1RRMA 2F8LA 4PX9A 5NULA 5JMWA 3SLGA 3WK6A 3WWEA 4B4UA 1PN3A 1WZIA 4U7FA 2HV8A 4B3BA 1RC1A 3HVUA 4LY6A 2QPOA 2WSIA 3OMWA 4WLUA 2WFLB 4PAMA 3WFJA 3OCYA 4C04A 4D57A 4UJ3A 2IEAA 5AKIA 4ZEOA 3RVKA 4J0IA 2FPUA 4UASA 4ACAA 2RB4A 4IOKA 1COZA 1ZUNA 2I2FA 3AYZB 4FE3A 5GP1A 4TKVA 5KYGA 1KPGA 5EKXA 1QJ4A 4DG8A 4LCEA 3IILA 5K45A 1DBRA 3EUAA 3KKPA 3UB3A 4FSXA 1TJ4A 2CHUA 1I4WA 2JJ1D 3FWHA 3KL2A 3PPWA 4MUAA 3GGDA 4Q7LA 3QKIA 5G0TA 1RM5A 3LJKA 3QEBZ 3OIUA 3RODA 4IIJB 2OKCA 2QTVB 5DBEX 4ZMBA 3B82A 2Y1KA 3DE4X 2NU8B 4QG3A 2ZFUA 5G0VA 2X77A 4M1QA 3ZJUA 2QW8A 1L5SA 4Q4AB 2ATIA 4M0MA 4HN9A 3B1VA 3TSCA 4B1FA 2Z5LA 3B1ZA 4U7JA 3A9SA 1WMFA 3CXUA 3R7LA 1JJ7A 3A3NA 4BJHB 2IBTA 2ZBUA 3HWX1 1DC7A 4OHRA 1ZQ9A 3UUGA 2QZ9A 4NBLA 1P2DA 1OXSC 3L1KA 3AF6A 4MEAA 1X6VA 4ZI3A 5A62A 1CNFA 2PSFA 1N6IA 2WSSA 3EIXA 4KPYA 2BJHA 1NVFA 1U0SY 2Q29A 4JJ4A 5FYDA 5J40A 5LYYA 1V3TA 1Y3CE 5FRDA 2Y1WA 3Q2IA 2QY6A 1IHDA 1RJFA 1U28C 4PAWA 1Y4SA 1C0LA 4TZ0A 4ZARA 5AVKA 4XVHA 1JGTA 1XD9A 3IDAA 4ETIA 2O6HA 3CMCO 5LCXA 1EIWA 1JECA 2IEDA 1BMTA 2AOUB 2IYFA 3ENQA 4RY0A 4FTWA 1A2KC 3ULKA 3GYGA 3U44B 3V4FA 1URPA 4KTVE 1UZUA 1C4XA 3F1KA 4K86A 5AW7A 1JMVA 3HLTA 4ICIA 3LBIA 4QNRA 3RSFA 8LDHA 3HVRA 1U4SA 4CQNA 3V8PA 1NRIA 2AK2A 2BGIA 1L5KA 3MFQA 5A4FS 3NLLA 4D92A 4IJMA 4R0MA 3FOBA 4TN1A 4UNNA 4C7JA 1VJ5A 4TVKA 1C14A 3K4HA 4AT1A 1U3DA 4MUXA 4N12A 4FXGB 1DCFA 3LG2A 3PDIA 1AB6A 1EIZA 1NTOA 4WSOA 4XUDA 3RI3A 1ZOPA 1T4CB 1Y6ZA 2IW3A 4FR2A 4JBGA 5EIFA 3TFWA 5KIAA 1E20A 2CJWB 1LW7A 1X7GA 1T43A 2ORWA 3TR0A 1FFDA 2C3UA 4H15A 5HQTA 3PNBA 3RYIB 1T0BA 3OZTA 3VOAA 3ZLTA 4NENA 2OTCA 3NRCA 4KRFA 4J7AA 1L4MA 1ZGGA 1QWSA 5CTJA 1TO1E 1U9YA 2P9GA 2PGLA 4TXNA 4XPIA 4BOYA 5B2EA 1XZ8A 3KSBC 5THKA 1AH2A 1OLSB 4KKVA 3DXYA 1I6WA 2EFGA 3MWGA 2BR5A 1WCYA 5CLLA 1VJ1A 3ZWNA 1NMEA 1OXXK 4R68A 4WEOA 2H57A 1UDXA 4D96A 1RYDA 1TX4B 4M9XA 5CHEA 2Y92A 1YJ5A 1RS0A 3GD7A 1NJ5A 2IS1A 5KOJB 1IXKA 1E4YA 2IOHA 2DX7A 4NYMR 2WP0A 1E63A 1DO0A 2K7FA 3FGOA 4J2TA 5LMNB 5LLTA 2C00A 1T0IA 1C3XA 1R0XA 2LR0A 1ISJA 2PU5A 3AVOA 3C3CA 3DUWA 3DW1X 3ELUA 2OP1A 1Q19A 1IN5A 3RSGA 3FKQA 2HJ9A 2BGNA 2GCNA 3AUFA 3B48A 3WGZA 3U7GA 1RPJA 4TVBA 4H7EA 3FUTA 3WXMA 2AJBA 3NX4A 3QJGA 1H8ED 3EY4A 1X1RA 3IBFA 4D4MA 2XDQA 3HPRA 2HJGA 4O3MA 1PNTA 2R65A 4Y30A 3T7EA 4IS3A 3D8HA 3VI4B 4MDFA 1TA0A 3INGA 3AJ8A 5BSTA 2JA2A 1N2CA 5K03A 1E6KA 3TTYA 5SZKB 1KJQA 3LX4A 1JE1A 2FW0A 3MT0A 4HWPA 1ZONA 4YPFA 5KDOA 1NU6A 1TRHA 5FYQA 3RF6A 2VDMB 4CVNA 1DJQA 2FZCA 2DFDA 3PFIA 4IJVA 1FVXA 2XYQA 4Z9BA 5JTUA 1E4EB 1L7MA 2FSHA 3DEZA 4MQBA 2PQMA 1RDFA 4NCKA 1Y89A 3TQOA 3LVBA 2QGZA 4PBTA 1UEIA 4TXHA 3W90A 3CWZA 3IQZA 1GYPA 3RSQA 4TSKA 3JZIA 1G21E 1YTUA 2RGWA 4J4HA 4ENRA 5CBPA 3L5OA 2CLHB 3LQ1A 2RJOA 3E5MA 5BMVB 2B7LA 2BHTA 4EOGA 3NHKA 3KD3A 3WJ1A 4E2WA 2GJKA 4LHEA 4M37A 4F9GA 3FWZA 1QF7A 1CS0A 4RM3A 4XQEA 5E8RA 4ZCIA 2Y4NA 1Q1ZA 1U99A 2WE7A 3E7XA 3QWHA 3SOZA 3K32A 4LKRA 5E7QA 3GVXA 1I3KA 1F8YA 2C96A 4GBMA 4ME6A 3VZPA 1CFZA 1N9GA 4JI0B 2YYYA 5ILGA 4JITA 5IJAA 1JEYA 4PV7A 1FEZA 3LOQA 3QMPA 1RNLA 5T4FA 1J7KA 3MINA 1MR3F 1OGIA 3UW1A 3ZLVA 1DB3A 1Q74A 2Q4TA 2H2DA 2XMPA 3IRVA 4JLPA 2XF8A 3D3EA 4C0XA 2QT0A 2ZE5A 4KJXA 2HREA 3L06A 3JALA 4YJDA 3REQB 1FFWA 1ZD5A 1E2FA 3S5UA 2LW7A 4MQFB 4B8ZA 5I6DA 1WQ1R 1XV5A 2XQJA 3Q6MA 3ROFA 1CUGA 1LSUA 5EP1A 5CCXA 1X39A 3H1AA 2QTWB 3TRIA 5FL7A 1C3OA 3BH6A 4H3VA 4UOZA 1OSNA 4RXUA 2AMVA 3DG9A 1VJTA 5IJXA 2P9TA 5AM3A 3KPWA 4K03A 4REMA 5IAGA 1FQKA 1TZCA 2CLCX 1MPXA 3WAJA 1S1CA 3HR8A 1UAYA 1PT8A 4M83A 3U3MA 5C8ZA 1AGNA 1HE1C 1TA4A 1H2FA 1Z7WA 1UFKA 2INGX 3D6UA 2CZCA 1CJKC 3FFBA 1P29A 4AK9A 4F06A 1FFYA 4MVWA 1Y7HA 1YS9A 1IUOA 1PKXA 1FLVA 3BGWA 3GFBA 5ELMA 5B64A 3ORQA 3OC6A 3KELA 1GP2A 3TQQA 2E5FA 3CLRC 2GYWA 4URFA 4ATNA 4A23A 5D3MB 4PC6A 2QI9C 2Y6UA 5CH8A 4MR9A 1A72A 4OG2A 2GN2A 2XEXA 2QPTA 1OKKD 4EY8A 2R8ZA 3B3AA 3R23A 4S24A 2OQVA 2YDXA 4G2TA 4E3WA 2PMFA 3N2EA 2V45A 3OJFA 2GASA 3K0AA 2XMQA 1CHNA 2ZPTX 4N0PA 3V8BA 4FZJA 4KXLA 4QOSA 1KMCA 4NK4A 4E5MA 4YYZA 3UJNA 4E7PA 3S2IA 1XDGA 3USZA 1C8BA 2AZMA 1XQYA 5BW5A 3D6VA 2OA0A 3IEPA 3C5WP 5K0LA 3D0QA 4EG8A 2IX3A 1F7VA 4KSCA 2FY8A 3HB9A 1ORTA 3G9TA 3LZCA 1KQ3A 4LHSA 1QVZA 4AXXA 5HGXA 3D2AA 1XEWX 3UY4A 2WKRA 2WU4A 3N70A 4Z9XA 3RG8A 1YZLA 1YXMA 1L7RA 1HLPA 3HR4A 1G7RA 2HRDA 1NVTA 3R76A 3G13A 4AL4A 4AYTA 2EFDB 3D5EA 1W4BA 4UVGA 3WYNA 2CKDA 4BIIA 1GOTA 2D2VA 3U2QA 5DMHA 1M2NA 4KMSA 3TLEA 4G5YA 4BMXA 3BTSA 2PH1A 1KZ1A 3EG5A 3MAGA 4GD3Q 1M8GA 5DHTA 4EG5A 3ODGA 5BUQA 4Y98A 2WYWA 2J33A 1U6KA 3I28A 1PU2A 2XA1A 1CP3A 1IBRA 3GWGA 4RPCA 4O4HF 3UZUA 3WQRA 4N4AA 4B5KA 5JTTA 2XYHA 3C98A 1NY6A 1L4FA 4UTOA 1T9KA 4NE2A 3KHSA 3O3MB 4RZIA 1Z6GA 2FPLA 2R5NA 3AFIA 3DAGA 5H3CA 1E5VA 2WLTA 4QWMA 1CR6A 4ZYYA 5CAEA 2H2HA 4V1CI 3A1VA 3PF9A 1J70A 3LFHA 4HTAA 5D5QA 5K99A 1NT2A 2IGBA 3KVRA 2Q45A 2WYHA 4FUQA 5LP6C 4BV9A 3FRJA 3QVTA 4GMFA 3AM3A 3UO8B 5HGJA 4E03A 3DPIA 3TKLA 4IEIA 5FPQA 2JGIA 3OPVA 2Z83A 2Q6LA 4MNTA 4N7JA 4YT4A 3IVRA 1EK6A 3O03A 1RE0A 2ROQA 4LJ6A 4ND2A 3VHXB 3TKYA 2FFHA 1Z4OA 3UG7A 4UNQA 4JLKA 1QH1B 4AICA 3C39A 1WHTB 4BBAA 5LP6A 1A50B 4CDMA 4D6PA 2J31A 4BP8A 2YMQA 2GBFA 2P4QA 3B6IA 4TXLA 4GVPA 3WIOA 5KDLA 3QV1A 3FNFA 5KYVA 2X3YA 3ZE1B 2VO1A 5F73A 4C4TA 3A9RA 4OAOA 2I6XA 3VO9A 4FKZA 4PVDA 3FCSB 1OOEA 3EDRA 5F78A 2R86A 3BE5A 3SQOA 1E1RD 3C87A 1ZLYA 1VKRA 2HBZA 2V7WA 1R8QA 4I5IA 3BZUA 4OH7A 1ZWLA 3NBYC 1FF9A 1XR3A 1NKVA 2FSVC 2YIJA 1NAIA 4FYJA 4MRSA 4R2WA 4YWHA 3R8CA 3T5BA 1GKKA 3MWDB 3OM1A 2WAYA 4R3NA 1EP9A 5TR9A 2X9QA 4UXJA 3WADA 3LY5A 5JAIA 3VYRB 3BXEA 2P2ZA 4J1TC 5EWMA 5ALWA 1JHYA 2I71A 3PQDA 3VPFA 3P4UA 4U2KA 1DAIA 1N6KA 2C2OA 5J43A 3H16A 3I9JA 4BGEA 1Z36A 4NZPA 2YWFA 4RK0A 2WVHA 4G41A 3EFOB 5A4JA 2I54A 1ZJWA 4GL4A 1XI2A 2DFPA 2FSVA 1Y5IA 3F6YA 2CV1A 1SKUA 2FMHA 2ICEB 1W8IA 4FIDA 2OBXA 4H7DA 1PI3A 1LQTA 3GPCA 1IU9A 4KO2S 4PHCA 3TR6A 3VZRA 3ZC3A 4YRMA 3CEPB 1B0UA 1Z6ZA 2PGJA 3DEFA 4H7FA 1CT9A 1HURA 3G23A 1A9YA 4LEIA 4UBMA 3LXRA 4Y3UA 2EZ9A 5EXPA 5KSYA 4F5DA 5T3UA 1T9ZA 2YFKA 5CDFE 3BFXA 3V8RA 1ULBA 4B7CA 3QRWA 3BCRA 1Z0FA 1IPFA 1P39A 3I09A 3JX9A 4KODA 3C15C 4MDHA 5TS2A 1DU4A 2C3MA 1PJQA 2V55B 2X1LA 4E94A 3GJ7A 1KERA 4ZHQB 2AVNA 4GQAA 5KX5F 3JR3A 2B92A 3HXTA 2A94A 3EGEA 3IKMB 4LISA 5IJZA 3ZD7A 3GCDA 1QTIA 2IYTA 1A4UA 1SCJA 4HQFA 1CV2A 1WZEA 2JARA 1PTKA 5LZ7A 3WMFA 2QY9A 4MVJE 3T5PA 1DEXA 3RJ9A 5DI9A 4AZVA 2CYBA 1YK0A 3EPPA 2DCMA 3HA2A 2F3UA 1N2SA 3C6KA 4DCVA 4QTXA 4G67A 4CLOA 5JEDA 4Z53A 1C3VA 4DLTA 2O7SA 3OE4A 4EG1A 5JNWA 4LF7B 1II9A 1EPUA 4CM9A 4N40A 4BJ1A 2BZ1A 4BLVA 1SOVA 1E3MA 1O6GA 4XWKA 1FP4A 4NEHB 2ZE6A 3U56A 4ZANA 3Q1KA 1H8HD 4KXYA 5LZ2A 4YMGA 4PQYA 1CY8A 4KH1A 3T35A 2HHAA 1ISRA 3K0FA 3OAAD 1EJ0A 3T7AA 4H7PA 3M83A 3ND9A 4Y67A 2AD1A 2F9LA 4L5JA 3V00A 2YYSA 3PGKA 2GT1A 1DUVG 1U8UA 2XBMA 3C3MA 4DG5A 4B75A 3FFTA 4CYMA 2F8TA 1SCBA 3K1YA 4DYVA 1F8UA 3CEMA 3ZWYA 3HNRA 5AKHA 3T1OA 3W5CA 2XQFA 1D6SA 1T35A 2DF8A 5KSOA 3ROZA 1UJ4A 2QSZA 5A2QA 1WXXA 4CETA 1N92A 4CHGA 1CNEA 2FPGA 3FRHA 3GRCA 3UPTA 2OEPA 1SXJC 1T29A 3KJGA 4A0FA 1W36C 1PL7A 4E12A 2V6JA 1RYBA 4QGFA 4P31A 2FH5B 4Q18A 5IX8A 4O4LB 1L1EA 1NXQA 1W48A 2WDPA 3CCCA 1WD7A 4EDHA 1XRJA 4U5QA 2XJ9A 5BRAA 1YA6A 2VNAA 1E3LA 1PX0A 5HIIA 3DKIA 3HKEA 4N65A 5H81A 1KY3A 2DJ5A 2MR6A 4LF5B 4UEQA 2O07A 4E33A 4XUCA 1SG6A 4LNUA 2DLCX 3AU8A 1FTYA 3RARA 1LXCA 1JZQA 4KXWA 1JNXX 3SX0A 3REGA 1EFTA 4KWHA 4WRRA 4CGZA 3BWBA 3BB4A 4U9HS 5D5PA 3ZJTA 1R64A 5FPTA 2EXXA 4KRGA 1I5EA 4KQWA 4DNPA 5C8VA 1O4VA 4FYIA 3QF4B 2OV2A 1JQJC 1E9BA 3GROA 4XQCA 4TVSA 4EB0A 2PEYA 2VQEB 5DMXA 1I10A 2IOFK 4O0MA 1NSFA 1EX7A 1Y8QA 4TQUS 1GZ7A 4EUKA 1ULZA 3IDZA 4WKGA 2YWRA 421PA 4CZ2A 3KIPA 3THWA 2X1MA 4KR7A 2YNMA 3OJ0A 2QUBA 2CLMB 4Z0PA 5JFTA 3AF1A 2ZI3A 4CM4B 5ALTA 1L8OA 1RLOA 1VI6A 2ZRLA 3KDAA 3CSUA 3GPIA 4KE8A 3G0IA 4MV0A 2YN4A 4UHHA 3NVAA 1A97A 2QVLA 2WD7B 4Q1AA 4KWEA 2H51A 3C97A 3Q7EA 4ZYLA 4JLMA 2ZUWA 2AG5A 2XBLA 3GYBA 2QT9A 2CXRA 4IQ0A 3N8HA 2QTTA 2WTXA 2FR8C 1Z8HA 4MYCA 3PGXA 4Y0VA 4Z4QA 2Z5VA 4J8PA 5F35A 1K3TA 2CVHA 3GEIA 1AZWA 5KWJA 1BN6A 4OQDA 1ML3A 2D7CA 2EP5A 2F3RA 4F3NA 4WCFC 3EZ6A 1P9OA 3H5LA 5TQ0A 1E7MA 1J0BA 5L6MB 1VGVA 3GWZA 2NLOA 3Q0IA 2E9SA 2I6FA 2WBLC 1H0RA 2HF7A 2CXXA 5AUQA 1XAIA 1Z26A 1V8OA 1Q17A 4EYSA 3NVDA 5FX2A 2WFMA 4PVCA 2FR8A 3CX4A 2FR1A 2C42A 1UJ6A 2ACKA 1PFUA 2H65A 2QTCA 3TLCA 5F7XA 2Q9CA 5TY0A 1XVTA 1D2AA 4CM7A 2VNJA 3DW3X 5LXTA 3KUXA 1F4PA 2C5EA 1AS0A 1DWOA 1I33A 2J9FA 4EF5A 3GN1A 5A5EA 2VTBA 1FP6A 2E0IA 1XVUA 3WISA 6Q21A 1U98A 4DLYA 5K6RA 1I30A 1N6NA 1PR3A 2H59A 4ZTUB 3T99A 2O8BB 1XRPA 1FS4A 3OPYB 2CNOA 2H29A 3L0BA 5JARA 3WAGA 4HQLA 1Y4DE 1UMKA 2QTMA 1ZVKA 3OF5A 1ECFA 2J0EA 4J76A 4YMSA 1NXVA 3KKMA 3LOPA 3PNLA 1ZD3A 4EX7A 2CXOA 3ZE2B 3RS7A 3M70A 1AKWA 1MDBA 4OEHA 1U3TA 4Q3NA 5H83A 2WM9B 3RSOA 1JQBA 4DSUA 4C7OA 1TECE 1K86A 1Z7GA 2Y0DA 4KX3A 5GGXA 5TX7A 3T9FA 3TMKA 4TMZA 3NIBA 5CA0B 3LC0A 1HV8A 5FA6A 1CUYA 2XDAA 4KWIA 3ZEIA 4BNDA 5CX4A 2BGKA 1FBNA 2V8BA 3ON5A 5FUMA 1GKLA 3WHLA 3RSLA 3ADKA 4E07A 4KAJA 2ODTX 3LGSA 4Q1VA 3BIOA 2OGSA 3WMRA 4D94A 1KR2A 1V8FA 2YDYA 3CZQA 3DKKA 4PC2A 5LU9A 4J0EA 3H1GA 3QVLA 1JDBC 3QLUC 3SDZA 4KXQA 3BH0A 2YICA 2IF2A 4QVGA 1NSYA 4FDVA 2Z8YM 1QPBA 1ONNA 3AUJB 4PZCA 2CHVA 2RBEA 4CIVA 1DKRA 3V8EA 5FWNA 1ABBA 2X9GA 3WIEA 1PD0A 2KX7A 4B87A 1UFQA 2RGAA 1UBMS 4RE5A 3QHAA 4HWOA 3VR4A 1CXZA 3L7MA 1XIVA 3TR5A 5H3LA 1TU0A 4RV4A 2R8YA 3G6JB 2LCIA 1G64A 4FKBA 5G0SA 1JRLA 2LKDA 4AJLA 1LS1A 2ZJ3A 2NYUA 3VTKA 1J9EA 4BRWA 1MABB 2LD4A 1CY1A 1BJTA 3R5JA 4BLUA 2CVZA 2R2GA 1NN3A 2C8KA 3KALA 4EMUA 1M2OB 2NG1A 1HQKA 1XKTA 2NSJA 3MQ2A 4CDRA 3MG9A 3JW8A 2GHTA 5L3VA 1MB9A 2VRBA 3KQNA 1P1IA 4B8YA 5K3EA 1RJGA 4YAUA 4V24A 1AO0A 5K8VA 4INOA 1EHIA 1U3VA 1P0QA 1I7LA 1QC5B 1WCXA 3JPYA 3L8ZA 3HSKA 1GUYA 5IT0A 1G8JA 2XIQA 3KLNA 3COJA 1VG8A 4W99A 1HE4A 4TGLA 4IDHA 1X2BA 2QRVB 4A26A 4AY3A 1Z9BA 3A9TA 4HYEA 4LQCA 3VH2A 4A27A 2G09A 1N5OX 1IQPA 1L5YA 3RH0A 5IKXA 2C4NA 3DDSA 2P62A 3NBQA 1O94C 4NMWA 2WJJA 4I3GA 2GEUA 3A2KA 4FLFA 4L6AA 1UOOA 4Y2XA 4DJTA 4FZ3A 2H9IA 2R25B 4IMJB 4GP9A 1JAIA 2WJWA 3HWWA 4MZDA 3QZUA 4AG5A 1MT0A 1H2EA 3ONWA 2HWUA 1BXRA 4JR2A 3RVJA 2IGTA 3ELDA 4RESA 1RXIA 3BMNB 5IJ9A 3VYVA 5TB5A 4R1OA 1G3IA 1A5AB 2BE9A 1ECGA 2I2AA 2Y0BA 3NB0A 2O2XA 5BN4A 1ZBQA 1T34A 4ZZ0A 5EIWA 5GVSA 1KMIY 1EVLA 4FHCA 2VJOA 2BCEA 2P78A 1BOOA 2PWZA 4R3WA 4TZ6A 3LDGA 2H2IA 1YB4A 1TM1E 2FUNB 3QKRB 1X7DA 3NEJA 3NPMA 3PHHA 2YWDA 4OIFA 4X6LA 1C7FA 1ULUA 1LDNA 1CIPA 2C94A 1P7YA 1DT3A 4OYYA 1KPHA 1ODIA 4IIJF 1UWVA 3QELB 4XIIA 1V71A 2XUPA 4HRXA 2YASA 2IF0A 2FLVA 4V0SA 1KJJA 4GU5A 4LE2A 3EVZA 1SD2A 3FUXA 1XKLA 3Q2KA 2NU9B 3EX7C 3SP1A 1UBRS 3NOOA 4JUCA 1NBAA 5FWYB 3IJPA 1KDYA 2D5AA 4DXHA 2B8EA 4QVIA 3LXUX 1X7YA 2B83A 2W11A 3DD5A 3MRTA 3TZQA 2QB5A 2GN4A 1FYVA 2FJPA 2POCA 1Y5RA 5JPNB 3N2ZB 2UXBB 4EI7A 1V47A 4E5SA 4KPFC 2CZGA 3KQOA 1BVHA 2CL7X 4NCBA 1E79D 5FTNA 3LUGA 2J9ZB 1AKQA 3F90A 2DUJA 2Z3WA 3F3YA 4M54A 1TJ3A 4FMBB 1HPLA 4C4OA 1H9BA 3EFHA 2C1XA 3A6HA 1IEQA 4CKBA 8ADHA 3QYPA 4KE9A 4LC0A 3DC2A 4RPKA 3SLKA 2P90A 2R11A 3RAEC 1CQIB 1SN7A 2RGEA 3HLKA 3A1CA 4U6NA 3S6JA 3STXA 2TRSB 2QDXA 4TWIA 4D3DA 2B0CA 2ERXA 2YQZA 3STVA 1I1QB 3CR3C 3M9WA 5BSVA 2C0CA 4UEOA 5JUWA 3RTBA 5JZOA 4J6FA 2ZSIA 1AA9A 1CEEA 4Z2AA 3LYHA 2HJVA 5IUNC 2QWXA 1C50A 2ACWA 2VZ0A 3OEHA 4ZYZA 4Y6SA 2VHWA 1JIIA 3SEFA 4GKKB 4FGWA 2HA7A 1QS0B 4KSBA 4IH9A 3C74A 4FXKA 5GAJA 2C82A 3S2UA 3QOXA 2Q5IA 3MM4A 2CF6A 5CPFA 4YRJA 4MHOA 4HFJA 4GNRA 4BXOA 5AI8A 5JAPA 3DNPA 1J23A 1MHPA 1ZZGA 1P9LA 1Y6QA 2VP5A 3JVDA 4EGJA 3SE0A 4MW9A 3CHYA 4JKOA 4MKIA 3IMGA 1Z13A 2YH2A 1L8QA 4ZVKA 4D8UA 1KIAA 4BO5A 4PX2A 2H2FA 3UUWA 4QPCA 3D6JA 3CR7A 1E1KA 1E1QD 1C4WA 1V7QA 3PIRA 3G0DA 1A04A 5I9TA 4AVYA 1XDZA 3DSRA 4NRDA 1CB0A 5F12A 3ROTA 1KEEB 4NOJA 2EQAA 3O91A 4R7GA 4MW6A 4MPRA 3KOMA 3CPJB 3RIGA 2GARA 3LQFA 3IODA 4D9FA 2A14A 1P0MA 3QE0A 2CB0A 1MJ5A 3ETCA 1W76A 1X86B 1PQUA 2H2AA 3NBMA 5DGHA 5DLQC 1ODLA 3U48A 4YAKA 5BVHB 3BWYA 2XZPA 3W8FA 3I1JA 5ED0A 5BR1A 1N9ZA 4KQIA 4D9GA 3OPXA 2FDCA 5IZCC 4WDRA 2R96A 3IOYA 4BL5A 2DQKA 1JPNA 4JT4A 2ES4A 3AIOA 4PLFA 5DTMA 4YAFA 3LQKA 3VTZA 1A1VA 3CINA 1Q0RA 3QVGA 4IRXA 3MPOA 1ZD1A 2IYPA 3IAAA 3C1UA 4JGBA 5J9FA 3ZGNA 2WG2A 2ODBA 3B70A 3OX1A 2BH2A 3GGJA 5C8XA 3I8XA 3L8EA 2JAQA 3UHOA 4BNTA 4CDNA 4RPGA 3LI2A 3O9VA 7ADHA 1W6UA 1KDVA 5E4TA 3FPJA 2FPXA 3ETGA 4UC0A 1BX3A 1B14A 1ZRMA 4N6OA 4GO1A 5J4VA 2Z2KA 4LDRA 4R4JA 4XRGA 4D3XA 5KTRA 2ST1A 1U1CA 4COOA 2GZRA 3WLNA 3LHKA 5ES4B 1Q7GA 3HSSA 1RHRA 4RF3A 4J90A 3HS0B 1JEEA 3A1SA 3UMGA 2YUIA 4LY0A 3IUQA 5EZSA 4ZI5A 1CS4C 3RKUA 5CB4A 5IABA 4RS4A 4G1BA 1DXYA 4JJZA 4AP6A 1TC2A 1H2AS 1TEVA 3VNQA 2D8MA 3BRCA 1UQUA 1RQ2A 5BMVF 4G65A 4ND5A 1EUQA 1FSFA 4A91A 4TVOA 1E2JA 2QTLA 3MWKA 3QWIA 1OB5A 2YC2C 1XCOA 3T06B 4X44A 3S44A 2MHGA 3UWKA 3K0EA 1U9ZA 3E22A 4RMHA 4TMTA 3S99A 3W7BA 3RS5A 1YFZA 3G2OA 3PKZA 4JXXA 4NPHA 3H83A 2H1LA 1QPGA 3S28A 1Y1KE 2H1FA 3MF4A 1IJBA 3R3VA 4LFCB 1EGQA 4II7A 5EUQB 3NCTA 1EFDN 4ZOCA 3QX8A 2ZYUX 3FPEA 2Z04A 3Q0EA 3JARA 2BFNA 3OT4A 4KQ1A 5ALRA 3PV0A 1ZCFA 1SD5A 3JYNA 4M0EA 2EOAA 1TCVA 2N47A 4PRYA 4QXAA 4DUZB 3U17A 4ZTZB 3S2YA 4JP8A 4NECA 4P33A 4LZPA 2XWPA 2R7AA 2ZSAA 2ZZNA 4JODA 4RKFA 5FUXA 2ILVA 1IBMB 3E27A 1QRTA 1XLWA 2PZJA 2V54A 2WP8J 2Q7XA 5IN4A 2GZ3A 2I55A 4O4HA 1R88A 4BQOA 3O82A 4L9SA 1FZQA 4OQZA 4YV1A 2ASVA 1TF2A 2EDAA 2HSWA 3OPYI 4KFUA 5J4YA 3ZZNA 4CUZA 4IHJB 3HLYA 3EMVA 4JLNA 3UK7A 3WV4A 3ASUA 3W1EA 5JYEA 4M0KA 1HRKA 4GX2A 1I8TA 2NV0A 1M2VA 2PMWB 2Q4DA 1WRBA 3I9OA 2Q7DA 4M0CA 2VF4X 1FE8A 3P7MA 3HB1A 5D2CA 3RYCA 2PT7A 1E2QA 1X70A 4GOXA 4CCWA 1N4AA 3PHBE 1VLJA 2C7VA 3FUUA 3IUMA 1FYWA 4L9WA 3GLIA 1KZGB 5HKKA 1D2EA 5EMLA 1RCTE 3PL5A 3ICEA 1P3DA 2YJZA 1J7JA 2REQB 4GE3A 4Y2QA 5DXJA 5FA5A 2IQ5A 3WK8A 1XMQB 3KEQA 5C1BA 1YMVA 3BWXA 4U39A 3VO8A 4BMOB 1TEXA 3MIIA 1HA3A 3ETJA 3IR7A 4RY8A 3VNVA 3VKGA 2AMYA 1YL7A 5JXHA 3ZDCA 4EP1A 5L40A 1KAEA 1MFPA 3TQSA 4WK0B 4OX9B 4ZO8A 1EX9A 4XWAA 2BMVA 2OFFA 4M8NE 6ADHA 3DMYA 2C3PA 1L7BA 1VJCA 4HLNA 4KKXB 4LHZA 4M88A 4C4ZA 5BP7A 1IZ7A 3JAMA 4CIBA 1PEKE 2VK8A 2IXFA 1GNSA 1II0A 1LPPA 3CT6A 3WWYA 3ZWKA 4D98A 5B3JA 4R05A 2J7PD 2FZ4A 3HVKA 4FI3F 3II6X 3DHNA 5L51A 4TWBA 1O58A 4ZOAA 2IPAB 2QP4A 2JGMA 3RFXA 3JYLA 2V8OA 3C7AA 4KWCA 2C7OA 1MA0A 2QVZX 4IJ5A 5B1IA 3T6KA 1IJFA 1BG6A 1T2UA 2ODEA 3EG9B 3OIYA 4RANA 5C3UA 5IAAA 1GEGA 2QKIB 1MEEA 1XFAA 2GCEA 5KTSA 4CF5A 2XXBA 2QRHA 2RC5A 3DZ8A 3QVWA 5KVQA 2P9QA 4NJMB 1N0WA 1Q7TA 3F4BA 2I4NA 2WK1A 4DLPA 4U0KA 3ZCPA 1C1HA 3FGPA 1GZ6A 4FMCF 4EB3A 1R0SA 5JSUA 4DLLA 2YXLA 1TQHA 3JWHA 2EVWX 4OU5A 2FMIA 1UXJA 1M6HA 3A1NA 4HWSA 5K8CA 121PA 1HC7A 1YRQA 1BHO1 2ZJYA 4K9PA 2A4KA 4QGAA 4B2LA 2D1FA 2OZVA 3WDLA 1Q7RA 1IATA 3M4ZA 2WQZA 5FWAA 2XWJB 3JQAD 4L57A 1ID1A 1TUBA 1JYEA 2H4HA 3N0TA 3IO5A 3EVCA 4MVJG 4ZO7A 3VSDA 3NBFA 5DIZA 2HJRA 3RRNA 4RZ2A 4GC5A 1F8XA 1E1LA 4JB0A 2XADA 4B4VA 5LZ4A 3HDHA 1RXWA 1RJEA 1DLIA 2HCRA 4X5OA 3HXKA 3IEIA 4G1CA 4DB2A 5LSAA 1E2EA 1E3IA 5KX5A 3HEBA 3RUHA 2A5JA 2DR3A 5EPEA 2W2LA 2XRYA 4QT4A 5EP2A 4BNKA 2QSUA 1Q7EA 3GBPA 3O4RA 4ZAGA 4C6TA 4ZYTA 1R1DA 2I07B 1XL0A 4XB1A 3KJIA 4GR9A 4MKZA 3DJFA 3L0SA 3T94A 3S27A 1CUHA 4C4AA 1UT6A 1C8LA 3KSMA 4S1OA 5T8KC 3NM5A 3LM8A 1OWLA 4G5XA 3GDWA 5ALHA 1RW4A 1WW3A 1NJFA 1UMBA 4DC0A 4LGMA 5DM1A 3UAGA 1O95D 2FZ5A 3O9MA 1T25A 3WI7A 4Z4CA 3KU1A 1BCSA 3LE8A 3K15A 3WAKA 3ZYCA 1KGDA 2VP2A 5IFKA 1A76A 5ERXA 2F1KA 4ER7A 2R7KA 3H04A 1G98A 1KO7A 2FCAA 1DSSG 4HGZA 2A1TR 5AVRA 1YKFA 4B9EA 4P5EA 5T8KA 3K9HA 2PH3A 5CM8B 5MFZA 5CNIA 1MHTA 1KEPA 1PJSA 2WSMA 2X4LA 2BFMA 3GUVA 1NURA 5K5EA 2FFRA 2JF0A 4H7KA 3S8MA 1EI9A 1XA0A 2QP9X 2RH8A 4EUNA 5DTEA 2BE7A 4XPZA 5FOQA 1GLGA 1KDPA 3G5MA 2AOVA 1SCAA 3GT3A 4PS0A 1VYHA 5F7ZA 1AMNA 4NBUA 1QNLA 2R6AA 4B46A 2XTZA 3O38A 3PNPA 1P7CA 4U3JA 1WUTA 4XWGA 1VE6A 5BYAA 5I48A 5BPHA 3HJNA 3KYCA 3F71A 4B3JA 2NT3A 1DADA 2W2NA 3RS4A 4YR9A 2Y1EA 3TOSA 2ICAA 1SBTA 4PY2A 1DIOB 1OXVA 3R5SA 3P2EA 4QGGA 2E49A 3C3DA 1QVWA 1Z0IA 4GWGA 2PBLA 4L6CA 4NNOA 4U0JA 3T0GA 3UMFA 4CUJA 1HNWB 1B6SA 3BRQA 2XYPA 1F20A 4F5WA 1W93A 2QL7A 2QX6A 3ACDA 3W4JA 4MJLA 1GR1A 1XF9A 1FX1A 1VB5A 2YXBA 2B4QA 1OAKA 2I1LA 1XK7A 1KNXA 3E5HA 2IHYA 1S2GA 2E21A 3OLYA 1VECA 4ZHQF 1DCTA 4NZOA 3HY4A 2D13A 1AXGA 1FDRA 1CETA 3A8TA 3QV2A 4FFSA 4FLMA 4GOND 4LMBA 1BDHA 3VJKA 3D2CA 2RHLA 2JNWA 4KC0A 5E6RB 2ZRGA 5FLYA 3RREA 1VL6A 2VDNB 3ESRA 3L84A 1VOTA 4POAA 3JRXA 3UV6A 1XVLA 1GPBA 4DJDC 3RV3A 5F98A 2W8BB 2GSWA 4J4TA 5IC6A 2GN9A 1L9XA 1KJZA 1M1XB 2QQ0A 4Q1EA 4Q37A 5T41A 3HRHA 5IJWA 1KHHA 4NBVA 5CK5A 2YWXA 3TG8A 2GAIA 4NMXB 3VH3A 4O3FA 1OLXA 3LFUA 3EPJA 5CXUA 5EPUA 1R0RE 2O0JA 1UL1X 2X23A 2H5IA 3HABA 4I50F 5CJJA 1DEKA 2Y27A 3PPIA 5K3FB 1IBLB 1P9RA 2ZOSA 3L7NA 1J6UA 4Y2RA 4CEHB 1T26A 1XHLA 4GW3A 3ANLA 4QOEA 3U4HA 1JU4A 2ZBVA 4NZ9A 5H82A 4QG7A 1EFUA 4C7MA 5AW9A 4M8KA 3ZIDA 4BO9A 1DJMA 1GG9A 3O3OB 3A36A 1C2TA 2ZBQA 3IQGX 4I19A 1T0JB 2YXNA 4LNHA 4AURA 2B4RO 2JD0A 3Q11A 4IKEA 3ZX5A 4EBFA 4TRRA 2GTHA 4QYSA 5EIEA 3CNQS 2GPTA 4OFBA 1G6HA 3LZDA 4R2JA 3N87A 4B2IA 3OWOA 5F1PA 1L5ZA 1U31A 2J5QA 3DO5A 3I9V1 4R1MA 4XB6B 3MS4A 3HQ4O 5E4JA 3F6PA 3ZNNA 2O5RA 4FYVA 4GUDA 5ALGA 2IYQA 3IB3A 5EVCA 4GEKA 3VKVA 3CURA 4TTTS 1DIBA 3DYIA 3O92A 1NRJB 2WIIB 2FVYA 4BV2A 4BB9A 4O4LF 1YHZA 2C2KA 1BEZA 4MQMA 5L3SA 5CGQB 3IURA 2C9MA 1BDMA 3VR5H 3U7RA 4C0WA 1FX0B 2ZVQX 4LQ4A 3FWYA 3PKIA 3AG6A 3H9EO 1ULAA 1POWA 3R4CA 2W6QA 2FZWA 5IC5A 1U3UA 4EJSA 4A7PA 5FI3A 1A2OA 5CYPA 1ADGA 2PBFA 3HRIA 3I2YX 4TMVA 4KO4S 1ZFNA 1A2BA 3OZSA 4H77A 2AEFA 4LJ8A 4LOIA 5DTJA 4ZFNA 5CFPA 2CEAA 9LDTA 1XRRA 4PCLA 2L18A 2FFJA 1EXWA 2CNNA 3PQCA 821PA 2KJQA 3RIEA 1W8DA 4NYIQ 5BOVA 3L7BA 4FMDB 2B9EA 3GJ5A 4C0BA 4EMTA 2W6CX 2ZRQA 3AVPA 4A0QA 8GPBA 4HEA1 5HQ3A 4MQ5A 3CQ9A 4MXDA 2DRIA 4L6IA 1M2GA 2HU2A 3A4TA 1WMSA 4JP3A 1AQ6A 1C9MA 1QGOA 1Q2UA 1X8KA 2ZPUA 2H48A 2IZ5A 4KFTA 2ZRFA 2OCIA 1IYZA 4DR1B 4ISBA 3IBSA 3QJYA 4L4SA 2GDJA 4X00A 4ZAZA 4EG7A 3ZHBA 3BXPA 4Q39A 4L8YA 3R7WB 4HEJA 4MWCA 4CGYA 1XL1A 2WHXA 3PJGA 3E9QA 2L82A 3K5PA 3E2PA 1E9EA 5I9NA 3PITA 4UDYX 2JK0A 1Y6FA 1I2BA 4KO3S 4ZZ2A 3J81k 3MC1A 5REQA 5CIQA 4PYJA 5BPFA 5LM3A 3C8DA 4H3SA 4JC5A 1U5CA 1KU0A 1B26A 2V5UA 4G85A 1XJCA 1HUQA 2HC9A 4YWJA 5DGIA 2X3FA 5IDQA 3JZFA 5DEIA 3M9LA 221PA 2V03A 1O03A 2PL9A 4YDRA 3I2HA 3MTQA 1W5AA 2VBFA 1SR8A 1MKYA 2W43A 3RVQA 1KARA 4HMPA 3MJFA 4E32A 4I5FA 2PXXA 3FBWA 2WSYB 4AKTA 3B6EA 4R83A 1N1DA 5E9AA 2BCGY 5CH5A 4R9SA 3ZDAA 2VCYA 3SNKA 3FOEC 2OZKA 2GJSA 4FBGA 2R85A 4G5QA 4RJLA 3VPDA 3QF7A 4ZVQA 3UAYA 4EQZA 4YMTA 1ZCJA 3H8SA 5ELXA 1GQFA 1LF0A 1DQSA 4NI5A 4NE9A 4TS4A 3CLUC 3AF5A 2EU8A 1AHPA 5T64A 3M1AA 4HUJA 1GWNA 1A9SA 4OFWA 2BC9A 3EDYA 1VJ0A 5E9QA 2PRZA 4L28A 4DB4A 4RVGA 3GRKA 1PGNA 5J2TA 2G5TA 4V1CA 1ODKA 4NEQA 2LZ0A 1H3FA 2B4AA 3SBXA 4RD3A 4MICA 2IELA 3VR6H 2POQX 2XY4A 1DP4A 1RAEA 2VTEA 3EFBA 3WA6A 3HM9A 4FYPA 1G4AE 4NCXA 5FPPA 3TRHA 1F60A 3AKZA 3GRUA 1OASA 1U8XX 1NOIA 3WYGA 3ZE7A 5CA0F 3JQ8B 3VUEA 1ZIXA 4UXHA 1WQ4A 1X14A 2O2ZA 2RAFA 4B5LA 1GPUA 2PT9A 1V7PC 4GC9A 1TA9A 2HWYA 2JKZA 1GJRA 3KLMX 3OIGA 3G2IA 2G5PA 1XJ0A 4XTCS 4DZRA 3U5TA 1NAHA 2A78A 1G55A 4JA2A 1H3EA 3KQPA 3GJ6A 2I4OA 2J5RA 3C5VA 4KNVA 4MP6A 1OPXA 4BO3A 2GHRA 1QIEA 4BO4A 1J2EA 2IA5A 4YRZA 3KOWA 3TOVA 5BSWA 1YACA 2Z6UA 2BGRA 1C7ZA 2WFLA 3H65A 4E1AA 2SKDA 3LTEA 5A1JA 4RABA 4NZMA 4TT3D 2J6BA 1X42A 1Z45A 1I6MA 1K9SA 3FFAA 3NG1A 1C1XB 3CIFA 3HSYA 1WXQA 2WEKA 3D6MA 3TDKA 4BC1A 1SXIA 2R1VA 4LXTA 1BIFA 3QIAA 1ONPA 4JCCA 4JT9A 3QU9A 3YASA 5AIBA 2QX4A 1NN0A 3HGMA 1LLCA 4ESOA 2AOWA 4JLOA 4X1YB 2NIPA 2K4MA 3GCWA 4RJJA 1L1FA 3SVZA 4KTTE 4WFQA 2VF2A 5A4DA 2Q3MA 4CBVA 1BHSA 3FFWA 2GGSA 2XMDA 2E4XA 2UYOA 4Q4AA 4XEHA 3V8NA 4ZICA 3P2MA 1FJ2A 3ENVA 2V1UA 3FZGA 2YS6A 4OVKA 1GNLA 2XXAB 1Z5WA 1OVGA 1OWOA 2G83A 2MTBA 3D7SA 4MWOA 3ROXA 5AOCA 3QEMB 4EA8A 2BEVB 1GQQA 2G4LA 3UUFA 2CGEA 3ZZTA 1E8MA 1UKVY 4GSYA 2F67A 1TU4A 1R66A 2A88A 3DZFA 1E6WA 1EGVB 3EAGA 5THQA 4CL2A 2V5VA 1M75A 3CR8A 6PFKA 4J49A 1RU3A 2NTNA 4QFDA 3I6BA 3OQIA 1ZRNA 2D5LA 3LDHA 2O2EA 1YR1A 1JVNA 2VHCA 5A05A 4B47A 4ZEMA 3SG0A 2P3QA 4S35A 3W1VA 1CY6A 3QLVC 1SKQA 2I91A 1S2NA 4GXNA 1DOZA 2XE7A 3N8KA 5BSRA 4V38A 1XMVA 3RGWS 2R6JA 2OCPA 3LIIA 1FXWF 1AMUA 3BMQB 4R2MA 1V5FA 2OBBA 3FVRA 1NI3A 4IIGA 1QB7A 2DLDA 3O94A 3V46A 3U7IA 1H65A 2Z6VA 1XHEA 2CLIB 1N3LA 3ABRB 3DDUA 4DG9A 4BX9A 2ZE7A 1GGMA 4G2NA 3IMCA 4OHOA 4AM8A 5KNCA 3MCUA 4ER6A 1RQLA 2K2QB 5FBKA 1P0CA 4DSOA 1KZ6A 4GL2A 1YQUA 3R74A 3PA8A 1LGYA 2OGTA 3H3JA 4GX0A 5K8UA 4CKEA 4EJ6A 3RTAA 1PG2A 4WFJA 1LCIA 1KO8A 3B7GA 3CTPA 3G2QA 2ZTUA 3FPBA 4IF6A 4WX2B 2WIGA 3ICWA 4X84A 4WL0A 4YP7A 1GNTA 2A9OA 5NLLA 3TAXA 1UPTA 4JWTA 3TEJA 2D1SA 4MQEB 4W6QA 2VK1A 3BS4A 2FN7A 1U0FA 5CFNA 1YVDA 4TYYA 1W19A 1ND6A 4JL5A 1JAHA 1RC0A 2CJWA 2WIAA 1QGAA 3DXXA 3RK0A 4ESHA 3TTVA 4IS2A 3SDBA 4W9RA 2Z4RA 1WUYA 3A1UA 1UPFA 1CUVA 2QMUA 4GGOA 3K70C 4ND3A 1H66A 2XITA 3KTDA 4XM2A 1CG6A 2W6JD 1MDFA 1WTCA 3FUCA 4Q0MA 1NQXA 3NU1A 3RGGA 4BCBA 2QYOA 4C08A 2OV3A 2P5UA 3FIUA 3H7AA 2V0NA 1MG0A 1ZKMA 1OLSA 3EAQA 3M5WA 1WY5A