3BXOA

Crystal structure of streptomyces venezuelae desvi
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
236
Chain Sequence
YEVDHADVYDLFYLGRGKDYAAEASDIADLVRSRTPEASSLLDVACGTGTHLEHFTKEFGDTAGLELSEDMLTHARKRLPDATLHQGDMRDFRLGRKFSAVVSMFSSVGYLKTTEELGAAVASFAEHLEPGGVVVVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRMEVHFTVADPGKGVRHFSDVHLITLFHQAEYEAAFTAAGLRVEYLEGGPSGRGLFVGVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N,N-dimethyltransferase
publication title Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
pubmed doi rcsb
source organism Streptomyces venezuelae
total genus 78
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.1.1.234: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.10 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases CAC2371-like domains 3bxoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bxoA01
1ZGJA 2PT9A 4A6DA 2AS0A 3DXYA 5GM1A 2XVAA 4Y2HA 3JWIA 3DLIA 3C3PA 5LQUA 9MHTA 4L7VA 3FPFA 2IDJA 3EPPA 2Z6UA 3P9NA 3FUTA 3RODA 5EEGA 4QQNA 4CKEA 3P2KA 2ONYA 2O07A 3EVGA 1EG2A 3OZTA 3P2EA 4IKPA 2IH4A 1JR4A 3DTNA 1BHJA 3QOWA 2P3OA 5EHIA 2OYRA 5K01A 2PKWA 3HTXA 3C0KA 3EVBA 2PXXA 2EJTA 4E31A 5K8VA 2PBFA 3DMHA 4RTSA 4E30A 4X63A 3H2BA 5DXJA 4B17A 3G5TA 4RTRA 3E23A 3G2MA 3L8DA 5ICCA 2EX4A 5FHQA 1XCLA 3I64A 5FULA 4PCAA 3MTEA 2Z6QA 3M6WA 3KR1A 1G60A 2CL5A 2IGTA 3FYDA 2NXEA 2ZBRA 4FSDA 4HGYA 3MGGA 4YV1A 3FTCA 1Z3CA 3PX3A 2QRVA 3AJDA 2YR0A 4HC4A 4RTMA 5C1IA 5FTWA 2IDKA 2ZSUA 3EVDA 3EVZA 3DMGA 1P91A 2XVMA 3DP7A 3M33A 1JG3A 3MCTA 1NW3A 4NECA 2B9EA 3UJAA 5EZQA 2P35A 3TFWA 5IKMA 4EKGA 4GC5A 5CVDA 3LDFA 5K05A 3FRIA 1QAOA 3BKXA 1P39A 3DUWA 1KPHA 3LDGA 2HNKA 3THRA 3O4FA 5T64A 2AVNA 4HTFA 5CM2Z 2EG5A 2K4MA 5DT2A 4DCGA 2G70A 3GGDA 4MIKA 3KPUA 4OQEA 3TQSA 5K0CA 3VYWA 4E2WA 2P8JA 4FP9A 2UYCA 3ME5A 1X1CA 3BT7A 1INLA 3PFGA 4KIFA 2AOTA 5T6BA 3HVJA 3CCFA 5DSXA 3MAGA 4JXJA 2CWWA 2Z6AA 1M0EA 4E2ZA 4OX9Y 4CXMA 1SUSA 4IV8A 3A7DA 2NYUA 3TOSA 3ELYA 3AWIA 3HM2A 2YUIA 3KQQA 4H0NA 1BOOA 3R6TA 2ZLBA 5GIPE 3PFHA 4QVGA 1VP9A 3TPZA 1RJFA 2YXLA 2FYTA 3M6VA 3BUSA 4LWOA 4QVKA 3EVAA 4K6MA 4M7RA 4QTTB 2OKCA 4PINA 1JQEA 5DSTA 3X0DA 3FTEA 2FK8A 4R05A 3UFBA 2UZ4A 1H1DA 1RJGA 2YXDA 4KDRA 4M37A 1HMYA 1XJ5A 2NXJA 5EC8A 4FS8A 2QRVB 3EGEA 5DM0A 4RTNA 2OXTA 1L1EA 4HSGA 5EVJA 2B78A 2ZZKA 1WXWA 3GRZA 3ID6C 5CCXA 5E1DA 3RW9A 1EQAA 4C07A 3QV2A 3UJ7A 5MHTA 2ZFUA 3TM4A 3GRRA 2ZTHA 5LQKA 2I9KA 3OZRA 4U7PB 2FCAA 4KWCA 3K6RA 3MCZA 5HIJA 3UJ9A 2XBMA 4HTFB 1NW8A 3DOUA 1WG8A 2QE6A 1NW7A 3DLCA 5ICFA 2ZBQA 3FYCA 2H11A 3KR9A 2P3QA 5BW5A 1VLMA 3BGVA 3KR0A 4RSRA 5D1HA 1FJXA 1G8AA 3OU7A 4X61A 1SQFA 4FR0A 4PGGA 5FUBA 2BR5A 1ZG3A 4A6EA 5F2NA 1YZ3A 3G5LA 3JWHA 3FTFA 2P7IA 3EGIA 3KPVA 1I4WA 2IIPA 3PT9A 4AUKA 4GOND 3WSTA 1L3CA 4PIMA 4QQKA 4V0RA 3LX6A 2NXCA 2PV0A 2UYOA 5DTMA 1JG1A 1L3IA 1UWVA 5K0NA 5E8JA 5DWQA 1IM8A 3A7EA 4PYLA 4P7JA 3HCCA 5CVUA 3LBFA 3LBYA 1N7JA 4C03A 5KQSA 3I9FA 1L3BA 1G6Q1 1WS6A 3LDUA 1JQDA 4PYNA 4GQBA 3U81A 3OFJA 3UZUA 1AQJA 3NWEA 1NW6A 4GEKA 1KIAA 2ZW9A 3HA3A 2GLUA 2FPOA 1NBIA 5DRTA 3R9XB 4WXHA 3NMUF 2VDWA 3G89A 3GJYA 1TW3A 4XUCA 5K0JA 2HTEA 3ELWA 3C6MA 3KQWA 1WZNA 4DMGA 3P9CA 1U2ZA 5DM2A 5BW4A 2P1DA 4FT4A 1XDSA 2JH8A 3G8BA 3HVKA 1O9HA 1N2XA 3LL7A 2ZWVA 4RVHA 3A26A 2O0LA 3O31A 3C3YA 5CVJA 4DM3A 4AZTA 3BWCA 3LCUA 1X1AA 3MERA 1EJ6A 3FRHA 5DXAA 1JTFA 1KYZA 2E5WA 2Y1XA 2ZBPA 3TR6A 4ER3A 4OBWA 2GA9A 1V39A 2IBSA 5FQOA 3KQMA 3OE4A 2C7OA 2V7EA 5K0BA 2O05A 5E9QA 2UYHA 5C9ZA 1D2CA 1G8SA 4RVDA 2G1PA 3UWPA 1KHHA 1ZKDA 3EGVA 1JG4A 2OB2A 1DUSA 3M4XA 2IH5A 3DMFA 4GC9A 4DF3A 5ERGB 3B89A 5FQNA 1NW5A 3E05A 5GP1A 3UJBA 4E70A 1R8YA 4ZTBA 5DX8A 4CWAA 3FPEA 2PX2A 1XVAA 5DX1A 3IV6A 5DM1A 5E9WA 2I7CA 4P7KA 3A27A 3I5UA 5EG5A 2HMYB 1SQGA 1SVUA 3LKZA 3KPJA 2YX1A 3NVMB 4GUAA 4BY9E 1QZZA 4HGZA 1QAMA 1JTEA 2ESRA 4POOA 10MHA 4XCXA 5GOZA 2JHCA 3DULA 3T7TA 2PXAA 4P7FA 2G72A 5HFJA 1AV6A 5KVAA 2HWKA 3EMBA 5KQRA 1JQ3A 2ZULA 3M70A 3ER9A 2NP7A 5EZSA 3OCJA 5LQJA 4DKJA 1VIDA 3TKAA 2NNWB 2EJUA 2IBTA 4OA8A 1BKYA 2N47A 4YUXA 4EKIA 3ANXA 5FA5A 3SX0A 4BP3A 3NTVA 5E8RA 4OQDA 5FADA 3O7WA 4C08A 4RTLA 2PWYA 2VDUE 4GOMD 5EIFA 3PTAA 3LKDA 4HRAA 2AZTA 5DLYA 3GRVA 3PB3A 4PGHA 1L9KA 2GB4A 2ZIEA 1F3LA 3KR2A 4GBED 2OPBA 3TRKA 3G2OA 5LQRA 4KIGA 2P40A 1FPQA 2AOWA 3HCDA 1VPTA 3LECA 3LSTA 4R8RA 4AZWA 3OU6A 4EVIA 5CD1A 1AF7A 3D2LA 4KRGA 3MQ2A 2AN4A 3ERCA 3HCEA 3M6UA 4FT2A 3B5IA 1X19A 3HA5A 3B3JA 2JG3A 1KXZA 3V97A 2NP6A 3VC1A 2OZVA 5HIMA 5GINE 5B1SA 3EEYA 4PIPA 3SXJA 2VS1A 4RYLA 1NV9A 1ZQ9A 5K0LA 3GXOA 3DXXA 3G7UA 4GOOD 5EKXA 2ZIGA 4YUZA 3LCVB 5ICGA 4ER7A 3KU1A 1R6AA 3THSA 2F8LA 1VBFA 3R3HA 3T7SA 3OE5A 1FP2A 1ZHFA 3S68A 3UBTA 3B7PA 3HVHA 4PYIA 4AZVA 1RI3A 2B25A 3HCAA 2JHPA 4YMGA 1MHTA 5F2OA 1RJEA 1IXKA 4C05A 4KVZA 2O06A 3HEMA 3MB5A 3Q87B 5E2BA 3RIEA 2G71A 5FWDA 4ER0A 2BH2A 1I9GA 2VDVE 1XDZA 3GIWA 5EPEA 5LQCA 1HNNA 3BWBA 3G88A 2FRXA 3A25A 4HH4A 4RVFA 3UJ8A 3ELDA 4CTJA 3P8ZA 1RJDA 1Q0SA 1FP1D 2BZGA 2YTZA 3NDJA 1G55A 4M36A 4MQ4A 5IH3A 4X41A 7MHTA 2R6ZA 1JSZA 3HP7A 3HNRA 4RV9A 4BLVA 4CKBA 4FGZA 2GS9A 5T67A 5K0GA 1EJ0A 5HZMA 1WXXA 2DPMA 5M5BA 3EVCA 4U7TB 5EGSA 5EHGA 2G8NA 4G56A 5BP7A 3CGGA 5C0OE 5CUQA 4PNEA 1SG9A 3LGAA 5CVVA 3HVIA 4C4AA 5K0EA 2WA1A 4PYQA 2QM3A 4PWYA 4LECA 4PYOA 1X1DA 2JH9A 3SM3A 3VSEA 1P1CA 2FK7A 4QTUB 4E32A 5EMJA 4DZRA 3A4TA 2BR3A 4OBXA 2YQZA 2ZWAA 3PS9A 3GU3A 4XUEA 3EVEA 3KQTA 4FZVA 4IWNA 1D2GA 1QANA 1KPGA 4EMSA 2ZCJA 3OU2A 4FSXA 1YFJA 4R6XA 4PYMA 2PT6A 3SSOA 2YVLA 4UOEA 3ER8A 1F38A 1G38A 3VC2A 2AR0A 2PVCA 4ER6A 4MTLA 5HIIA 2NXNA 3E7PA 5U4XA 1T43A 1X1BA 2V74B 3T0IA 5BXYA 1JG2A 3UA3A 2KW5A 4KW7A 5EMKA 1PRYA 1UIRA 3AXTA 1NBHA 4RVGA 4DQ0A 2XYVA 1VE3A 3MHTA 3IHTA 3GNLA 1MJFA 4ATNA 1XXLA 2DULA 4DA4A 1EIZA 3JWJA 3SVZA 2AN5A 4MWZA 3C6KA 3FPGA 2ORED 4PYJA 3LHDA 2R3SA 1FBNA 5G02A 3FUVA 3NW9A 2BM8A 3PVCA 5CIYA 3CJTA 2B2CA 2OO3A 1RI1A 1RI2A 4QDJA 4V0QA 3B3GA 3TLJA 3CBGA 4QDKA 5FA8A 1M6EX 2O57A 2P41A 1TW2A 4OA5A 1YUBA 3HCBA 3KQPA 1R74A 1R8XA 4C04A 4F85A 5HOQA 3OZSA 3NWBA 2VZ9A 5H02A 2PLWA 2Q41A 3DR5A 3KQYA 4PYKA 5ICEA 3EVFA 1PJZA 3FPJA 3OFKA 2ERCA 2HR1A 3IEIA 4GF5A 3FTDA 4P58A 4R6WA 5EMMA 3P97A 4F84A 2PX4A 2IPXA 1XTPA 1P1BA 2PSSA 5GWXA 3QOXA 2AOVA 1O9GA 3ORHA 4YV2A 2B3TA 4RTOA 1I1NA 5D1NA 5E1OA 4CKCA 3BZBA 4WVLA 3NVKI 3OPNA 4E2YA 3KQOA 1VL5A 3BGIA 2PXCA 4F86A 5LR6A 3BGDA 1KYWA 3LPMA 4QPPA 5DX0A 2I6GA 2PWPA 3GO4A 3SMQA 3BWYA 4GOLD 1ZGAA 1WY7A 3IYLW 3FZGA 3CVOA 1YFLA 1D2HA 4RTKA 1RI5A 2AOUB 1YF3A 3CJRA 2C7RA 1JSXA 5EIWA 4YUYA 5EEHA 3BWMA 5EMLA 3PLAE 1RI4A 3AXSA 4Y30A 5HILA 4MHTA 1AQIA 2ZVJA 5DM4A 4YUWA 2BR4A 5DTRA 1B42A 3DH0A 4E2XA 1Y8CA 1VP3A 2JJQA 4RX1A 2PY6A 3UJDA 3LCCA 2GH1A 2P3LA 3GWZA 2JHAA 4IV0A 1KR5A 1VQ1A 1UFKA 3BKWA 4RTQA 1QYRA 3FUXA 4E33A 3B3FA 8MHTA 3P2IA 1ORHA 5LQAA 5EKUA 5GM2A 1SUIA 4YUVA 1OR8A 2PJDA 3G8AA 3KKZA 3I53A 3KPYA 5KYGA 5JR3A 3GRYA 4EQZA 2PX8A 3REOA 5GIOE 5K0FA 2ZIFA 4PCLA 1IY9A 1XDUA 3BXOA 3R24A 2AN3A 2FHPA 2IP2A 4M38A 4PONA 4LG1A 2A14A 5EOVA 5HEKA 1KP9A 5HIKA 3CJQA 5CVEA 4X1OA 3TMAA 4ER5A 2IFTA 4LWPA 2LD4A 5E1BA 5E1MA 3CKKA 4HG2A 3EMDA 2C7QA 1ORIA 1DCTA 2EFJA 3KQSA 1NV8A 1TPYA 2QY6A 4KDCA 1BC5A 2ZZNA 2GPYA 3F4KA 1QAQA 3HCFA 3G2QA 4ISCA 1EAMA 3SSNA 1YB2A 3T7RA 2CMGA 4RTPA 3SGLA 4X60A 3UJ6A 2AVDA 4CTKA 4EK9A 4YV0A 2I62A 5LSAA 5CCBA 2ZZMA 4O29A 3G2PA 3K0BA 5FWAA 1NT2A 4RWZA 3TM5A 2GAFA 3KPWA 2H00A 5P8WA 1NE2A 1R00A 3JWGA 5DTQA 2PGXA 3V8VA 2WA2A 1DL5A 2WK1A 2BM9A 4P7GA 2OBFA 3P9IA 2IH2A 3EEOA 1M6YA 1YZHA 1KPIA 1N7IA 3PX2A 3NJRA 5JUWA 3FUUA 4AZSA 2AOXA 2XYRA 3GDHA 3HA7A 4AX8A 3ELUA 3R0QA 3NDIA 3MTIA 2Y1WA 5DRYA 2AOTB 3GCZA 4QPNA 2C7PA 1O54A 3FPHA 2CMHA 1R18A 5FHRA 2OB1A 5E2AA 2PX5A 5FCDA 2HV9A 5KS2A 3M6XA 3SSMA 3AY0A 2YXEA 3TKYA 4RTJA 3DXZA 3FUWA 4BLUA 3P71T 3I58A 4R8SA 3UA4A 3CC8A 3Q7EA 2P7HA 4BLWA 5F2KA 2ONZA 5EQJB 1XCJA 3E8SA 3SR4A 4BP1A 2CKDA 4XUDA 4Z2YA 3GRUA 3KQVA 4C06A 2UYQA 1Q0TA 2AOUA 3UJCA 1SKMA 2OY0A 2XYQA 5LQNA 5K09A 3P9KA 5K03A 2H1RA 2VP3A 3KHKA 4YMHA 1NKVA 2ADMA 4DCMA 5DPMA 2QYOA 5E9JA
chains in the Genus database with same CATH superfamily
3ECAA 2HA2A 1OLUB 3LP6A 4ZVOA 4NH4A 1EFDN 5FL7A 4MVYA 4YWJA 5CDGA 1ZVQA 3P9PA 3TL6A 2DWQA 1HFEL 3KUUA 4LJRA 3P9NA 1UJCA 2B8JA 1OPRA 3EVGA 1YHZA 3JQGA 2FUG1 3BOSA 3PGJA 4JENA 4UUBA 4BZPA 4AIRA 5KOJA 2IHBA 4Z9BA 3UQYS 2OYRA 1U90A 4CMJA 3COJA 1KQFA 3K5WA 4QGSA 4QNRA 5I9LA 1HL3A 5K8VA 3C8DA 2IYVA 3O21A 4PN3A 5J4KA 3ADOA 3ANSA 3ZD9A 4X63A 3L9WA 3U5TA 2H1HA 3KDSE 2HEIA 3OAAD 2BSAA 4FK8A 4H3HB 4IHJF 1Z7GA 5DHQA 5I7SA 5ES4B 3O1HB 3PICA 3FIUA 3EE6A 3QWAA 4CM1A 1CJCA 1XCLA 1DVRA 4FCVA 4XIIA 4EY7A 4LRWA 3FSGA 4QU5A 4EY8A 1LRLA 1NVDA 1S89A 2HQ1A 4JLBA 1D0IA 4AECA 2Z6QA 4J0FA 2HMWA 3FMVA 3K1ZA 3FYDA 3H5LA 2PK3A 1T0JB 4DA9A 3ZS9A 2AMYA 2Y1CA 3JZAA 2PQMA 5HK8A 3ESBA 4G5YA 1YHNA 3RRZA 2OCDA 4EYQA 1TO1E 1TEVA 2O7SA 821PA 3N76A 4YX9A 1QQAA 4NNOA 3HXPA 1IUNA 1JX6A 3TFWA 3LBAA 3BRQA 3W5DA 1IBKB 4JXZA 2YFHA 1YR9A 4HLQB 3TWOA 4YAJA 1AHIA 1SCKA 3W5JA 1TO2E 3AUFA 4BTVA 3R1IA 4Q7QA 4X6YA 1KI8A 3THRA 1N3IA 2FEMA 4LDJA 1G4UR 2VJDA 3BEDA 4LZZA 1MMFB 3A58B 1JA1A 1TMOA 3MOGA 2VJKA 3LOPA 3CM0A 1NWCA 2IYYA 2Z2YA 3D6UA 1XWIA 1PJ8A 3L1HA 3V4PB 3RSLA 3O8OA 1DTEA 4CODB 2Y0BA 3HXQA 4ZAYA 5T6BA 5DSXA 3MAGA 2QRPA 4ZI7B 5B3JA 3GLGB 2I22A 3B2NA 4I8IA 1KR2A 2G7ZA 2HFKA 3A7DA 2Q62A 3SZRA 5G3ZA 3SU8A 4Q9DA 5B2FA 2VQ6A 5H3CA 1KK3A 1KDYA 2TMDA 1E77A 2ASVA 3ACCA 3EA4A 4B5KA 2QRZA 1CPYA 3U4QB 1FZTA 1RJFA 2PSFA 2VHUA 3KUCA 4RD3A 2P9ZA 4I50A 3FTEA 2H2GA 2OKCA 1USVA 3BTSA 1DIGA 4DBZA 5DWDA 2FN9A 1J5EB 4A92A 1XZDA 4ZVKA 1YJXA 4DQKA 3BIFA 1HMYA 3U7JA 2ILVA 1GZ6A 1U0TA 4HQ6A 4PC7A 4FU0A 2Y93A 5HBRA 4TWBA 2YMPA 1CHNA 4HAWA 5F7OA 1E4OA 4Q1FA 4GMKA 5E1DA 4C07A 5EJ4A 1XNJA 5BWNA 1HWYA 1TD9A 1CB7A 1MO5A 2VK2A 3N75A 4X1KB 2VYCA 1RC8A 1C3LA 3PR1A 4D3FA 3U37A 5KU1A 3GA0A 1JZSA 3M5WA 121PA 3RS8A 1AKMA 1AO3A 4N54A 4HNVA 2H6EA 1Q44A 4IO0A 1EQ2A 2OD9A 1RW4A 4QPJC 3UB4A 2WYHA 4OQNA 4AFNA 3PUIA 5K4HA 2Y05A 1KTIA 1JE0A 2C4MA 4H7HA 1XBTA 1OB5A 1Z07A 1IATA 4AF7A 3OA0A 5BQXA 4MW5A 2CLSA 3WB0A 2LBPA 4ID9A 2C4HA 2GTHA 3H65A 2D7JA 2P2SA 2YHBA 3B3QA 3B20A 2WINB 1OKKD 1LBEA 3C8UA 4RXUA 3E6AA 4EG8A 3T5CA 1NZFA 3C5EA 4R0NA 3FNQA 4PC2A 1H2AS 1PR5A 2BDUA 1ZBQA 4GMHA 4DXHA 1Q21A 2CUTA 2HLNA 3F47A 2W2LD 4I4LA 3UBMA 4KPGA 3IUMA 5J47A 3IGFA 4OD0A 1BDBA 2EKPA 4Y1RA 5TF4A 5I7RA 4PYLA 4UTOA 3VGJA 1NJFA 4PO1A 4TYMA 2H1CA 2QZ9A 5CVUA 5K8UA 2RKBA 3WIOA 1UKEA 3ZIAD 4F04A 2NUBA 1TX4B 4MUBA 4K0RA 4E5SA 1FQWA 4O25A 4MROA 5KAMA 1J21A 3U3RA 4H35A 1XRJA 2RK4A 3BCRA 3B5EA 4GEKA 4JLVA 3HA3A 4UNRA 3N74A 1DJQA 1O8BA 3R9XB 1XL0A 1I7PA 1Y1KE 4WVFA 4X8MA 2VF7A 1CY2A 2X2FA 2ODPA 5IYZB 1YR1A 2HI0A 3IIIA 3LPDA 4AN0A 1OYWA 1PG2A 3OZIA 1G8PA 4MUEA 1I80A 2XNDD 4OXNA 4WNAB 2JH8A 4QUDA 4BMNA 3BHNA 2H57A 4MNTA 3GLHB 2WC1A 1HOTA 2ZJFA 3NOOA 3UWSA 4DV0B 1G63A 1HT1E 4IQGA 1NUQA 3I12A 4MLPA 3TJRA 1XPOA 1BE1A 3RGWS 4FFLA 4EGFA 3NIWA 5IBQA 2CBXA 2CJFA 1M1YE 5FQOA 4ZDIA 2ZB8A 1RWKA 2P2ZA 3OE4A 1ZJ4A 3VR1A 3W8EA 2XNSA 5H4HA 2UYHA 4IDCA 1D2CA 3DPUA 2EU8A 2OD2A 3NRCA 3N8KA 2H8GA 1ZKDA 3EUEA 4FMBB 4Q1EA 2OB2A 4AF8A 3N8NA 2HSGA 3D8TA 4WBXC 2YINC 4BNVA 2GHQA 3MK31 4BZWA 2FQQA 3LX8A 1ULHA 5KTNA 2DR2A 4XB2A 4XQEA 1WXDA 5GP1A 1JDJA 2O3JA 3RS4A 2HNAA 2AW3A 3G7SA 3HCWA 4IJKA 4YO8A 3WNBA 2XIQA 1DEXA 3G13A 3P96A 3D7NA 1X7XA 2GQ0A 3FCYA 2UV8A 1GV0A 5CLLA 2EP7A 5JVDA 2FJPA 3ZJUA 2GYYA 3DDZX 3DZFA 4JSRA 1OH7A 2WZDA 1QZZA 4LNUA 1XFDA 5L8VA 3KXLA 2VTBA 5DNEA 5GOZA 1KBOA 4UD6A 1A72A 4Y9SA 1SVLA 3NGMA 4FEYA 1H0RA 1MO6A 3BFKA 4X6XA 1G8MA 3P52A 3PP8A 2CLIB 3VYVA 4B8WA 5KVAA 1KMHA 1S3GA 1KEEA 4E11A 1MIHA 3OFSA 1R3UA 4DARA 5AW3A 5EZSA 5K8JB 1FVOA 3CNHA 1RZRD 5C5DA 1YA6A 1RIIA 1MIOA 4OHUA 3PDCA 5E95A 1KYIA 4XVCA 4MYUA 4GOMD 1XLWA 2WKWA 3BD6A 1M67A 3DWIA 4ND8A 4KXLA 3VU3A 3D6NB 3NRJA 3U9LA 1WW2A 3TSAA 3V8PA 5BSFA 2VR1A 1JYFA 1E94E 4CM9D 4EPRA 1EKXA 1QHEA 2EV9A 3HKBA 4JX9A 1NIJA 2XUDA 1RXUA 3LECA 3SPXA 5A6SB 1JDUA 1RPNA 4HDSB 3V55A 4C3UA 5HWSA 4JVSB 5EVCA 2JI6A 4C7BA 4A36A 1NXVA 4I1RA 4O3MA 1N5OX 1PAUA 2JZCA 2OMEA 5ALGA 4M60A 2YICA 4JMPA 2JG3A 4LBVA 1G21E 3C14C 3QKTA 3FGNA 1Y8AA 5KKAA 5B4UA 4OL9A 3A8TA 2CLCX 2Q2WA 2WW8A 4PIPA 5ALWA 5B6IA 4XTCS 4RYLA 3FZNA 4NVRA 2XF2A 4TYQA 2OVBA 2QY9A 4CL2A 5T6MA 2VUTA 1MFZA 1Z74A 2C77A 4NBVA 3I9LA 1Z17A 2W2MA 3LCVB 2VJBA 3R3HA 2HADA 3AUSA 1GPH1 2YASA 1JDTA 1SUFA 5HHTA 4JNKA 5TE9A 3AUKA 1P72A 2D62A 2H17A 3D31A 2FN8A 3MELA 3N3AC 4EB0A 2O19A 1H0KA 1O97D 4JZKA 1SG6A 1WQ1R 3S28A 2A9QA 4V39A 5K51A 5LQCA 3TLXA 1SN7A 3A4MA 3HV2A 4D82A 1N36B 4B7XA 3O47A 4J3NA 3RTDA 1XCPA 1G3IA 5I7AA 4M87A 1EFRA 4RAOA 5IH3A 4LSGA 4R1TA 4BZQA 1KMMA 3KALA 5E4YA 3V2IA 2GS9A 1B1CA 2XMDA 3OE7D 3GWGA 3VH3A 4CR6A 1YU9A 2WI8A 3C41J 1KJJA 1EU1A 3IFSA 3AHIA 3WLSA 1V4VA 4RENA 4KHPB 1SG0A 5ED0A 3CGGA 1R15A 5I7VA 4KBYA 3V4ZA 3CUWA 2I4LA 4N5LA 4Z9XA 3JASA 2J7PA 2DTXA 4NOJA 4PWYA 1UAAA 3FFWA 1QH0A 5G40A 4TXHA 2G88A 4LKOA 4N7RA 3DFIA 1JW9B 1OC2A 4CR8A 2VHTA 4IJ6A 1XHLA 1HMPA 1YNOA 2N0SA 3PNKA 4ZYUA 3RADC 1FFBA 2BR3A 3TE7A 3CEMA 3GEBA 4OVKA 1QG6A 4HFMA 3T1OA 1J1ZA 4FZVA 1X9IA 2PBLA 2VXBA 3RRFA 3U7IA 4YASA 3VNBA 3ZX4A 1S1MA 1NAHA 2BBOA 2PPVA 5IUNC 5KOYA 3T35A 1KJ8A 3LPLA 4GAEA 3PRHA 3TRJA 1SVKA 2BYTA 4GLFA 4TZ6A 1J0DA 3MJDA 2WFMA 3OTGA 3T0IA 1VJGA 3E7PA 1CR2A 4CCYB 2ZCJA 4TZKA 1JG2A 5L3QA 3JR3A 5IVIA 3SBDA 1PU2A 4KV7A 2ZKLA 1SA0A 1B8NA 1E1YA 1R6VA 4DHEA 4US2R 3T06B 1ISGA 5HQTA 2ZIVB 3BD7A 4QYWA 4WBSA 1H1TA 2Y6VA 3F4LA 2Z2XA 2VH2A 3ETNA 4QLBA 5EE0A 5A4DA 5HUHA 3GFBA 1ZI6A 3QU9A 4WBNA 3JQBC 5BSGA 4RF4A 2B2CA 2Q07A 2YN4A 1J1UA 4QDJA 2JFZA 1Z16A 2JCXA 3EIEA 1PQUA 2P67A 3FZQA 4HPWA 1TC1A 2CYBA 2Q8QA 3CBQA 3GLVA 4D8UA 5BWBA 2H07A 2OQ2A 4GBMA 4WX2B 5HPYB 2JGEA 2F3RA 5HOQA 2AKEA 2WIFA 4MGZR 4Y2JA 1VKNA 2P1RA 1N8KA 1RABA 1SKAA 2YY6A 3FLMA 4H18A 4MMXB 4HWGA 2W2TA 3TIXB 1Q7GA 3DT9A 4YP7A 4HQRA 3QPDA 5KYKA 3QX8A 3CZMA 2R1TA 4XZ3A 3OO0A 5D6OA 4BMPB 1I36A 2VOEA 4NZPA 3GUUA 4RF3A 4J0DA 4LQ4A 3OPNA 4L5CA 4JYCA 2NZ2A 4OI1A 3QLUA 1NVMB 3FBTA 5BOVA 4LJ4A 4XR4A 5KTYA 4NOLA 3V00A 1IQUA 1CS4C 1T9AA 1M1ZA 3HB7A 3MILA 3MJRA 3MRXA 3EIQA 3LP5A 1OILA 1R9JA 1XQVA 1WY7A 4PLTA 2B35A 4BGVA 2CXRA 2ZANA 3LIPA 4FVTA 4RFVA 2WWHA 5EGNA 1T2AA 1VDZA 3PYXA 5DHTA 3SXUA 4BMYA 1E2JA 3HU2A 1A71A 3C1OA 3VNSA 2QL9A 4B0PA 3CF4G 5JXWA 2ZUCA 1KI4A 3NYIA 1I4TD 2JGMA 3UM9A 2C5EA 2HHCA 2ZR8A 3EGCA 4G5FA 4XWTA 4F8EA 2FFQA 4NATA 1TXGA 2P3LA 1KR5A 4GR9A 4WZAB 1YS4A 3KB1A 3PA6A 3FUXA 2C8JA 1L5LA 5KNCA 3MS7A 3QVLA 3DZ8A 3NP9A 3MPUA 1N9KA 621PA 1U8TA 3F8WA 4HRYA 4I9NA 1SCUA 2AG0A 3OZVA 1LCIA 3IDQA 2FTKE 5J2UB 3OJXA 3W3AH 1VM8A 3ENVA 2C2KA 3SIPA 3R5HA 5JISA 4PHCA 4J7CA 2Q5QA 3DE6X 5B64A 1E9FA 1T6NA 4EUFA 3EK2A 1C3EA 2HJGA 1MJNA 5TQ0B 3OT4A 4KMOA 3G17A 3O9ZA 3EH1A 1D5WA 4PZPA 3TW0A 4LVNA 4ER5A 1J97A 2GTPA 2LD4A 2OENG 2WF9A 3ROKA 2W11A 4ZHQA 5A03A 3H1FA 4OGFA 4XRRA 4EY6A 2A1IA 3L05A 1YB2A 5EQTA 3SF0A 2JJ2D 3LQYA 4BX3A 4JC4A 2GO1A 1Z6AA 3C7AA 4JNCA 1DARA 1GADO 1QRDA 1USUA 4AZ0B 2BFEB 4WZ6A 3MIZA 4FKZA 1ZMRA 1CZHA 2D0OB 2HLPA 2PRKA 4ZQHA 4R9VA 3QVGA 4CEJB 3HRIA 1Q0PA 4EL5A 2XD4A 3U7QB 1NE2A 2WOJA 3JWGA 4W9NC 3RVOA 2JIRA 2WA2A 2B2XA 5H1YA 1NY5A 3KAQA 2WK1A 4TTIA 3S81A 2LIPA 5C5CA 1JHXA 3L04A 4Q03A 3U0BA 3GAZA 1KMNA 3OY2A 1N7IA 2PGOA 4CF7A 4J4HA 4N6GA 3UHOA 4ZN6A 3OLZA 2GHTA 1N4DA 2Y0CA 3SC3A 1W34A 4A2QA 2IITA 3B1ZA 3K8ZA 1Q2XA 5T3UA 5H9WA 1YS1X 3PU6A 1R12A 3JQRA 4NYMQ 2PJRA 3ZE1B 3VTZA 4PLFA 3DGFC 2C3OA 1O54A 5K3FB 1KZ6A 4UTNA 3BREA 3AUYA 4P36A 2ZYDA 3H5IA 1S2DA 4PRYA 5KU7A 4Y0NA 3GCDA 2Z9BA 2X1HA 3F5SA 1QHYA 2ZKIA 2X2OA 4UHEA 1ZP6A 3UA4A 1U31A 1JL3A 1T5SA 2XGOA 2GEDA 4BLWA 4ZJPA 2O2XA 1BCRA 4X6LA 4FKMA 4Q82A 4PHHA 1T0HB 1F0NA 4BP1A 1JIVA 1T6YA 1KAMA 4OAOA 4Q3AA 1UJ4A 4TS3A 3VOSA 3ZXXA 4S0ZA 5FTLA 5JS8A 2ZB4A 1AKYA 4JBLA 1X1RA 1NN0A 1VGRA 1UQUA 1GPAA 2D2FA 1VMEA 4LGMA 1T4MA 1ZN2A 1NL3A 1M10A 2EG9A 2C8VA 2FSIA 3GROA 4HEHA 4U0JA 3ZE0B 2ZP1A 4O4HA 4EZBA 1I24A 5DPMA 4WQMA 2OCIA 4D3SA 1FYFA 4B71A 2WMDA 1X70A 4IP0A 4DAEA 4JHLA 4P81A 3IMCA 1SCBA 1ZCJA 3PI7A 3MW8A 4UCWA 3CPHA 5CNJA 3V5NA 3WLFA 3NT2A 4C22A 5ISMA 3G1UA 4KDFA 5ANRB 2Z6UA 4U7DA 1IXYA 4WGFA 1Z37A 5EN4A 3KYCB 1ZIYA 5AHXA 4CKEA 1A9OA 1SZDA 3DW1X 3SXPA 4GMGA 1U99A 1Z2NX 5JCOC 4RPHA 4HYTA 2V6MA 4LHXA 5A3QA 1BHJA 1MVOA 2CE2X 2HCJB 1Q1QA 2FMFA 2QAJA 2FEPA 3IPYA 4C0WA 4D9BA 3HTXA 4DLTA 2FR8C 3OHMA 4C6TA 4EABA 5JSZA 2PDAA 5EUBA 3T3GA 4CF3A 3NAZA 4EZEA 4DCSA 5LIRA 1ENPA 3GJRA 2J6HA 3K31A 4DGQA 3K6KA 1Z0ZA 4K9RA 5FULA 2DH5A 3KAJA 1P6QA 3CEJA 3I2IA 5MN5A 1QHXA 1PLKA 3ZCPA 1X2EA 5K3OA 4EHFA 3LCJA 5E6RA 2E85A 1VPDA 1IHYA 4JQSA 3RS9A 3LO8A 1C1DA 1DS6A 1P1KA 3EYAA 2PH5A 2CLFB 1XEWY 1UXHA 4NP6A 1Y1RA 2CNDA 1Z8HA 3CF2A 1DV2A 1P4GA 4D6XA 5LN1A 2YHIB 3UJAA 3PXXA 2HY7A 4MYRA 2X5OA 4P4LA 1QIIA 4YP5A 4ERXA 5BRJA 1CR4A 5GAJA 3WFZA 4G3XA 4OIMA 1YVPA 1OV6A 1ZDMA 3BKXA 5CJ2A 2NAFA 3H5NA 1XVUA 4MUAA 3TEMA 2I3GA 3RU9A 2YFYA 1VMDA 5DGDA 1K7FB 1WCIB 2B2NA 3QLTA 3SVTA 4FYWA 3MLEA 1C4WA 4ZARA 1D03A 1EINA 1GG8A 3C7CB 4S1OA 4N5DA 4YDQA 2GVZC 1W36C 2IODA 2BBSA 5GONA 2QV7A 1NUPA 3MTDA 3GL9A 3A1VA 2ZBUA 5L53A 1UC5B 3G0IA 4XWKA 3H9EO 9GPBA 1ZOOA 1Z33A 4JUFA 3D5TA 1IPHA 1BRTA 2AYYA 3PGA1 3ELYA 1YQDA 1OXVA 3NAGA 4PFQA 1MVNA 1PJQA 1YJQA 4RS3A 4E5NA 3RIYA 1XDDA 1ZH4A 2HHJA 4II2A 1FDVA 5JAQA 4D0NA 2Q5LA 4DY6A 3A36A 3A6HA 2J0UA 2I7DA 3HYLA 5AHWA 1EX9A 1I6KA 1OAOC 3D4BA 3GP8A 3VVLA 2F9MA 1V3TA 2HIHA 4H7EA 4PRKA 2YXDA 4AROA 4EPVA 3AGPA 1R0YA 2GN0A 1GEEA 4KFSA 1D9XA 4ZJUA 1NU6A 2IC5A 4Q9NA 4ZQCB 3K0EA 4RTNA 4KLCA 2DM6A 2VSYA 2OXTA 5SICE 2RGNC 1UK6A 1K08A 1YBVA 2IK8A 3A10A 4XQCA 5E6UA 2EW8A 3W3ZB 4DCPA 1PSDA 3BEOA 2VUUA 4W1SA 3CZ9A 1PHPA 2C9CA 3BRWA 2A74B 1DT3A 1FRNA 2QDKA 5FWXB 4OQPA 1WKCA 2ZTHA 1XTQA 3DFFA 1B0ZA 3A3KA 1C2TA 1RT9A 2W70A 3QLEA 3T1HB 1FYEA 2XBMA 1JR3D 1HPLA 2R8BA 4LJ6A 3U5ZB 1WG8A 1SIOA 4WA7A 3DVQX 3P5SA 5ILQA 1DIOB 4GQIA 2YQ5A 4GU5A 1YS9A 3C1AA 1HZJA 5CFPA 2I65A 3ZZ0A 1G8AA 4LJ9A 3HABA 1KY3A 4GYYA 1UAGA 2PA3A 2SECE 4HGPA 1GA6A 2NPFA 4F60A 4YFVA 3O0TA 3VR3A 5EIAA 1NQOA 5JPNB 3W5AA 3T1NA 1KIMA 4WASA 2EFDB 5EJIA 2XYHA 1LPPA 3K1JA 4QPCA 5AJTA 1OWPA 2L17A 2FEOA 3ORSA 3WGLA 5CB4A 1RHKA 4O5AA 4JD5A 4DCTA 1TCVA 4E88A 4R2MA 5K0NA 2Q9BA 5FOWA 1AXRA 1HDYA 4J0IA 3W04A 2KI5A 1M1YB 3Q41A 2ACKA 4YV7A 4MR7A 2DLDA 3ND9A 5E3JA 5BOSB 3X1YA 1N77A 1DE0A 2OE2A 2QTBA 3K4HA 4JN6B 1A96A 1CT9A 4YC7A 1V41E 1EWQA 1O77A 3U81A 1DSSG 1SCIA 1SPXA 3FAZA 1KEVA 4LYAA 2PRIA 3TECE 1NW6A 1J6UA 3A3YA 2YOFA 3ESYA 3GVHA 1M0WA 4EUKA 1ABBA 1U8FO 4PC1A 1P1FA 2AJCA 4TTSA 2XMQA 4LRUA 3EYWA 4G24A 4O4IF 3P2OA 4Z3KA 1D1QA 3BD8A 4TVSA 1PNVA 1TW3A 3PD0A 4DCJA 1AB5A 4PX3A 5E2IA 3R3WA 4GPIB 1SELA 2HBRA 3KQWA 6ABPA 1ILEA 1X7YA 3ETJA 4H6PA 1Y8QB 2H2IA 5A4KA 3HVKA 4Y0AA 4QOIA 3IQHX 2E87A 3L4SO 1KH1A 1UZAA 1QNFA 4WKOA 1O5OA 4UBNA 2EX1A 4FFOA 3ZU5A 4KRXA 2IXAA 1X1AA 1WCWA 5JJ5A 3D0KA 1AK2A 2BTEA 4P4TA 1MB9A 4C4PA 4ER3A 4W1QA 5ALOA 1PJCA 1ZC4A 3K8QA 3JD0A 4YAGA 5K0BA 4EI2A 2R6CA 3CH7A 4D3DA 4FMDF 1CCWA 4FFWA 4WL0A 3LWDA 4IINA 5JS7A 2H7YA 4JC0A 4DJEC 3IUEA 3FPSA 4WAUA 2Q6KA 4UMDA 2JIQA 3HWSA 4N3BA 4D26A 4E70A 1U9IA 3BRCA 4B4KA 5LOVA 1VLHA 4FX5A 5FNZA 3U7EB 3I23A 2GRJA 3IV6A 4ACAA 4BFLA 2IIVA 3W5VA 5AIBA 1THZA 3NVMB 1ZITA 4K88A 1WQ4A 1G21B 1SCAA 4MA4A 4NEGA 4F8YA 1CY0A 2ZSIA 3BF8A 4AXXA 1G5TA 2R6GA 1HE4A 5ADHA 3QTBA 2FQWA 2GN6A 1J2RA 4M88A 3MUFA 1JG6A 3LG2A 5CK4A 3A06A 3BA1A 1JHRA 3KXIA 1GUZA 4MUHA 2OR3A 1N1MA 3BCHA 3ZNNA 1MABB 4NBWA 4BP3A 2O8BA 4TL8A 5E8RA 1TKBA 1WB5A 1DP4A 5ICSA 2ZT8A 3GEIA 5BUSA 4TWJA 2BELA 1CDEA 1U8EA 3GQBA 2Q6TA 3PB3A 3SDBA 4PGHA 1JALA 3TD9A 1JEQA 2BJVA 2ZYSA 4NBRA 3AUTA 3B1VA 1EFKA 4YRDA 4ZVLA 1M2OA 5F9HA 2F1HA 3ORFA 2QM8A 3ESQA 4GM1A 4JI8B 1FVHA 5F1YA 2W98A 2VDOB 4YAFA 4CMKA 3G2NA 1ZU5A 3C97A 3ASYA 4W6ZA 3C15C 4U2KA 2QORA 2HIMA 4CLOB 1G1MA 1MOSA 2IYEA 3K2EA 4B6FA 2ZBVA 4MKGA 2C2OA 3O94A 5BO5A 3RH0A 1EP9A 5AVQA 1J22A 1FXWA 3IOBA 2Y1OA 4BB5A 2X4IA 2OBYA 5AJWA 5JQGF 1Y3IA 2VS1A 3A1SA 3W6ZA 4MWTA 1XTZA 2GEBA 4UXHA 4QGFA 3GRPA 4QT0A 5J23A 3GXOA 1STOA 1Y3DE 4HWOA 3SDZA 1UFVA 3T4XA 3O92A 3H97A 3TK1A 4UFNA 1M2KA 4QODA 3JZIA 5HA5A 3IHWA 1CLUA 2XA2A 4WXRA 4F5EA 3NWPA 3R3YA 5EJ6A 3RABA 5J4LA 1PUIA 1LTHR 2B25A 3D6AA 4JASB 1LLFA 2PE5A 5ITWA 1RJEA 1UOQA 1KQOA 3Q87B 2B4AA 1EX6A 2P4HX 4R7TA 3FOEC 1I9GA 2JIZA 4Q3LA 3T52A 4DKXA 2UXDB 3G88A 1TUEA 2B30A 1ZK0A 4HH4A 3T7AA 4F06A 4HTAA 1NI3A 5DK4A 3T7DA 4DIMA 5CLIA 1U65A 2YTZA 2IUUA 4R1UA 3S3TA 1RHUA 1M76A 1SHUX 3F6CA 4R83A 1Y3FE 3NHLA 1P18A 1UBGA 1XRLA 4EX7A 4MQFA 3IKLA 5F23A 3CNBA 5T67A 5LD2B 1U2DC 1PK9A 5SY6A 2DPMA 3KHUA 1GWNA 4U7TB 4DLPA 4GZMA 3DONA 2C97A 2WMNB 4B46A 3JQAA 3IBTA 3S27A 1E2KA 3HH8A 4TSFD 1D5CA 3WSWA 3AVWA 3I73A 1L4EA 4I5GA 5A71A 1GNTA 2X0RA 4X85A 2AX3A 2ICEB 4S1VA 1G3QA 4QTUB 4BN4A 2WYVA 3ZBUA 1C8BA 2O3UA 2W37A 4Q19A 3AV0B 2ZI3A 2IU3A 1DDIA 2JATA 4BBPA 2CT8A 3KQTA 3OM1A 2V7GA 5C8ZA 4PZLA 4D9JA 3RYHA 3L0YA 2BD0A 2CSUA 2NVWA 2CNWD 1HNZB 3D4LA 3EMVA 3HXLA 1Q1NA 2ACWA 3RIGA 1ID1A 2JLSA 5E9AA 3PQ3A 2G36A 4JJFA 3RT9A 2NT4A 1K4KA 4BC0A 1KZGB 5I6DA 3J81A 4RDCA 1E96A 2UZAA 3O8RA 3P9YA 5F9MA 3U26A 1XXLA 4O2BB 1AXEA 2MINB 1QPGA 3WWOA 2C7BA 2H4HA 3HKDB 1H22A 1GSHA 1F20A 1TZMA 2PCJA 1M34B 1NF9A 4TT8A 4R71A 1P81A 3IEMA 3PUJA 3THYA 1FNDA 3H0KA 3TLJA 1W75A 2FMUA 3RFXA 4RVOA 4KREA 4KB5A 1GU1A 3WLKX 2Q3DA 4ARUA 1JHAA 1MO2A 1X14A 2QNIA 4B87A 5ICEA 4FYKA 2Q41A 4FCWA 1J23A 3DMRA 4MUKA 2GCEA 3OPVA 4PYKA 1PJZA 4TKLA 3V34A 4CLHA 3IDOA 2ZRAA 1P5FA 1V25A 1XN1A 4RLSA 3L18A 1CC1S 2K6GA 3HE3A 3ORHA 1OPXA 1NLMA 3KT3A 4IOMA 4C5CA 1XJ0A 4E2FA 4DDVA 5AUPB 5LMUB 1AY0A 4EB8A 3RU2A 3NONA 1QM5A 2ZDQA 5EFOA 3EEBA 4A0RA 1OV4A 2O1SA 3G9ZA 4QZVA 3ZQKA 1KTVA 1EGMB 3ZHXA 1Z36A 4H08A 3GNQA 5DP1A 1UEIA 5KQGA 4RKFA 1NRJB 3ZY3A 4RTKA 2AOUB 2RIRA 3BTUA 4DW8A 3K6SA 5K2OA 3LTNC 1BRMA 1BN7A 2AXPA 2BBTA 2VQ3A 3QPUA 2NV6A 4ARZA 4IV5A 3DH0A 3X1WA 3U09A 4B3RB 4DRXB 3FFBA 4X64B 3PQ8A 1U4NA 3EQ9A 2KQUA 4FZ5A 3O8QA 5CFRA 3QFFA 2IXEA 4HX2A 4UXIA 4GRDA 4C7OB 5G0VA 2AJDA 4AY4A 4DUZB 4RACA 2APJA 5FPHA 3I53A 3VKGA 1N7HA 3HJFA 4OHBA 1WU8A 1Q19A 2E1PA 2HIGA 1EM8B 2J6CA 4K26A 4LCBA 4OXIA 4U7FA 4CT0A 3GX1A 3U40A 3ZGNA 3KZMA 4FYPA 1Q6ZA 4HSEA 4D4LA 4M7WA 3RPEA 2HU8A 4NNJA 1RQPA 1Y7HA 1ZO8A 2JK1A 1DXHA 4BASA 1IU9A 3I1FA 1PL7A 3K0SA 4LBYA 1N3BA 1JEEA 3DDWA 4Y2SA 2G9NA 1YRQA 3H8VA 4NDAA 3EMDA 1EX1A 1U9YA 1E89A 4JLWA 1I2CA 1BC5A 2AMLA 2PS0A 1M2FA 3P0RA 4HAOA 4DCCA 3SIXA 3AEQB 4QPDA 3RC2A 3JD2A 6AT1A 4B3IA 5E6SB 3RD5A 3LUGA 1U6JA 4YGYA 2AJTA 3GFFA 4B34A 4F3RA 2F55A 1JFFB 3G2PA 4ZEWA 4WLNA 1ODJA 1NN3A 1W4AA 4YJ3F 1J4AA 2A86A 4IIBA 2WLSA 3ZKAA 5JJCA 2NZYA 4NK4A 5BNIA 3T4AB 4RZ3A 2AMVA 4OOEA 1WUTA 3MMSA 4P7GA 5EKDA 4ZMSA 5AW8A 5CXQA 1PIWA 4RD6A 2XAUA 4DIOA 3BB3A 2GBCA 3FRPG 4UTXA 4D5EA 1SXGA 5JZBA 2WIKA 1B0AA 1HYBA 3HQ4O 3NJRA 2ECKA 3PX2A 3QBJA 2CXPA 2HPHA 4IJWA 4LBZA 4A8JA 2DB3A 4RKQA 2ZSKA 4LWZA 4RZQA 3HA7A 3NG1A 2XCTB 2IHTA 2BCJQ 3WB2A 3FDXA 1E3WB 1WVGA 2CNLA 2R7KA 1DAEA 1J9EA 3GCZA 2VHEA 4HJRA 5CDUA 4L4ZA 1PCXA 1PUXA 4P4SB 5C32A 2ZEJA 1JDPA 1NJ6A 3Q0EA 4PVCA 4WK4B 4PPQA 4QL3A 2JC3A 4J29A 5JXHA 1IEXA 3NIDB 4JQZA 1E2IA 1XTTA 2L18A 3ML1A 1D2AA 4MQEA 3Q7EA 5CEEA 2HEGA 1EIWA 3SBOA 3E8MA 3TJMA 1LV7A 1PQWA 4I08A 3V8EA 1S8FA 4FHCA 2WM2A 1NJ5A 3GRUA 4XXHA 4JJAA 1SKMA 3H5VA 4P93A 5K09A 3PC7A 1KVTA 5CHYA 2GK6A 4AG6A 2JJ8A 4DUGA 5GZ1A 1EG7A 5KYYB 4H1HA 5F5NA 2PMKA 1M72A 4HD8A 3R3XA 2A78A 3A6EA 3WKEA 1XTRA 3F73A 2JCVA 1I3LA 3GUZA 4EKYA 5EWLB 1JB9A 4Y2HA 1TD1A 1CTQA 1KJWA 4IRMA 5FOSA 5LQUA 5LL6P 2XZLA 2CZCA 1IWBB 2B20A 4FOLA 4R1LA 3RUCA 2VYVA 4E1BA 4GLLA 4YJGA 4HXFB 1E3MA 3L4BC 3TIFA 2QT1A 1I3NA 1B2RA 4CF6A 3P2KA 3ROPA 2O07A 1W1WA 2FI1A 3MN1A 2ZSJA 3QP9A 4V24A 1QHFA 1Q7CA 3A2NA 3P0FA 4G6ZA 1KK0A 3LO5A 4IQ0A 5EESA 1IVSA 2G83A 2PBFA 4QXAA 3ICWA 4IQ4A 4HDMA 3N58A 3VHQA 5JSQA 2UZ1B 4B17A 4TL9A 1ZC3A 3IXLA 3L8EA 1VI2A 3Q0TA 4DDMA 1X7GA 3L7OA 2WUGA 3AJAA 2XQJA 4Q66C 1FFHA 4TWAA 4J0HA 3T5TA 5LLDA 2WJ4A 1UMCB 5LZ2A 2ZYHA 4XR9A 1UC8A 4BAUA 4R40A 1N5RA 2MU1A 3GD5A 3O83A 1H65A 1K3FA 1DU4A 2DPXA 1G60A 2LUOA 2ZROA 4OQZA 5DN6D 1ECFA 5KKNB 4HGYA 1BVHA 2ZYAA 4IWXA 3ROQA 3R7WA 3TLEA 1HFWA 1LPSA 3FTCA 3KP1A 3PX3A 4MKZA 4WE3A 1PJBA 3SI7A 1PDVA 1QRRA 4QRIA 1W581 4UUPA 2VVTA 3U7FB 3W5CA 2BEVA 3DP7A 4I5IA 4WZZA 2Q6IA 1NW3A 5IHXA 4OO3A 1X13A 4WCFB 3O82A 1ZZGA 1WKVA 1WJGA 3CG0A 5TQVA 3VDMA 1D09A 3IHKA 3NQ41 3C5WP 3PCRB 2VF8A 4X84A 5KZMB 4HTFA 2WHEA 3TIGA 1ZINA 4CIDA 1T1JA 3JQFC 3GGDA 3VHLB 5KSYA 5ADVA 1NXTA 2XBUA 4CMGA 4E2WA 1NNUA 2ORVA 1Z47A 4HDNA 5ALTA 4D8YA 3AHCA 3W3AA 1TIPA 3GEPA 1I1HA 2CWWA 4MW2A 3FHTA 2JF0A 4JEIA 3VH4A 3GK3A 4JBGA 3OLQA 1Z4PX 3QMVA 5TC4A 2Y67A 5B5SA 1L7QA 2XVZA 3PC2A 5A0FA 4AM8A 3PHHA 1EFCA 4HN4B 1JYSA 4FXGB 1DPFA 1ECJA 3QLVA 3Q1LA 1UUFA 1QE0A 2DKFA 4JB3A 4CTOA 5L6LB 1OYYA 1M2HA 1Z4KA 2VL7A 1AQYA 2IY9A 2V9ZA 4LCEA 4FONA 1MLDA 1TRKA 3H1TA 4OMUA 2RGAA 1QGYA 4XM2A 2E4ZA 1EFPB 5CX1A 4EHAA 2ZWMA 1A8PA 3FHLA 1AUVA 3L06A 3OZXA 3UFXA 2OD7A 1KI6B 4O4LB 1GUYA 1R9MA 3JD4A 1I1OA 3K8YA 4J7XA 4KDRA 1EK5A 2HRRA 4MZXA 2ID7A 1VPLA 3UKJA 4BP9A 1CUJA 1VCIA 3UHPA 1WO8A 1L1EA 2WWGA 1L5OA 4TS4A 5CT4A 2WG1A 1A1SA 2ATCA 3GRZA 1FP4A 4URHA 2D2VA 3NS7A 3F6PA 3OJOA 4MX8A 1GKKA 3WV4A 4D4KA 5JFOA 1TCAA 4PEVA 5JXGA 5JHHB 3TLMA 1E2EA 1P9OA 4G4JA 1KRXA 1O95C 1DO8A 1JLKA 1JQAA 2I2AA 3MT8A 5DNWA 4MV4A 4BJ5A 1CNEA 4PLGA 2O7NA 3LF1A 1QP0A 3G3EA 2EQ5A 4B45A 3F46A 1NX9A 4Y2PA 1F4VA 1R4MB 1KKUA 4WOBA 1DJNA 1OUMA 3K2IA 3N7UA 3OQJA 1D0SA 3G8DA 3IMFA 2HBQA 3COZA 1X0VA 1RLMA 2ICAA 3KR9A 1WXFA 5DOZA 2GFQA 2NOAA 3KR0A 3ST7A 3VPCA 1VRVA 3IEKA 3OU7A 4CHGA 4ZCIA 4H60A 1ZG3A 3KEGA 1CQXA 2JW5A 5BVGB 2CXQA 1HZZA 4KGXA 1IYZA 2IYUA 4DC0A 1K8XB 3VISA 5F1PA 2IA5A 4M8KA 4RCVA 4A91A 2JL1A 5ITZB 1ONNA 1Z63A 1ID8A 3QEKA 2I34A 1FX1A 4Q4LA 3RVLA 2UYOA 2QVXX 1ZK2A 4X1IB 5DTMA 2EDAA 1HK7A 4EUEA 1Q12A 4CLDA 2HK7A 1NW4A 1YZFA 2QG4A 1TTQB 3H9BA 4HP8A 2QZPA 4WI1A 4WXYB 1UQRA 2PUAA 2VZ8A 1C4OA 3D8NA 4ZMRA 4E94A 4FDMA 5A4FS 2FJ0A 4PYNA 3ZZUA 3UZUA 4M9SA 1OF1A 4KH1A 1CD5A 1USWA 5KYUA 3N0TA 2QQEA 2EJBA 5EWJB 2ZVDA 2Q7DA 1QMGA 3KKPA 4QA9A 4AN1A 1LRJA 3OPYI 1GZVA 1ZJZA 1W25A 5EHQA 3UPUA 1QH1A 1HE8B 2RC6A 2EL7A 4QJ4A 3Q7IA 1CQWA 5AM2A 3WRYA 3ZHSA 3KOXA 4KACA 3QIAA 3WL5A 1JTVA 2OCPA 2OZLA 1N5MA 2Q29A 2JFYA 1N2XA 2VT3A 3K6JA 1PD1A 1T5LA 5AIAA 1DRJA 2E21A 4YRQA 1YO6A 5AOAA 2MHGA 3EDYA 3UHJA 2PYIA 1ZIPA 4QOSA 2ZBPA 3L4KA 3MMNA 3NU1A 1KIFA 2IBSA 1QGOA 2C07A 2QUJA 1PHRA 2QW1A 3NV7A 2B5VA 1N2SA 2VF5X 4LGYA 2JIDA 2WUFA 2C5AA 2YMQA 3G49A 3OH8A 4J91A 4IQ8A 4KO2S 1WOYA 2C5GA 3IEPA 4DCUA 4HWPA 1PK8A 1XDBA 3WL4A 4YMVA 2G1PA 1NULA 2UU9B 2NWQA 2IH5A 3DMFA 2RAUA 3CZAA 3K05A 3MFYA 4DF3A 4XAQA 1U7XA 3G9QA 3LF2A 4RSGA 4RV4A 3F78A 5IAGA 1DC3A 3WLHA 2DR0A 3TW8B 1QX3A 1DIHA 3MYRA 3V4FA 1PFQA 1FNSA 3DL4A 3ZGVA 5EG5A 2D8MA 4KP7A 4AL4A 4C14A 4N48A 2DY0A 2XSZA 1Z26A 1JAXA 2I9PA 1QAMA 2D1SA 4TV9B 3VR0A 4YPFA 4HPXB 2V98A 2NUPA 3OZEA 4LY9A 1A4IA 1DBRA 3FFXA 2J9ZB 3ZLVA 1R4ZA 4UDYX 1HH4A 4WLUA 5FP0A 3ZIUA 2B82A 4O02B 4B35A 4KC0A 4RHYA 4LMPA 1O4WA 1PV4A 2CZQA 4M1ZA 4A10A 1YRLA 3T5DA 4IGFA 3LKDA 2AZTA 3HXKA 1D7OA 1BN6A 2WJVA 5DJ5A 3NT4A 3IULA 5K3CA 3N0VA 5TNXA 2M1XA 2V58A 2A5FA 3OD1A 1IG0A 1YOVA 5AOBA 3TB4A 4JJZA 1RMYA 3AQ4A 4QOEA 4IIUA 1SCNE 4KIGA 2EKLA 1JVBA 2P40A 3HCDA 4M4SA 4RY0A 3VSDA 4DNQA 2YVKA 2BWJA 3L79A 1G5QA 2FOLA 3DR3A 4X3CA 3U3XA 3V8MA 5MGNA 3HM9A 4QBHA 5JDIC 2IYSA 3RFCA 1BMDA 1T1SA 5EE3A 1E58A 5LUAA 2AMJA 3Q10A 2YYZA 1X19A 1XEXA 4OQ4A 1NOIA 3TNJA 2NP6A 5E9QA 1K6EA 4RGQA 1JDZA 4BEBA 2OZVA 3Q3IA 1XNHA 3FCXA 4M8LA 3RC3A 1PJSA 3B2QA 1RVDA 2JFOA 3H3JA 1O7JA 4FFSA 2I80A 1C30B 4WHMA 2P65A 5G41A 3A4YA 2Q1TA 2IIBA 2XWQA 5M3BA 5KEIA 4X3PA 5DO9A 2R60A 1E0SA 4TVOA 5HBGA 1LSJA 2IYXA 2X7JA 4EB3A 3IKTA 1BWPA 3QK7A 4LRSB 1EMDA 1SZCA 3FYUB 1GSAA 2F3TA 4ZO8A 2VP6A 4KE7A 1VCMA 2XWPA 3HBFA 4KSYA 1X92A 2C4KA 1GTJ1 1PTJA 3M89A 5CT9A 1XEWX 1FDUA 2C94A 2XTNA 4R16A 5IDQA 2E89A 3G0CA 3MB5A 3DVAB 4BTLA 3ZVMA 2ZWIA 1MRNA 1XAGA 5F7JA 4QG3A 4M8IA 3R40A 1RRFA 1E4YA 2XMCA 4MP3A 4MV3A 1RYMA 2AF4C 5FI0B 4M36A 2HQSA 1JHDA 4FYHA 4XDGA 2NO9A 2P6RA 4OQFA 4CTMA 3F9CA 3NR2A 3UJNA 1ECBA 4CKBA 1I7QB 3R5TA 5EMHA 2HXYA 2ECPA 3SHFA 4BO8A 1BA2A 5EQDA 2CJPA 2A0KA 3INYA 2WM8A 3B1KA 3QE3A 2GRAA 3PEVA 1RHRA 3HBAA 3B2EA 4OJNA 1SOUA 4H77A 4NYJR 4P33A 3ZKWB 1T3TA 3V4VB 2PRJA 5KYWA 4HQLA 3S8YA 1K7CA 2GM5A 4BE9A 2Q2NA 3B8EA 4KN6A 1K9VF 5JU6A 4OHFA 1K4MA 1GZ5A 1LA2A 2B7BA 1ODCA 1F3OA 3V1UA 4DOMA 2BFCB 1FSPA 3F7NA 1AD2A 1W9HA 3REGA 3U39A 3SBEA 5CHEA 1V7CA 2W2KB 1X0XA 3WLMA 4G85A 2P5TB 3CZ4A 1F38A 1M7BA 1VCOA 1IEVA 2I8CA 1P19A 1SH7A 1Y5RA 3MZ0A 2PBZA 4PX2A 5DGHA 2O8DA 2HA4A 1J0BA 2BCEA 2D3TA 2WVGA 3D54D 3OTOB 1JR2A 4ZEMA 3LLMA 6PFKA 3L6OO 1UIRA 2PH3A 5TGZA 3HDVA 3C3MA 3BPSA 3IHTA 3AOGA 4LF7B 4WUVA 2WOOA 2VK1A 3PG5A 2XHEA 1S5PA 2PSDA 3BH7A 1BGVA 3E3OA 4OFZA 2B4TO 3FPGA 4OQLA 4RIEA 3LHDA 5CNKA 1GTZA 3FUVA 3I2FA 4LOLA 5CIYA 4BUJA 3GFOA 5AJXA 1ZSVA 3AW9A 3KTAB 1RAIA 4LOAA 3VNVA 4TVKA 2ANCA 1CS0A 3MEQA 3QSYA 2VAMA 1GNLA 2P41A 2WVAA 1Y4DE 1KDZA 1HO3A 3EC7A 3QV1A 1K7XB 4YCJA 1M3SA 2VEDA 2PCLA 4MWSA 3SCZA 4G8BA 1QVVA 1EGAA 1K75A 1RBZA 5EYPB 2GI4A 3Q7PA 2C4NA 3EA0A 4V0ME 1NPYA 3D9QX 1M0SA 4GGOA 3W79A 2PUBA 2QI9F 1TK2A 5FNVF 1N32B 4WK2B 3ZGXA 2H5LA 4OM8A 4QBGB 7AT1A 2KLBA 1KZ4A 3TG2A 5AXAA 4J1TC 4B44A 5DK6A 5TRTA 4DTCA 1VL5A 2EZ4A 5IXJA 4P1ZA 1WQ3A 3UMGA 3Q7TA 4MPPA 5DX0A 2Q49A 4DY4A 1EXMA 3ED5A 3ZV3A 4GI3A 4MQMA 5DYYA 1OASA 2DWCA 3IYLW 2FE4A 3CVOA 2BW0A 2XXBA 1YFLA 2PZJA 4D56A 3FR8A 2C7RA 1XZKA 1E1MA 2QTNA 5EIWA 5HKKD 4P84A 1T2VA 4FXOA 1GAWA 2AUTA 2BHNA 4NMXB 4YCBA 4A16A 3Q3CA 3EZYA 4QU0A 4AP9A 2PN1A 1KFCB 3D8RA 3LXRA 1B42A 2YC2C 4YMWA 1W7AA 2NVUB 1U8ZA 4UNIA 3NHZA 3HXOA 1G5PA 3GUCA 4JA2A 5FB3A 2XUHA 2WJPA 4JLMA 2A9JA 2QZZA 4FNMA 3BF7A 3K09A 4OB6A 3T3OA 1HSOA 2TSYB 1XN4A 1JV3A 2R97A 4H7PA 1QYRA 2C9OA 2VUSA 2G80A 2ZIWB 1VPWA 8MHTA 3H0EA 4JDUA 1E2HA 3GR6A 4F7WA 1W44A 5GJBA 2NSYA 2J46A 1OX6A 1CB0A 3AC0A 3LZDA 2TMKA 1FMFA 5ED4A 3SYMA 3OIVA 5KX5B 2PX0A 1P7PA 4AT1A 1RYEA 4ZODA 2FHPA 1C3OB 3L92A 4M38A 5BRNA 2FX5A 2WWIA 4DDTA 1TT7A 2R7NA 3WMWA 2GCOB 2QMYA 3RSZA 2ANBA 4Z8XA 3UWDA 1G7SA 1OU0A 1YMUA 3KSMA 1RLTA 2DPGA 4B3GA 1Z7WA 3KQKA 1OU4A 3EDCA 3DNFA 3GJQA 5DI9A 3D8HA 3W06A 1C9NA 1YCFA 1C9JA 3SSNA 3EJ6A 1NNI1 1UKYA 1GL9B 4MAMA 4KYTA 3H04A 3LBIA 4OSEA 5JNTA 1N1DA 2VYND 4EYKA 4CMBA 4G4GA 4UXJA 1MAWA 1TEXA 2JI9A 3A14A 4S35A 3TFQA 1XL1A 3HDHA 2QG9A 4EJSB 5DM60 5TY0A 1R00A 3H2JA 4MI3A 1QBKC 4GKVA 3TTSA 2ZVQX 4EJ0A 5K6TA 3FKJA 4IQFA 4LUCA 1IB6A 1WKBA 4C78A 1B8OA 1JPNA 1V11B 4PZDA 3MTQA 2E9SA 3IEUA 5CP8A 2V6IA 4JKOA 1MNAA 2PZGA 2O8EB 2R7AA 4QDXA 1GN9A 1VHJA 3HR8A 3ZCQA 1L7EA 2CDAA 3R0QA 5J40A 3RLIA 5DRYA 3TSOA 2CD9A 1T10A 1LX7A 2AOTB 3GLQA 3WS7A 2J9YB 2R5WA 1YS7A 4MUNA 2EYQA 3E9DA 4M8NE 3QUSA 4DWVA 4C5BA 3M6XA 2JLYA 3WK7A 2AFRA 2BZ0A 1NVXQ 3ROFA 4X20B 3ZHQA 4RTJA 4KXXA 4DMCA 1YS2X 3CR8A 2HSZA 5BNZA 3IQWA 4NLLA 4V3CA 4QSHA 4KKVA 2XOKA 2H85A 3M5CA 4DSZA 2C95A 1KJYA 2N1BA 1N2GA 4WDRA 2DGDA 3VPDA 4YPOA 1DT5A 5EE5B 4RY2A 4D99A 2OY0A 3ZGOA 4DZTA 5LQNA 5BSHA 1HDRA 2VNSA 1YZTA 2ZE5A 3T4UA 5LDHA 4XWWA 1P45A 3H8WA 5KJ1A 3KQUA 4FFVA 2JLBA 2ZJ7A 4HZUA 3O4RA 4K8OA 3TQTA 4B84A 4IMPA 1Z08A 2GZMA 2WNIA 3OQNA 3OIGA 4GICA 5KNDH 4YRBA 2MSLA 5JFTA 1HSZA 1ZXBA 2X22A 4N12A 3FPFA 3EZ7A 5DNVA 3CPJB 3WRXC 4DE5A 1JEYB 3R5KA 3CRMA 4NE2A 3CUYA 5B4VA 3FBGA 3DQZA 1C4XA 2BJHA 1ZUNA 1OQAA 2XQIA 4CMIB 4JCCA 2C7VA 3DTNA 1DADA 2P3OA 1GOTA 4PPFA 3ZCVA 1D4FA 3EGXA 4DR6B 4U02A 2EJTA 1JAZA 1V7QA 3WGQA 3DMHA 4N0PA 1BFKA 4P22A 1H6BA 5DYNA 3EXIB 1Z2CA 2NZXA 3FMPB 4IZ6A 1RIFA 4NFHA 4RTRA 2R5NA 1LBSA 4GOXA 1F0KA 2A9RA 2X9VA 1U3DA 3PNQA 1C3XA 1I2MA 1P5JA 1PQPA 3H87A 3PPWA 4JEUA 4NZ9A 3RFFA 2JGRA 3RO7A 4HVCA 5CD9A 4ZTUB 2VH5R 1BJRE 1XZHA 4OU5A 1XMPA 2G0AA 2PLAA 1E7YA 3EC2A 3HO6A 1X8KA 1JMYA 3EVTA 5A1TA 4FTWA 3GBPA 4QO8A 4ENUA 1YDHA 4QELA 5TVKA 3EVZA 5HR5A 5CXSA 2UAGA 3MCTA 4NECA 4RZUA 2PMEA 3AKCA 5HYVA 5JNLA 1U0GA 1VMKA 5E4FA 3WKAA 4NMHA 4BEWA 4GOKA 3LDFA 4V03A 4NDZA 2AGVA 3RYIA 1ZW1A 1MX3A 1SOVA 5ERXA 2BT4A 3IPCA 3AYXB 3LDGA 4X93A 1NJ8A 2F9LA 2VDNB 4U2EA 4Y2RA 4FQ7A 1UDCA 2AVNA 2D1YA 2JLRA 2Z6VA 2R4TA 2JRLA 3NEYA 4PC3A 5CM2Z 5DT2A 5LYYA 4FYIA 2O0JA 3CVXA 4CMEC 3S5JA 1JKJA 4QYIA 4YRAA 3TVDA 1N6IA 4GXRA 4RA6A 2QUIA 4MDEA 5FUQA 2C2ZA 2UYYA 3E2MA 4A6PA 2EJVA 2NZVG 3N2IA 4HYQA 4MCHA 1Y63A 3JQGB 3FIJA 1B6TA 4REMA 1MO3A 2X3UA 3CCFA 4W9NA 2ZQZA 5BSTA 3PK0A 3SX2A 2B7CA 3PF8A 3V1LA 1SUSA 2J33A 2VT7A 2FOXA 5FLEX 2G06A 4B4OA 1KEPA 1NMZA 4II7A 2II6A 3NVDA 3MWFA 4G65A 4CNBA 4CRWB 2ZT5A 3QU5A 4BZXA 1AKQA 2QE7D 3TPZA 1AT1A 3FD8A 3LM8A 1TRHA 5F5XA 1H6DA 3IBCA 3AUUA 4C76A 2IHJA 1ZSYA 1W6RA 4I6GA 5J2TF 2VXOA 3TMKA 2CV0A 1QGED 1T6ZA 3GD7A 3WGTA 1G6KA 2LXNA 3CVUA 4XQ0A 4DA0A 1K86A 4EMBA 5ES3A 2XF8A 3OQVA 1Y6GA 1H8ED 5HS4A 2MYPA 2ZM6B 1HA3A 3FX2A 5M34A 5EVJA 5LCXA 1WXWA 1JQ5A 3OJCA 1AXGA 3PKZA 1LXCA 3QQ5A 5A5EA 4MQ5A 1QIFA 2OORC 3OF3A 4FD2A 4HV4A 2UUPA 4BV2A 1UM8A 1ZL0A 2G9UA 2D2EA 1DRVA 1XU7A 3BXPA 2W6QA 4RPGA 5I9TA 4O0LA 1Z7BA 3L0BA 3ZHBA 5T4HA 2O2IA 1YR6A 4OYLA 3ZGZA 2QAGC 3H7AA 2B4RO 1EBBA 3UJ9A 1N8SA 1EYZA 2G1JA 4KNWA 4DIFA 5BR4A 1F8XA 1NW7A 4WJKB 2D2XA 3NHBA 3TXAA 5TQJA 3MGCA 4CCWA 2H11A 2QTVA 3UAXA 3O8OB 1ZNYA 4UBJA 1CP2A 2AXEA 2Z3VA 3FZYA 2VJLA 2QTTA 4IFIA 5AK3A 1SUAA 5DP2A 5FUBA 2BR5A 1PQYA 3LT5A 3PJFA 1W29A 1E66A 2XTZA 1HLPA 3P5BA 3PFKA 5DCWA 5JCOA 4P83A 3ZIDA 1EGHA 1DKUA 4CE6A 3FDJA 1L4YA 1Y3CE 3OIFA 4DPLA 2Q1SA 4GP9A 1BYUA 4MUXA 1SIUA 2HH9A 2Z04A 4REOA 2CVFA 4N5HX 4V0RA 2Y1EA 4HCJA 2M6KA 4X62B 2NXCA 2EBWA 2P4EA 2Y99A 2PIDA 1JG1A 1KO5A 2XWJI 4IG9A 3H8SA 4RMJA 4XSVA 1Z0JA 4JJEA 1IM8A 1AMUA 2IX3A 4I50B 3UGJA 1N2IA 5B58T 1FFEA 4G5XA 4KAJA 2VQFB 2WB2A 2QZ4A 3A1TA 2GN2A 3BIWA 1CP3A 3WB1A 2BLNA 1Y9DA 3O4GA 1WS6A 4HQKA 4TX1A 5DHUA 2IZ5A 3EXEA 1QMPA 5CRIA 5KWJA 3BB1A 4MKXA 3ZWPA 3A6ZA 5FX2A 5AKJA 4ND5A 4UCFA 3IAAA 1Q3KA 1CYEA 1SM4A 1L0BA 2FPWA 3GLTA 4TL7A 4RNDB 2B37A 2XXJA 5IN4A 1KWGA 1JFTA 3ZDCA 2R4UA 3D2AA 2HTEA 3ELWA 2FR0A 1XAIA 3OBIA 3FSRA 4WY5A 3VHXB 3ES9A 4X7MA 2WTUA 3PEYA 2H18A 2RJ3A 1N6NA 2Q8PA 2SKDA 3TQQA 4FINA 1H0SA 3C3YA 3O31A 1E3EA 4DM3A 3HHPA 2VRNA 4LRTB 4YDSA 3EZFA 3I6MA 3S7ZA 3VSAA 5A4JA 5JYEA 5DXAA 2WU3A 1TJ3A 4IUBS 3FLEA 2Y1XA 2JI8A 3KCQA 2PANA 3PNYA 3TR6A 5BSWA 3SQDA 1R8SA 2OQIA 3E9MA 3K9WA 3LFUA 3Q8XB 5FUYA 1AK9A 3TLBA 1Y3BE 2FWBA 2QI9C 1IOWA 1TQ8A 3UWPA 3U3JA 1KHHA 4YY3B 1YVRA 3IUQA 3GIDA 2VI5A 4E7OA 4HUTA 3AERA 1TK3A 3NT5A 2X6QA 2QIOA 2G6BA 3JARA 4XGQA 1DZ3A 1I32A 5ENDA 2JFPA 2RGDA 3VOTA 1NW5A 1Y1PA 1AS3A 4Y1RB 1T0BA 1U7ZA 3LYHA 4N1AA 1DEKA 3BXHA 1G291 1PNQA 4IHJB 2PGLA 1O2DA 4RU1A 2I9KA 2VJMB 3TQOA 1VE6A 1VHTA 2GBIA 2FZWA 3FOFC 1KYVA 1Z2PX 1SUPA 3HEBA 3PZRA 5J2TA 1JIXA 5DF1A 4LF5B 5ITSA 1GAQA 5CT6A 5J9FA 3NMUF 3GUVA 4Z7QB 3KSRA 3ETCA 2HWKA 3W6NA 2GD6A 4JK3A 1GPUA 2PZEA 2RGNA 4BGDA 5C51B 3QXHA 2F1KA 5JAZA 3WL3A 3WWPA 3HGMA 4D94A 3L84A 4D9CA 3R9WA 2ILTA 3D3WA 3TZLA 2HAEA 1YZNA 5DISB 1CLEA 1QB8A 2GEFA 3BCUA 3CPSA 1JXAA 3F1KA 4OQDA 4K9PA 2JGFA 3E5HA 4QHSA 4ZI7F 5EIFA 5BYBA 1A82A 1WDMA 4Y1EA 1R88A 1IQPA 5H9VA 1UPCA 3UW1A 1NA5A 1H6AA 3MLAA 1JU4A 4XFKA 2P5SA 3WWYA 1IDOA 3LUAA 5I9NA 4L3WA 5BPHA 1M8PA 1ZESA 5A62A 2DR3A 3HLTA 4PC6A 1PW5A 4HXEB 2Y9PB 4G97A 1ATZA 4JP2A 1SBYA 4EG6A 1BD4A 1H2WA 2D7CA 3DNMA 3LRTA 4X9XA 3QXCA 3CLTD 3P2JA 1LPMA 5G4KA 4PSVA 4DYVA 4GW3A 5A5FA 5ESRA 3U4DA 1SBTA 1DCFA 1WF6A 1OBVA 4NABA 1E5XA 5H16A 1LKZA 1O57A 1O9BA 3Q8KA 1BEUB 4MB6A 3RS2A 3QUQA 2C03A 1EESA 1PS9A 4MVCA 5BMVF 4GX2A 4Y6QA 3E2PA 1X7XB 3AG5A 5NLLA 3EW7A 5JVDB 3OE5A 4LC1A 4WFKA 1A04A 1WB4A 3T34A 4US0R 1KKMA 3M83A 4AZVA 1GTRA 4YMGA 5D3KA 4YAOA 3VUFA 2VTBB 3LGXA 4Y9DA 3QLJA 1XZBA 3BE4A 4J0QA 4P38A 3WY9A 1TTHA 4ER0A 1KEEB 3ZDRA 3AG6A 1CVRA 4FUTA 4RDHA 2L42A 3CWQA 5ELMA 1HNNA 1MIOB 2WUEA 2R11A 4EECA 1MH9A 4R2JA 1M33A 4E09A 3IESA 1DG9A 2EWVA 3E1KA 4YWHA 1SD2A 4FDTA 1WDLA 2AT1A 1DELA 1LS1A 4HGQA 3BQ9A 2ON6A 4HH3C 4ND8B 1YZKA 3TCXB 4W1PA 3WYEA 4BLVA 3FRJA 4ND2A 3ZLTA 3DBVO 1WAMA 3ZY5A 3I6QA 4RK0A 3J7AC 3GH3A 2YRXA 5E7MA 4IX9A 3HKBB 4LCJA 3MXOA 3ANMA 5EGSA 4YJ2A 1Z2AA 5FPPA 4YCMA 1I5OA 5ER9A 3DTVA 4Z7OB 4Q21A 5AVJA 2P4SA 5CVVA 4ACBA 4JLJA 4BFXA 1EVLA 4R5HA 1JJVA 3LZCA 1R0BA 4PFKA 4OHYA 2WU1A 1QDLB 3IRVA 1OZAA 1X1DA 1E64A 4NFLA 5CEJA 4MVWA 1SURA 2QPTA 2FUKA 4E32A 5H7XA 2W7TA 4BLPA 4DZRA 3RTCA 1ZI8A 3BTVA 4PSCA 2F67A 4B2LA 3DQQA 4AKIA 2ET6A 1AZLA 3HL4A 3K1YA 5D7BA 4ZO4A 4KOAA 3L8YA 2YKGA 1JIIA 4FILA 2VJOA 4PZUA 2XYGA 3M6FA 4CCAA 2PT6A 1TOAA 1R5JA 3MJSA 5IYZF 1G38A 4HNRA 4LVUA 5ALSA 3DCNA 4NU6A 3LQRA 4FE3A 3WLEA 3PUHA 5LXTA 4DQ0A 4TLMB 1NBHA 2Z2ZA 4PPNA 1QV7A 3EXAA 4M1OA 5AXBA 3S2UA 5IN5A 1XDWA 5C5EA 1TQ4A 5I8ZA 1F9EA 4MWZA 2NQTA 4I2VA 3VM6A 3HVRA 3PTZA 1OXUA 5DV9A 2X8AA 2KHZA 1PVDA 1BDMA 3TF5A 3FB4A 2P9QA 4B73A 4DFDA 2E5FA 1VTKA 1E0KA 3EZLA 4UZSA 1WMDA 4RMGA 1HR0B 1Y48E 4IXMA 1DAKA 1DQPA 2Q1WA 4NI5A 4QWMA 1R66A 5C8VA 1J25A 2GSWA 3BN3A 3JYHA 4INJA 3D5EA 2Z3WA 3JASB 1E5VA 1KDTA 5EI5A 4YXFA 2OCLA 3P20A 4I5FA 3UJ3X 3K35A 4IUCS 2AEFA 1C8VB 1U1FA 4LDNA 4IEEA 4HEQA 1UFQA 3HYTA 4RY8A 4BO3A 1M8GA 1QFMA 2Q3LA 3OG9A 2AV6A 4WDQA 4D8VA 1OREA 1Y5IA 2PXCA 4BNKA 4YCNA 3NRBA 5B1HA 2IYZA 3DUFB 4QXMA 1WMSA 1YK1A 2CVHA 3QXSA 2ETXA 2XKBA 1KDOA 1SBQA 5JNWA 2AHOA 3WYFA 2ZATA 4M49A 4QREA 2XNKA 4TM8A 5DWVA 5FL7D 2PUCA 1KKLA 4YUYA 5L3QB 2H5IA 3MCUA 2Q99A 4GUDA 4OJYA 5EMLA 4HZIA 2NO7A 1A0OA 1SA0B 3EG9A 4M9CA 4RF2A 4E14A 5GADl 1CDDA 2FN3A 3FWHA 5LJLA 1VP3A 3UJDA 4RX1A 4R9RA 2YBEA 4UUMA 4AI6A 3BORA 1XC7A 1L5HA 4DRYA 4KQXA 3HO1A 4WBNB 3U44A 4KN5A 3CRW1 1WXEA 3P2IA 3L3BA 1SUIA 3HDYA 4Q1DA 2PJDA 3M2PA 3SZGA 5IBPA 2E55A 4CT4B 2H65A 3BZWA 4QXRA 1SRRA 2PL1A 4LK3A 3DOFA 4UU1A 5GIOE 4XFJA 3ZW7A 4EO9A 2J0QA 3OZCA 3E53A 3TDMA 3FSGD 3MQFA 4GMFA 1CIPA 1YULA 4TUYA 5THKA 4Z86A 2KJQA 4INOA 2JEZA 2D0IA 3TDKA 1O97C 2N1MA 1I14A 2VA9A 2HCRA 3JYLA 3KQSA 1NURA 5HJ2A 1RPAA 3GA5A 3SNHA 1DXYA 3BFJA 3PDJA 4MGEA 3T1QA 3WIUA 3UG7A 4L9WA 5CDFA 1FFYA 1Q11A 2JNWA 1H2ZA 3I3OA 4HADA 4YV0A 1N2EA 2Y9MB 3GGGA 4TMYA 5E7JA 4ARSA 5FWYA 1GUDA 2H59A 5ALUA 1QH8B 1VPVA 1NT2A 1KC3A 1Q0HA 3TBKA 5EAIA 3FR7A 3STVA 1L7VC 3FM9A 5AJHA 5JV5A 1O6ZA 2UXCB 3D0OA 4ROTA 3SXUB 5IRCD 4GDFA 2J31A 2OBFA 4K6OA 5EPUA 1V45E 3GVXA 1M6YA 3JCZA 2FVYA 1NRWA 1VB5A 2NV2B 4OYHA 1MZVA 3A4NA 1TT5A 4B3XA 4AJ2A 1SHLA 5D51S 3DE7X 4H59A 2FZGA 1OBFO 1XTBA 1BS9A 2F64A 2FF5A 2PXHA 4GPTA 1Y82A 4QPNA 2HM7A 2GZDA 4RV5A 3PXGA 1SCUB 2ZSDA 5HZHA 5BN4A 4UOZA 4GLOA 1CZLA 1OBHA 3AESA 5FCDA 4XD2A 2FGJA 2HA0A 2IOFA 2JEYA 1WL8A 1OX4A 2QMUA 4MW4A 2VPXA 3ELBA 2Y68A 3DL0A 4ZQGA 1E2DA 2B94A 2PU7A 2ZJAA 3OJLA 3K1AA 2GD2A 5AI0A 1UKBA 2PNJA 1IXSB 1OT3A 3IJEB 4H17A 3H5AA 3HZHA 1GUBA 5IAJA 1ORTA 3GT7A 4UE3S 2AEJA 3MUOA 1GNSA 1N57A 3L2OB 5F33A 4XASA 5K2MA 5LBUA 2LDBA 2CUNA 5G1OA 4ZHQB 4F92B 4C3VA 2WTEA 1UBTS 2D1QA 1LBTA 2VCYA 3P9KA 4I8XA 4P0QB 3M9XA 1S2IA 3ZJTA 4E03A 3CVVA 5ABPA 1S2LA 1IHPA 1O89A 2V0NA 1H1LA 4KUHA 1BJKA 2W8ZA 4G0MA 2ZJ0A 3RUHA 1DAGA 3CSDA 3DLIA 3PQ5A 4X92A 3RR2A 1AQ6A 3QVGB 3ZDBA 8LDHA 2IDJA 3OF5A 3EPLA 4RDIA 1EHCA 4IGEA 4X66B 2HWXA 4Z0PA 1EDOA 1Z7YA 1NNLA 1OTXA 4KR7A 1Z9BA 3N05A 5TQ2B 1A76A 3KUKA 4QLOA 3IAHA 2VN8A 4I4CA 521PA 2PKWA 3EUAA 4TRJA 2E4VA 5FOUA 1XA0A 1KI9A 3ITNA 2QLNA 1SKUA 2WJ3A 2DUWA 2ES4A 2V9PA 3G2HA 5FBWB 2CBGA 2GM9A 1UXJA 3K9GA 3NYQA 1AM4D 4FDAA 5FA6A 1MC1A 3DZHA 4CEIA 2GPNA 3G6JB 5BW8A 1GGJA 3F49S 1T25A 1L9XA 1CV2A 5FFFA 2ZJ1A 3O4VA 4IM7A 3D6MA 2MWMA 4YLYA 1P74A 1R6XA 3JVUA 3OPQA 4BWFB 1WHTA 4S0XA 3RAGA 1P60A 1YRHA 1P2VA 1BCRB 4LFAB 1VGQA 1Y33E 4FGWA 4MR8B 3ROTA 1ULAA 2OUKA 3H7IA 4OXYA 2ZBDA 1E1NA 2X0KA 2XUOA 3WLAA 5IKMA 2R65A 2Q0SA 1PDOA 3H9QA 4KAFA 3FNEA 4LI3X 4RHCA 1TECE 4E08A 1HYEA 3RYTC 4AVYA 3I9V1 4V0KA 1DBWA 1CDOA 4LQCA 4ZCSA 1GT6A 1VI6A 3PT5A 3HJNA 2P0YA 1F14A 5AXDA 3K7EA 1PGQA 3RWBA 1OJLA 1SU4A 2I2FA 1QZ3A 2FF7A 3JD3A 5LZ7A 4MQBA 3O38A 1BFUA 3QNUA 3DDUA 1HBJA 1ZA2A 1GTG1 5JNSA 4HMPA 4PHFA 4CKEB 2GMWA 4FJ0A 1IBSA 2EWWA 3W2FA 5J2UF 2FKAA 4DLVA 1N5JA 4K03A 4KCGA 4CU5A 2GBFA 1TAGA 1UOEA 1VCHA 2X8JB 4WW0A 1VJCA 4C6TB 2WFZA 3CE9A 4QD3A 5JSZB 3P32A 4K6CA 2PZMA 3LU1A 3V9PA 1BOOA 4B47A 5BN5A 3L0CA 3PNOA 1FLVA 1WUIS 5B55A 3ND5A 4L5YA 3L7CA 4AKEA 2RI6A 4G4IA 3L1IA 2P2GA 3X0DA 5SZJA 4G8DA 4C21A 4X7BA 1NBMA 2EZUA 2FSHA 2UZ4A 3FN4A 4UM5A 4EHNA 1U2EA 5E6RB 2G9VA 3S2ZA 1DC5A 2WYIA 4PHTA 5BR8B 1IHUA 1PZGA 3HDTA 3NHYA 3WYBA 4F38A 5L45A 3TLKA 5I47A 4OHXA 1PV1A 2AXNA 1JJ7A 1YQUA 1EQAA 3S55A 5HK9A 5DM70 4K40A 3FFTA 4KYIB 1ZGGA 5LQKA 1ECLA 3Q6MA 2YYYA 4JBWA 1EVQA 3QWFA 3MF4A 3HWRA 3PGVA 5A6VA 1RNLA 2A94A 3LVRE 4NICA 5DHSA 1W47A 5DNYB 3TGLA 2JFUA 3HB5X 3QVKA 4F56A 3OQ1A 1WZEA 3E82A 1DJPA 3EZXA 1HUQA 4N3GA 3FY4A 5GONB 3N6VA 1OA0A 1E69A 3CUEF 3WIVA 1X6VA 1SQFA 2PD3A 4DNOA 2GPBA 1YCHA 1JHMA 2GF2A 5J5AA 4DBVO 2HF8A 4CQJA 4J43A 4Q3DA 1V9LA 4QBIA 2R5FA 2Q6LA 5COQA 5C8XA 2YIJA 3V4OA 3HS3A 1ZM7A 4Q93A 2QRQA 3REFA 1FDIA 1NC3A 2PMDA 4DVJA 3Q2IA 5CH8A 3LL4A 4L4YA 3TLCA 4IMJB 5KDOA 2C1ZA 2QG6A 2PL3A 1ZA1A 4IKOA 1L3IA 4RPJA 4R2KA 3ZNPA 5DWQA 1IONA 2Z58A 2E4WA 1USKA 4NEHB 2YJ5A 4Q5IA 3BULA 3NLLA 1WXQA 2Q7OE 5SYMA 2F48A 3IALA 2GILA 5HG0A 1FRVA 2LPMA 3W5UA 1KEZA 2XDYA 4RVUA 1DOHA 2W0MA 4XX0B 1ZAKA 1OFVA 1L3BA