3BXOA

Crystal structure of streptomyces venezuelae desvi
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
236
Chain Sequence
YEVDHADVYDLFYLGRGKDYAAEASDIADLVRSRTPEASSLLDVACGTGTHLEHFTKEFGDTAGLELSEDMLTHARKRLPDATLHQGDMRDFRLGRKFSAVVSMFSSVGYLKTTEELGAAVASFAEHLEPGGVVVVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRMEVHFTVADPGKGVRHFSDVHLITLFHQAEYEAAFTAAGLRVEYLEGGPSGRGLFVGVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N,N-dimethyltransferase
publication title Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Transferase
total genus 78
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.1.1.234: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.10 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases CAC2371-like domains 3bxoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bxoA01
4DF3A 1R18A 5BW5A 5K0CA 1L9KA 4R05A 3M6WA 3QV2A 1SKMA 3G8BA 3EGEA 3UA4A 3CC8A 1D2CA 3E23A 2JJQA 3ANXA 1R8YA 5KQSA 3LCVB 1AQJA 5K03A 1G60A 3DXXA 1FPQA 3TLJA 5K0FA 3EVCA 4XUCA 3FPGA 1WG8A 1QAQA 3BWCA 2Z6AA 2AOXA 3GO4A 3MERA 3M70A 3PB3A 3LKDA 4H0NA 4PINA 5H02A 5P8WA 3FTEA 3ID6C 3HP7A 3UA3A 2O0LA 3HCFA 2Z6UA 2I6GA 2XYQA 3A4TA 4KIGA 1R00A 5JR3A 1YZHA 3OFKA 3R0QA 1TW2A 1JQEA 1PRYA 3ELDA 4IV0A 5E9QA 1XCJA 3EPPA 5K0JA 1F38A 4B17A 2OPBA 4RTKA 3RODA 3NDJA 1JG3A 5EQJB 5F2KA 2DPMA 4CKEA 4F85A 2NXEA 2P40A 2C7QA 2P41A 5ICEA 3FYCA 1ZGJA 3SVZA 1ORIA 2H1RA 1RJFA 2IGTA 3HCDA 3R6TA 4P7FA 1AV6A 3DULA 4WXHA 3KQOA 3LDFA 1TW3A 2CMGA 2V7EA 3B89A 4FT2A 4OA5A 1RJEA 2XYRA 5EMJA 1KR5A 3ER8A 1EG2A 1JQ3A 5LQUA 3HA5A 5CVJA 3G7UA 3BZBA 4E32A 1WS6A 2ZBPA 2P7IA 3IV6A 3UWPA 4LWPA 2YX1A 4RTPA 3QOXA 3LGAA 2ORED 3ME5A 3UJ6A 1JG2A 2AR0A 5E8RA 1RI4A 2C7PA 1I1NA 3JWHA 1X1DA 4C03A 3R24A 4GQBA 2OXTA 4EQZA 4PYJA 1QAOA 1B42A 3HVHA 5HIKA 3E05A 3EGVA 4WVLA 2VDVE 3KR1A 3EVGA 5GOZA 4KIFA 2BM9A 2ZULA 3KQTA 5DM4A 1O54A 4PYIA 3G8AA 3DLCA 3UJ7A 2FCAA 4FP9A 2ZCJA 3EMBA 2JH8A 3BWBA 5K0GA 2ERCA 2ESRA 2ONYA 5FA5A 4CXMA 2H00A 1RI3A 3C3YA 5HIMA 3MCZA 4GOLD 2ZZKA 3FPJA 3TMAA 2AVDA 3UJAA 3O7WA 4KRGA 3DMGA 4QTTB 2ZZNA 2PX8A 3GRUA 1RJGA 4RVGA 1NBIA 3AXSA 3KHKA 2NXNA 5EC8A 2O06A 2R3SA 2CMHA 3HVIA 1NT2A 4IKPA 4ATNA 4OQEA 3OZSA 4LECA 5LR6A 2PX4A 2ZWVA 2H11A 2NXJA 3OZRA 4PIPA 4RV9A 3EVFA 4EK9A 1XDSA 4MQ4A 4EVIA 5LQAA 2JG3A 3B3FA 3EEYA 3SSMA 3LL7A 3M6UA 3K0BA 3FUWA 3V8VA 3M6XA 5DX8A 3MCTA 3NMUF 5EEHA 3F4KA 3HCCA 4EKGA 2OYRA 3GRRA 1JSXA 2LD4A 2XVAA 3BGVA 3Q7EA 4ER6A 1UWVA 2PXXA 2YUIA 3LDGA 5GWXA 2WA2A 5HIIA 5IKMA 7MHTA 2HV9A 2C7OA 3FZGA 2EJTA 2I62A 2QY6A 2G71A 2G72A 2GPYA 2NNWB 2AZTA 3AWIA 3DMFA 3EVZA 3GCZA 1RI1A 3MB5A 3K6RA 4FSXA 4HG2A 2O57A 4DM3A 2A14A 4PGGA 1X19A 2PXCA 1I9GA 4F84A 1Z3CA 2JHCA 3FUVA 1X1AA 1IM8A 1QZZA 3DUWA 2YXLA 3B7PA 4CKBA 4YMGA 2JHPA 3CGGA 5DXAA 2ZIFA 4QVKA 1XXLA 1R74A 3CJRA 3JWGA 1P39A 5C9ZA 4M38A 4FR0A 3KKZA 2OKCA 4FZVA 4E2YA 5FA8A 4RTOA 3UBTA 3I64A 2BM8A 3AY0A 3BGDA 2NP6A 4P7KA 3UJCA 4RTQA 5K01A 4PYOA 5C1IA 3A26A 3EEOA 5CM2Z 3HNRA 3CJTA 3M6VA 1NW3A 5EHGA 5FHQA 1NKVA 2ZW9A 3PT9A 4G56A 1X1CA 3BWMA 1BC5A 4X63A 4RTRA 2Q41A 4E31A 1O9GA 4E2XA 2XVMA 3BKXA 5HOQA 4E30A 4IV8A 3SGLA 5K0NA 5B1SA 1JG1A 1FJXA 2O05A 3IYLW 2CKDA 1IXKA 4FT4A 3TKAA 3FRIA 2WK1A 2IH5A 2VP3A 5DTQA 4C08A 3FPFA 3FYDA 3PTAA 4HRAA 4PYLA 3RIEA 3UJDA 2OB2A 3HCEA 3ORHA 4YMHA 4DKJA 3FTCA 4AZSA 3FRHA 3G2OA 3T7SA 3TM4A 3HM2A 1JG4A 2PV0A 3P97A 3GRYA 1DCTA 3NDIA 3PS9A 2IH2A 3FUXA 4RTSA 1UFKA 3GXOA 1R8XA 2FRXA 2IIPA 2PLWA 2VZ9A 1R6AA 4QQKA 5CVVA 3DH0A 4M36A 4RVHA 4ER7A 2Y1WA 3KR0A 5KQRA 3G88A 3THSA 3OZTA 2BZGA 2IP2A 3I58A 5BP7A 1AQIA 3SR4A 3L8DA 4C07A 4LG1A 4U7PB 5DTRA 2C7RA 3G89A 5LQRA 4OA8A 3FUUA 1AF7A 5DWQA 5EOVA 3KQMA 1Q0SA 1XJ5A 3PFGA 1I4WA 2GLUA 3P8ZA 5CUQA 3NJRA 4CKCA 4QDJA 2IBSA 4L7VA 1RJDA 3DLIA 3JWIA 5HFJA 3GU3A 1JSZA 1XTPA 2YVLA 4RSRA 4AUKA 4GEKA 3EMDA 3FPEA 3PVCA 5ICGA 1FP2A 3I9FA 3UJ9A 3AJDA 1MJFA 4PGHA 1VP9A 5DLYA 1NW6A 4KW7A 3TM5A 5CVDA 1WXWA 3KQWA 3OCJA 4PYQA 3IHTA 3VC2A 4OBXA 2XBMA 1ZG3A 3G5LA 3TQSA 1SG9A 2PKWA 3EVEA 3LPMA 4RTJA 1HNNA 5CD1A 1KPGA 5MHTA 4OQDA 4YV1A 3DMHA 5DRYA 3FTFA 1KPHA 2OY0A 3H2BA 3KR2A 2PT6A 4HTFA 1KPIA 2I7CA 3OE4A 5E1DA 4CTKA 4HTFB 1PJZA 4RWZA 4M37A 4QQNA 1YF3A 2UYHA 5C0OE 4AZVA 2PXAA 1N7JA 2GA9A 2OB1A 4Y2HA 2ZBQA 4ER3A 5BXYA 4YV2A 4HC4A 2YXEA 4M7RA 1U2ZA 2ADMA 3VC1A 5EEGA 4YUZA 1D2GA 1P1CA 5GINE 3TPZA 1N7IA 3LCCA 2PGXA 1XVAA 5EMLA 1FBNA 4DA4A 4MIKA 2NYUA 4E33A 3BKWA 2AOUA 2PVCA 4BLWA 4Y30A 2WA1A 2P7HA 3LBFA 2AOUB 3SXJA 2G1PA 4LWOA 2BH2A 3BWYA 1SUIA 1VLMA 2AOTA 2AOVA 3NTVA 5FTWA 3S68A 4C04A 1BKYA 2XYVA 3UJBA 2AOTB 4DMGA 5FQOA 4KWCA 4CWAA 1NW7A 2B78A 3SX0A 5F2NA 2BR3A 5FWAA 5DSXA 3DTNA 4C06A 3BGIA 4DQ0A 5EPEA 3KQQA 3D2LA 3P9KA 3OFJA 5DRTA 1WY7A 2ONZA 5EMMA 1KHHA 4AX8A 3FTDA 5M5BA 5DM0A 5T67A 3PLAE 5E9WA 3VYWA 2K4MA 5HZMA 2ZLBA 2UZ4A 5E2BA 3HCBA 3HCAA 4DCMA 2DULA 3KR9A 10MHA 4PYMA 1VPTA 2GS9A 3HVJA 4FGZA 2PJDA 4O29A 5LQNA 3P2KA 1G55A 2EJUA 4GUAA 4X41A 3LDUA 5DM1A 4GC5A 2G70A 3P2EA 3NVKI 2CWWA 3BXOA 2HMYB 5LQCA 3GJYA 4QDKA 1WZNA 1YZ3A 2IH4A 4HSGA 1L1EA 4FS8A 4QPPA 1P91A 3R9XB 1WXXA 3O31A 3BUSA 3KPVA 3OU7A 4XUDA 5HILA 5K8VA 5DT2A 2EG5A 4PYKA 1KXZA 2B9EA 3M4XA 1MHTA 1INLA 3GRZA 1EIZA 3BT7A 3EGIA 3KPWA 1NW8A 3A7EA 3C6MA 3G5TA 5FCDA 4RVFA 4R8SA 2YTZA 4PWYA 5DX0A 1V39A 5HEKA 4A6DA 5K0BA 2YR0A 5T6BA 3SSOA 4R6WA 1ZQ9A 3NWBA 4HGZA 3ER9A 4KDCA 1M0EA 3KQPA 2IDKA 2ZIEA 5EHIA 2BR4A 5HIJA 3UZUA 3HA7A 4P7JA 5FADA 1NBHA 4OX9Y 4UOEA 4GBED 3IEIA 3P2IA 1ORHA 1OR8A 4BY9E 3A25A 3B3JA 4FSDA 2PX2A 1EAMA 4QPNA 5GM2A 3FPHA 2PWYA 4PIMA 3G2PA 4GF5A 2V74B 3UFBA 3KQVA 2EFJA 4JXJA 5CVEA 2JHAA 2VDWA 2P8JA 5K0EA 5K09A 2ZTHA 3KPYA 1VP3A 3A27A 3G2QA 1L3BA 3P9NA 4NECA 1VQ1A 2ZVJA 3DR5A 4V0RA 3UJ8A 4AZTA 4U7TB 4C05A 5CCBA 1VBFA 1YB2A 4BLUA 4IWNA 5CIYA 3KQYA 3OE5A 3OU6A 4K6MA 4GC9A 5EZQA 5FWDA 2EX4A 5EIFA 3EVBA 2VS1A 5DTMA 5U4XA 5JUWA 4MHTA 1XDZA 1EJ0A 1KIAA 3E7PA 5E1MA 5GM1A 1JTFA 4XUEA 2FYTA 1QANA 3GNLA 1UIRA 2IPXA 1JQDA 2ZZMA 5E9JA 4PYNA 3C0KA 4QTUB 1XDUA 4POOA 3LX6A 3TKYA 3DOUA 1EQAA 3NW9A 1JR4A 4EKIA 1N2XA 3B3GA 1X1BA 2IDJA 1BOOA 3R3HA 2QM3A 3GDHA 2PWPA 3LECA 5DPMA 5ICFA 3T7TA 2HNKA 2G8NA 2E5WA 1YUBA 4C4AA 3LCUA 3HVKA 1JTEA 3KPUA 4KDRA 4RTNA 3CCFA 3CJQA 4A6EA 4OBWA 4HGYA 5E8JA 2QRVA 3E8SA 4ISCA 2B2CA 2AN4A 1SQFA 2HTEA 2QRVB 1KYWA 2PX5A 4RX1A 3VSEA 9MHTA 2FK7A 1YFLA 4PONA 5EGSA 5GIOE 1TPYA 3O4FA 1SUSA 1VL5A 2BR5A 2O07A 5FUBA 5DSTA 3GRVA 5DX1A 3T7RA 1P1BA 3MAGA 2GH1A 5EG5A 4QVGA 3SSNA 3X0DA 1DUSA 5G02A 2FK8A 3AXTA 1G8AA 5LQKA 4BP3A 4RTLA 1Y8CA 2QE6A 2P3OA 2AOWA 5EKUA 5ICCA 3HA3A 4PNEA 2Y1XA 1BHJA 2ZFUA 5FQNA 2VDUE 1G6Q1 5E1BA 4YUYA 1VE3A 5K05A 1Q0TA 3I53A 2ZIGA 3LSTA 3SM3A 4GOOD 2ZBRA 4KVZA 5FULA 1RI2A 3GWZA 1XCLA 2UYQA 3HEMA 5F2OA 3G2MA 1T43A 1KP9A 2AN5A 2B3TA 3MHTA 5EVJA 2I9KA 2GB4A 2F8LA 5GP1A 5LSAA 1DL5A 2AVNA 2FPOA 4PCLA 1NV8A 3WSTA 1H1DA 1ZGAA 3C6KA 2OO3A 5DXJA 1L3IA 2KW5A 4BLVA 3EVDA 8MHTA 1QAMA 4DCGA 4XCXA 3PFHA 1SQGA 1KYZA 5BW4A 1NW5A 5E1OA 4CTJA 4YUXA 1M6EX 2NXCA 3OPNA 2PSSA 2R6ZA 3REOA 3PX3A 3LKZA 1YFJA 5KYGA 2CL5A 5EMKA 4RTMA 4F86A 3Q87B 3LHDA 4ER0A 2IBTA 5LQJA 1D2HA 3LBYA 2UYOA 5KS2A 3THRA 3DXZA 1HMYA 5IH3A 5EZSA 3KU1A 1NV9A 4AZWA 3GGDA 3NWEA 2ZSUA 4YV0A 1SVUA 2JH9A 3C3PA 4R8RA 4V0QA 5CCXA 3TFWA 1F3LA 4EMSA 4R6XA 1ZHFA 3KQSA 3P71T 4PCAA 5GIPE 4E2ZA 3P9IA 1G38A 3KPJA 2AS0A 5E2AA 5T64A 3RW9A 1M6YA 3P9CA 4MWZA 4GOMD 1VIDA 2N47A 3CKKA 2QYOA 3JWJA 4P58A 4GOND 5KVAA 3PX2A 2B25A 2AN3A 4DZRA 2P3QA 3TR6A 4X61A 3U81A 2YXDA 3V97A 2PY6A 1IY9A 3ELYA 1EJ6A 1ZKDA 2P1DA 4X60A 3B5IA 3GIWA 4X1OA 3MTIA 5D1HA 1NE2A 3NVMB 5CVUA 3HTXA 2OBFA 2PT9A 1O9HA 4RYLA 5EKXA 4E2WA 4ER5A 3ERCA 5DM2A 2IFTA 2P3LA 3MGGA 4RVDA 3ELWA 4YUWA 2GAFA 3A7DA 3OU2A 3I5UA 3QOWA 1FP1D 5ERGB 4ZTBA 3TOSA 5K0LA 3MTEA 4BP1A 2NP7A 2HR1A 4HH4A 5EIWA 4Z2YA 1L3CA 2Z6QA 5D1NA 3SMQA 3T0IA 3FUTA 4E70A 3MQ2A 1QYRA 1RI5A 2FHPA 3TRKA 3EVAA 4P7GA 2PBFA 5FHRA 4YUVA 3CBGA 1G8SA 3CVOA 2UYCA 2OZVA 2P35A 3DP7A 2HWKA 3ELUA 3M33A 2ZWAA 2YQZA 3DXYA 4MTLA
chains in the Genus database with same CATH superfamily
3BXGA 3D43A 4LGMA 4CG3A 4I4IA 4PN7A 1BDJA 1H2YA 4OLFA 3TPCA 1IZ0A 4Y2QA 1QMGA 4B83A 4XM0A 3V8NA 4Z5XA 5IC5A 1L5QA 3OCUA 2H2WA 1C3JA 4WN9A 5JCJA 1R6UA 2IJGX 3PWSA 3GFFA 4WN9B 5K0FA 1QH8A 1W9HA 4D1YA 5KVSA 5ELXA 1N77A 1D6NA 3SFTA 1DCMA 3UA3A 1GCOA 4EI8A 2E18A 5BYJA 4IMIB 4NBLA 4ZN6A 5MFZA 3DAGA 2EBUA 2ZPUA 3A4TA 2OM2A 4QDZA 3LUFA 3PNYA 1C2YA 2Q46A 5A7HA 2ATXA 3TX2A 3RUAA 3WGOA 4BO6A 5JXJA 2VHQA 1V45E 1NI5A 1OYWA 1URPA 2EJBA 1GTG1 1I6LA 4QGFA 4RTKA 2IZ1A 2CFTA 3HYCA 1H5QA 1JHQA 4QDUA 5EQJB 5AT1A 2PMDA 1F12A 2FN8A 2REXB 3C1TA 4HBZA 1GKUB 1ISPA 4YP7A 1SUDA 5D84A 2EOAA 1UC8A 3WFZA 4F3RA 1IJEA 4K7JA 4QG7A 5GVRA 3HCDA 4Z4GA 3AK4A 2GK7A 2VXOA 1EDBA 1UOPA 2WHXA 3TWOA 4OI0A 1T29A 3GJ3A 2TS1A 2W8ZA 3OTWA 3B13B 2X2OA 4J1SA 2AFRA 4KQFA 4F1KA 2P27A 5HK9A 5IT4A 5KQGA 4LF9B 2FPPA 1EG2A 3FHCB 4CTOA 1CF9A 4Q7KA 4Z6KA 1DWPA 2FPPB 1CDEA 1T8YA 4ZO6A 4KVAA 2A9OA 1EH5A 5BSWA 2P7IA 4B2YA 4QJ3A 2YX1A 2FJUA 2JLQA 4S2EA 3VHLB 2CDRA 1CIJA 2WJVA 2ACVA 2XE8A 3BIFA 4X91A 4CETA 3B60A 4MMZB 1S5PA 2O1SA 3EJ6A 3Q7PA 4U6SA 2OXTA 1IOWA 1Q6YA 3HDQA 4QDXA 3VR0A 1PWXA 3CPSA 3CN9A 1VIVA 1JIJA 3K09A 1Q0RA 2ZPAA 4J75A 2ZULA 2ACWA 2PJRA 2YHUA 4MMXB 1FMCA 1Z0UA 3AERA 4PYIA 3BFVA 3O8CA 2ZE5A 3DLCA 4N47A 1HI9A 3I2HA 4RCYA 1RZRA 3REQA 1XZKA 5HF5A 4ID3A 2ESRA 3TUZC 4YJDA 3REQB 3VSBA 5EE1A 5CB4A 1G3QA 3LY8A 1OBCA 5CB4B 2FFHA 2ZE6A 5JSKA 5KKCA 5IKXA 2ZJAA 4WUTA 1QNFA 1DIAA 2WU0A 2DJ5A 4Q7JB 4Y8VA 4C1BA 1TT5A 1NRXA 3JQBA 4CNBA 1E7MA 2FUG6 4EPXA 1TT5B 1JQKA 4TUYF 2B4YA 3Q3JB 4CI0B 2IYAA 1G8JA 2I3BA 3HUTA 2NZXA 2HSEA 3PDJA 4GIBA 1XDSA 3URKA 4PZ9A 5BVHA 2ERXA 4HDMA 3FFXA 5BVHB 2I71A 3IKLA 4HDMB 1R0SA 1L1FA 1DB3A 4W5NA 2PRJA 3SICE 3NEJA 2QRJA 5EJIA 4LI3X 1P6XA 4EBBA 1Z6AA 2IP1A 2ZJOA 3LO8A 2FP4A 1NDHA 1BG6A 2BT4A 2FP4B 3DS8A 3UJ6A 1TC1A 2AZTA 3KZ1E 1CQXA 1DBIA 1QVRA 2R84A 2CXXA 3K6RA 4FCWA 4YCAA 3U56A 1KI4A 3G23A 1XZIA 4DARA 3PHIA 4MCIA 4ZT6A 4ND2A 2WJ3A 4HFJA 3FUVA 3KAQA 4AJ2A 1GGKA 3G6KA 1SBHA 3DUWA 2XYPA 4IVRA 4BE7B 4G5XA 1REQA 2EDAA 4LV6A 3CGGA 4LWZA 2Q8QA 2X5KO 3NPMA 5DXAA 5TSDA 1NQWA 3B6JA 5L9AA 4FYKA 4QWMA 4FR0A 1V43A 3I83A 5CB0A 3H1FA 1CUDA 3KP1A 2XUFA 2ZIXB 1XZCA 4I3HA 1XTUA 1AA6A 1X3LA 3EHEA 5BOSA 1FDIA 1CR2A 1NTRA 3IR5A 5BOSB 1I8TA 2PH1A 5B4TA 2XY4A 3SC6A 3SDSA 1GGJA 2MTBA 1NBAA 4PYOA 4B6PA 4B33A 4C0QC 3UXYA 1U8AA 5LM3A 1XF1A 3HJGA 3P0RA 1KTIA 3P2MA 2P2SA 2JAQA 5E7QA 3W06A 2Z4SA 3ZU2A 3BCRA 1FFXA 4TROA 5AMXA 2GVZC 1TQ6A 2WJZB 1FFXB 2FZ5A 5CCDA 2XVMA 5IK2D 2XVXA 3E2IA 3O3NB 2J0SA 3IBSA 2KQUA 2UVQA 1FJXA 1J39A 4D9FA 3ADKA 1U0EA 1G18A 4L4ZA 4BNMA 3FOFC 4L0MA 1D6MA 3TLMA 1PCXA 2R96A 3FPFA 1GZVA 4OFXA 4OI2A 2FX5A 4BVLA 1K6JA 2I8LA 3WAGA 1DAPA 1E9EA 4NENA 1A96A 1AUOA 1QKJA 4B3TB 3Q9LA 4NENB 1CEEA 3UXMA 2AE2A 4AJJA 3AH8A 4HAVA 5IJZA 1EESA 1RC0A 4C29A 1XXHA 2WW8A 5JEEA 1UKBA 5EUCA 3P9PA 2VH5R 5EZYF 2XZLA 1XXHB 4QLAA 3S5UA 3SN6A 4DQVA 2D7JA 1GU0A 3FLBA 4XLTA 1R8XA 4PG5A 4R84A 2VIIA 4QSHA 3RVQA 3I9LA 2W4MA 4DA9A 5EUQB 3VMFA 3I58A 4CIBA 1JSLA 1AQIA 1OX4A 2IL1A 4N39A 4R2HA 2HU8A 1OX4B 4XZ3A 2DG2A 4OHCA 1XD2A 3PLNA 2J9YB 3OZGA 5CUQA 3ZDAA 2QENA 4MJ7A 3HCNA 1LDBA 3DTTA 1YJBA 5CD9A 5BMVF 1NLFA 3GJ4A 2DHRA 4N9QA 4JX8A 2CFOA 1F4LA 3RSQA 3DDCA 3J7TA 4PVDA 1OZHA 3GN1A 3OZEA 4L16A 3WLTA 3ECSA 4YRNA 2JHGA 5HVNA 1YOVA 3IGFA 1Y33E 3RM3A 1VGVA 1UZUA 1DHTA 1FFAA 1YOVB 1Y5IA 2PUVA 2R6GA 2XPCA 3IKVA 3Q4GA 1CSEE 1EXVA 2X4LA 4GH5A 2VPPA 3UJ9A 3KEMA 4A1OA 2PFSA 4A2PA 1U2SA 2BH9A 2FSFA 3CRNA 2V7UA 1JILA 1S8AA 2BKVA 3KEFA 1E3MA 3GEDA 4XPZA 1JAXA 2PKWA 1YAJA 4ZOLA 2VEDA 5FNVA 3MOIA 4N5DA 1JKJA 4KFTA 5FNVB 5LZ8A 1RLOA 1V8FA 3BVPA 3CNEA 3N2GA 3AR8A 1JMKC 4D46A 2JGRA 3N2GB 4KE7A 4NABA 2I9KA 1WVIA 2H9YA 2HQ1A 1RYHA 2I6QA 1E7SA 2INGX 2WZQA 4WZ6A 3SYNA 4RMNA 1YF3A 2O5CA 3LNCA 2ZI5A 1HKUA 2AUMA 4C2AA 4J4BA 4PU0A 1PL0A 4JBXA 1XTKA 4BQPA 3PP8A 1AHNA 4EVRA 2H4HA 1U02A 1UBTS 4XFDA 2GAJA 4XIJA 1GPBA 4E1AA 2NSYA 4ESHA 1XZPA 3FA2A 5PGMA 1CUAA 1DO8A 1R5JA 1Z88A 2O7SA 2FQYA 3KKPA 4YK7A 5HGJA 4S1VA 3EF1A 2IP4A 4BAUA 2HA6A 4GGOA 4DB2A 2FSIA 1PR1A 3ZE7A 2I29A 3JW8A 1NVVQ 3RT1A 4L50A 4DOMA 1N92A 3AY3A 1RVDA 4M8IA 4UTOA 5C18A 2F1OA 2XYVA 1QQ5A 3WB9A 3DQZA 2I4NA 2QMYA 3QOYA 4M83A 4G3XA 2CSUA 5THKA 5AKLA 5CYGA 4BNTA 2Z56A 3I9JA 5MFPA 2IUEA 3P5BA 3ZXYA 2GYVA 3D2LA 2PUHA 4UMDA 4KUGA 2WIKA 1W0JA 3PGVA 1SKUA 2APJA 2EF0A 2ZBEA 3GCDA 4P82A 2WTNA 4AX8A 2P1RA 3TVDA 1QCYA 2VZLA 5E9WA 4AF8A 3GC6A 3UC5A 3AGQA 2P6RA 4NF2A 3IR6A 1QWSA 3ZK8A 3IUEA 4YP0A 1P9WA 1TKBA 1X7ZA 2XSZA 4CRWB 2FFRA 5I51A 1X7ZB 1DG1G 2YMPA 2OHVA 3QW2A 1PV4A 4GMDA 4M98A 3W2IA 4YMVA 2QRNA 3SQNA 3WLPA 1KO7A 3TTYA 2H3HA 1AGXA 4GM4A 5LQCA 3MS4A 1YU9A 3JQPA 5TARA 1UDBA 3P2OA 3F3KA 4L9SA 1NSYA 2Z95A 3IULA 4IZHA 1I5EA 1O3YA 2E2WA 1LBIA 2RHLA 3O31A 1QGED 3HUFA 1N5KA 3CMCO 4EHHA 1GDDA 1VHDA 4LE2A 3KOXA 4B1FA 1DT5A 3EAFA 3CVWA 1KI2A 2JIPA 3PF9A 2XW6A 4FWBA 1XMQB 3QK7A 1YTLA 1G17A 2RHDA 4CFSA 1D1PA 1V39A 3QLJA 4HS9A 1NQTA 3HFRA 3HVUA 4II7A 4OXRA 3VZBA 4MIEA 1E9AA 1NYRA 1SXJA 4KOAA 2DKNA 3W2TA 4DIFA 5K6AC 5JOQA 4OVKA 1SXJB 2W2LD 4DHEA 1IQUA 3QHAA 1TF2A 6ADHA 4PICA 1FXUA 1SURA 2HZBA 4N65A 1WZUA 3AV0B 3ZVLA 3A25A 1QOPB 2DSNA 2VJKA 3AR2A 3ZHQA 2FSVC 1KO8A 4QNRA 4K6CA 3LUDA 2FLWA 4ENRA 4OK6A 4GZ6A 4FYYA 3D0OA 4LZLA 4EI2A 2N42A 4F56A 1D6JA 3EYWA 4BLUA 3CF6R 3UB4A 1ZH4A 2QTFA 1J07A 1KBZA 1LPSA 2RHTA 3JQEA 4TMTA 1Q7CA 4D3XA 3PGA1 4LHSA 4A15A 1EWQA 4PPQA 1BCRA 4CJXA 1PFQA 2ZRJA 1BCRB 3KL2A 1YR7A 3TRJA 2WF9A 3PR2B 2QRGA 4MGHA 3TZ6A 4MQUA 1KFJB 2GK4A 1PZFA 4AU1A 1GT6A 4KBFA 4QTUB 1EX9A 4POOA 4YWHA 4OQLA 2WWIA 5FOTA 1FVFA 1TUBA 5BSRA 1CDZA 1M2OA 2V8BA 4MQ5A 1TUBB 5EJ4A 3W04A 3HHEA 3IESA 3SHQA 1PDVA 1I0LA 1CJUC 2RK6A 2G8NA 2OA0A 4XB2A 2ZB8A 4IINA 2OO5C 3V42A 4GVXA 1RQRA 5FF9A 2FN7A 1P73A 2QAIA 4CM5A 4DN6A 2ORVA 1UBCA 2YV3A 1O2DA 4AAYA 1PQUA 1GSAA 5LOVA 1R0KA 3NAMA 1FQJA 5J3JA 3U7HB 3TW6A 2HBZA 3VYRB 2VQFB 2VNHA 3G7NA 4GYWA 4WADA 4C30A 1P1BA 1UBEA 1JVSA 1LS6A 4HEHA 4RXTA 4JBYA 1GY8A 2C9YA 2PIAA 2GBGA 1VPLA 4DEVA 4BP3A 2CHVA 4RTLA 2QE6A 1IEVA 1OCEA 3GZNA 4BZQA 5BR4A 5ICCA 2YV2A 5JWOA 1TQ4A 3O4JA 4MV4A 3GZNB 4RJIA 5C80A 1IE3A 4ND7A 5EKTA 3H9BA 1FDWA 4WKPA 1O95D 1P9OA 2GF0A 4M21A 4D9GA 4OM7A 3B1YA 1K3UB 5K3SA 1EFDN 3BF7A 5D01A 2VP0A 5F2OA 4U2CA 2B3TA 2OORC 1IZ8A 2EP7A 2DAPA 2GCEA 4OHUA 1DO2A 1LW6E 4RC9A 4P4SA 4P31A 4TLEA 5C8YA 4DSUA 1EX1A 3LJKA 4P4SB 4BGIA 5KNDA 4NJMB 1KI3A 1ZGAA 1YJ5A 3A3NA 1I1OA 3AGPA 3ED5A 4LOJA 4TV8B 4GGPA 2JBAA 3OWOA 4OJNA 4Y6SA 5LCXA 3KC2A 1SQGA 1KYZA 2ONCA 5LPNA 3VX4A 5LJLA 4JEMA 1JP7A 3PX3A 1ICIA 2Y1FA 4O8CA 4DREA 3B1FA 1E99A 3AFMA 3HDVA 2V0GA 1SWWA 1KKLA 2EARA 4J49A 5CBPA 2GETA 3TSCA 1M10A 3RKSA 1LWNA 5CBPB 5KWSA 3D31A 3HFGA 3I1JA 3QLTA 4DA8A 1K88A 2PHZA 6CHYA 3OOWA 2OP0A 4ED9A 1TVMA 1H6AA 2ANBA 4ZFNA 1EZ1A 3AJEA 4E51A 1IAQA 3ZI0A 2PLNA 2P4HX 3HM9A 1PD1A 1OXTA 2OV8A 4HPXB 4LF8B 3DEYX 5LZ9A 3FE2A 4OAQA 1NKTA 5H68A 1N5JA 5T64A 1SUFA 3VZQA 4D98A 5JLJA 1SKQA 3VR5H 4BO7A 1HSZA 1I7PA 1IXZA 2QN3A 2WHYA 2FI1A 3G13A 3DMTA 3EFEA 2W8BA 1ZRHA 1HE3A 2JK1A 4CF4A 1VJRA 2W8BB 1Z2PX 2BMEA 2DUUA 4ARVA 1QJ4A 3AM3A 5A4JA 4R2IA 2CJWA 1QV6A 3T5BA 1AKMA 1QC5B 2PY6A 4Q66C 3GNSA 3BF8A 3NIDB 1YJAA 3KVRA 3M4JA 4UASA 1NE2A 1W34A 3HRHA 3W79A 3DWFA 4V0SA 3MRSA 1TU4A 4OGFA 1OLXB 3QX7A 4RYLA 2PL3A 2WTAA 4TRNA 4RZ2A 5K1ZA 2QZPA 4W9RA 2EFHB 3ELWA 1ZR4A 2WC1A 4IMPA 3OU2A 3E22A 4V3BA 4BPBA 3E22B 1KI6A 2WJGA 3UH0A 4UDOA 2XR1A 5D1NA 3E9DA 5DLEA 2PUFA 1OH6A 1KI6B 1A82A 1J56A 3EN0A 1RI5A 4JYCA 1RDFA 1X1TA 4ZO7A 1QFYA 3ZX5A 1GTJ1 2XGGA 1PT7A 2L69A 4W6ZA 2H2AA 2HH9A 2OD2A 2OZVA 1HOTA 5JSYA 3G68A 3GDGA 4JKYA 1QFXA 4HEJA 1V96A 4MTLA 5BWBA 1NVEA 3NWOA 4D94A 3PXEA 1G2OA 1ZC3A 1RYBA 3ENQA 1GGFA 2ZXEA 3BWXA 2RGRA 1Y6QA 4B8ZA 3MTDA 4UBLA 4A6XA 3WGLA 1NRIA 1DAFA 1F6DA 1YIDA 2H1LA 4OXIA 1CD5A 1N6KA 1RWBA 1P0MA 1YR8A 4BFWA 4MI9A 1YQEA 4K9MA 5P8WA 1E6LA 3M70A 3PUVA 5I7RA 1CY2A 5TJHA 2IYTA 2PD4A 2ZBDA 4I1SA 3UMMA 5AHXA 1PTJC 3R23A 2VH1A 1WHSB 1JXQA 1QK4A 1TOAA 3VR5A 3WQHA 3NHBA 1RWWA 1MX3A 3LUGA 1IBLB 4H15A 1NT4A 4KR6A 5CNIA 1F8GA 4YJHA 1QQTA 3V32A 3ADOA 4O0LA 1XZBA 4HEQA 5BT9A 2VDKB 1H65A 1N1GA 1ORIA 3FOWA 2PSHA 2EZUA 1WA5A 5IKEA 2AKYA 3EX7C 1EK6A 1GQYA 2W70A 3RG2A 1C9MA 1EFKA 2C8LA 2V55B 1Y7LA 2DM6A 2FU5C 3KQOA 1S01A 2B7CA 1G8PA 2CMGA 1OLUB 5KPDA 3OBBA 4GYKA 2ASVA 3FCXA 3CU7A 1SXQA 2O50A 1TCCA 4E32A 2C83A 2LKCA 2ICAA 1E2PA 2RGEA 3BAFA 2P90A 4MTCA 3VJLA 5CITA 5TMPA 2ATCA 4BLOA 1RM3A 2I6SA 2W6JD 1UOOA 1XTSA 3JWHA 2WIGA 5FPYA 4QUBA 2FRDC 3WFJA 2IYYA 2W2KA 2E21A 2X13A 3E05A 2ZJ8A 3LC0A 3U3RA 2JD2A 2JATA 1VGRA 2W2KB 5BURA 5FLEX 1YMVA 4D0LB 2Q9BA 1C9DB 1J70A 2QU8A 5DM4A 1PS8A 2BC9A 2O3RA 2X5XA 1ZM7A 3UANA 3ZCXA 1CG6A 4RY9A 4WIAA 1E2KA 3K3PA 4KACA 4BKPA 1KO4A 2AXEA 4MVWA 1U1FA 2D62A 3NM6B 1T2DA 1QGAA 1BMQA 5HIMA 1ODJA 4PZZA 4REOA 2WSSD 2EGUA 3TD2A 2J0EA 1GGMA 2O3SA 5KINB 5EXEA 3O7WA 3CUEF 2GPSA 3OBIA 1JBKA 3N0TA 3AILA 4H3SA 5ECDA 4DG8A 1ODKA 3HI6A 4YGXB 4YMTA 1DSSG 3K35A 2R3SA 3OKAA 2W6OA 1N25A 2P11A 3I3SR 3PWTA 3GNTA 3DF7A 4M54A 4OQMA 1YAHA 3I2FA 3OJFA 4PG7A 1XFAA 3T1OA 4NSNA 4D0GA 1XOIA 3EPKA 2QTHA 3KSMA 3FLAA 3SSMA 1ZGZA 1UT6A 1J5XA 3NHKA 2ZSJA 3R41A 3UCFA 1E3WB 3FUWA 1CY4A 2NZVG 2YC2C 4QU9A 3LPCA 3M6XA 3NVAA 5JPCA 4ARAA 3P26A 5KNLA 4RVCA 3L77A 3ZW9A 3V8PA 2QS9A 4IF4A 1UWVA 3N2NA 1NI3A 4CF6A 4ZDIA 1QP7A 1E6EA 3IAM1 4N0MA 5L51A 4P7JA 1EZZA 3NRBA 5GM2A 3MB5A 4DMUB 4H2DA 5ALPA 4ZJZA 2H1HA 1JNXX 1G5RA 3GP3A 1C81A 2RKWA 3QPBA 2GK3A 3FM9A 5DJ5A 4F8YA 4EKYA 4A8TA 2AZMA 1P17A 2AFHE 4W99A 2F90A 1RRPA 4S1PA 2KX7A 3DP9A 2LNDA 4PYRA 3NFYA 2YNMC 4YMGA 1WD5A 1YHZA 1HETA 2DVMA 2V7QD 3WNZA 3EG9A 2IEGA 4JR1A 3D8BA 4TQUS 3GCXA 2OKCA 4I08A 5DGXA 3T9BA 3EG9B 2IYEA 4LC9A 3PQ3A 5EWLA 4RTOA 3ZD7A 3U44A 4HQKA 3BGDA 5EWLB 3U62A 3U44B 1VSBA 5LB2A 1IULA 2JAPA 2NM0A 3DAOA 1RKUA 4TRJA 2BTEA 4C7OA 1P60A 1QFSA 4QT0A 2DT8A 1E3QA 3CUKA 4Y2VA 1I9CA 2O3TA 5AI6A 3BK1A 1XZHA 3LZDA 1OAOA 5KIAA 1JSCA 2IZ5A 3FOEC 4NIMA 2YYAA 2VL7A 3A9CA 3RH0A 2A1TS 1A9ZA 4EUKA 3EFHA 1IHDA 4EYKA 4F4UA 1JG1A 1XGKA 2QPTA 1USKA 1DKOA 3WK8A 2A9FA 3D3QA 4FT4A 1JKMA 3AONB 2A35A 2Q0XA 3MJRA 4HAZA 5BRNA 2C5BA 3D6NB 3VZDA 3L0IB 4U0KA 4BO8A 1J6UA 5I8WA 1YBAA 3LT0A 2LBPA 3CKMA 2BN4A 1Y1LA 1L7PA 2QQEA 4PHCA 5SZJA 3VH4A 2X9GA 5BNWA 2DY0A 2FDCA 1DT3A 3P9SA 2NSHA 3L6RA 1L4MA 3LFHA 2OZKA 5T41A 4NV1A 3W7VA 5K3EA 1LI7A 4WDRA 5CFOA 2OAQ1 2XLCA 1GA1A 1GG2A 3DBIA 3KR0A 4RGYA 4RNDB 1BU5A 3R5SA 4RWEA 1S89A 5E7JA 1N2CE 3FLEA 3MWYW 3CRRA 2WV9A 4A23A 3RYIA 1PT8A 1X15A 1DC5A 3FNFA 2XKKA 3VPSA 3RYIB 1SJ9A 3RFVA 3SR0A 1Z6XA 4B85A 4DLZA 1Q0HA 4NBVA 1ZJJA 4H3HB 2GLUA 4CL0A 1XU7A 1XFDA 4OYRA 2E7ZA 1IPFA 3X2EA 2VTVA 1G0NA 3DLIA 1NFQA 4Y2XA 1YK0A 3PGXA 4FHZA 1SY7A 1UBOS 3EEIA 3JQRA 1YC5A 4R54A 5E3IA 8AT1A 3F74A 1DCKA 2PXHA 3OIVA 5BORA 4W5OA 1R16A 4D3ZA 3JARB 2ETVA 3V48A 1WQ4A 2QVYX 3AJDA 3L0SA 1KY2A 1L4GA 4IWYA 4DV7B 3UGKA 3IUNA 5GGYA 4OBXA 4PHGA 5AI8A 2Z9BA 3WBBA 3G5LA 2HMUA 1G0OA 2V5VA 1UANA 3FTPA 4JJ6A 5EKSA 3EVEA 2GF2A 3L1IA 3CLKA 2ZVDA 3GPBA 2G8LA 1L6IA 2ZUEA 5A02A 4RK7A 5GJCA 3D4BA 3NM5A 5F73A 2I4TA 5LQSA 3KR2A 1HX7A 4RKRA 1H2AS 1LK5A 2HA7A 4MH0R 1Z7GA 5JAZA 2MT9A 4LYJA 4RJLA 2Z3VA 4LV8B 1H9AA 3IE0A 3JPYA 2FN4A 3GJRA 4OHOA 2NAFA 4XEHA 3TD6A 5JD5A 4KE8A 4M7RA 3G82C 4ZC8A 2R48A 3HR7A 2LXNA 4YR7A 2CHGA 1MFZA 3KB6A 4G89A 2A59A 2ZITA 3FBGA 5C1OA 5KX5F 1QG4A 3QKRA 4R9NA 5DW3A 3QKRB 4YYZA 1XU4A 2BKEA 4MVJD 5J58A 1W30A 1SUIA 1HE1C 2PMFA 1B8OA 5ALMA 3L40A 4WFJA 1ZRSA 1N2BA 3AL0C 4DLBA 3D3NA 4CTMA 3SX0A 1GPH1 3LWZA 3IOBA 2XUOA 5KSWB 4IDEA 1KY5A 3RVNA 3Q3VA 4HH0A 5LBIA 4IJVA 2R68A 1E7WA 4AJ9A 4U7DA 2NVWA 3B1JA 1HDRA 1X9GA 2OHGA 2IXFA 4D9BA 2E4XA 1TF5A 2QD1A 2WAYA 3ZWKA 2ZRIA 4ZAGA 4DV0B 3IIJA 2B2NA 4GX2A 5EJ2A 3OFND 3TYXA 4DA6A 1XMVA 1P2SA 2Z04A 5E2BA 3X1MA 3IBCA 1S2OA 1YR2A 2VT3A 1XLVA 4ISBA 3KOOA 4B4KA 4MCAA 1L5HA 4L6CA 4LZZA 2AZ4A 1L5HB 3NTOA 4J1NA 1ONPA 1QH0A 4PW0A 4RF2A 3P2KA 4DDHA 4QE3A 3TXYA 4MQLA 3IQZA 2EC5A 4WACA 2Z1DA 3PFBA 3VI3B 5A5DA 2MOKA 4DJJA 3PUZA 4LEIA 1AE1A 1YZ3A 4LSZA 2K7ZA 4ZMRA 4XX1A 3SBOA 1VFNA 4JC8A 1OKKD 1SHTX 2XKBA 1PDOA 3Q3HA 4RGQA 2Z09A 1FU7A 1V5IA 3WO1A 4ZRDA 3QU4A 2F7SA 2MMCA 3BM5A 3A1NA 1W36B 1AGNA 3W1WA 1AURA 2BKLA 4I5EA 4DR6B 4P92A 3IB6A 4QYTA 4R8SA 1SCNE 5AJUA 5DX0A 2IU0A 1DXHA 5BNIA 4AY6A 1XQXA 2GN0A 3HN6A 3OQJA 3TCNA 5BWCA 3SSOA 4R41A 2HMSA 1F48A 2H6EA 3WGIA 4JP5A 4PLYA 5B4UA 4KGZA 2ZIEA 1MB9A 1X77A 4Q02A 3PX7A 4HDCA 1GRRA 3FPLA 1BJTA 5FADA 3EOZA 1LLQA 1C9KA 5CRIA 3WLHA 5EN4A 4ETMA 2PX2A 1CDOA 4LSMA 3IO5A 1NKSA 3ZQJA 2UV8A 1W2GA 2JIZD 3SS9X 2RGDA 3K0EA 3UFBA 1DIHA 2EFJA 3HBNA 2F64A 3R3SA 4HLUA 4X0EA 2FAXA 5FEMA 2OWEA 3KPYA 4LZAA 2NWQA 3A27A 1L3BA 2YBEA 2CXOA 5CFQA 2WINB 2CK3D 5C31A 1TFRA 2CXQA 4U7TB 2ZI9A 1KDPA 5TDHA 1SD2A 1UXKA 1Z37A 4P35A 5A4KA 2GN9A 3VNSA 4YCLA 3C4QA 3H16A 3O3MB 1AKTA 1K68A 1I10A 5C37A 5A2GA 2OCDA 2FN9A 4ALNA 2H29A 1H9BA 3MTGA 5JC8A 3C7DB 3CURA 5F51A 1L5VA 3H1GA 2FPUA 4IL5A 3VKVA 3G9XA 3EZ6A 3S1LA 4BVAA 5C1BA 2X1LA 4BC0A 2WF5A 4PN3A 3K2EA 1JAHA 1ND6A 3K1JA 3DZDA 4NG4A 1N2XA 3D7NA 1FU8A 4NX2A 1I3LA 3VOSA 3LA6A 4F5EA 4LF4B 3LECA 3KLPX 3T7TA 3CX6A 3OIWA 1W5TA 4BNVA 3HYSA 4X8LA 3WNQA 5G0TA 4XFKA 2OAGA 1CEYA 3HSSA 3PI7A 3UHFA 2YRXA 3SJZA 1XEFA 2HTEA 1QG0A 3R76A 3LX5A 4JT8A 3UAOA 1VLHA 3R09A 3WL3A 1BS2A 2MR6A 3OQHA 1RWPA 4CM7A 5KTSA 1SUSA 4F45A 4C4RA 4J76A 2GARA 2O07A 5EUMA 1Y4AE 4H7DA 1WZIA 3B70A 2LPMA 1YASA 3MJ4A 4FHGA 5IBPA 3RS9A 3ZDFA 3V4RA 5TR9A 2Y9MB 2GH1A 1LPBB 2GM3A 3F6PA 4MVJF 4Y6PA 1TT7A 8ABPA 1Y8CA 4CIDA 5EKUA 1KGSA 2WF8A 1C4WA 2OMEA 4IKOA 1AMOA 2HQBA 3Q85A 3ZDYB 1BMFA 3E03A 1Z08A 1UWCA 3CFYA 2VDJA 3EIEA 3VJRA 1A7JA 1OYOA 3GWZA 4PZUA 3LPNA 1RFLA 4Y2UA 2HFJA 5AO9A 1JIUA 1KP9A 2AN5A 2B21A 3NKVA 2C03A 3T9CA 3ZUPA 1K98A 4RZHA 4AMBA 4XWKA 4D0SA 4KPUA 3EDMA 1YZVA 1DELA 5I8ZA 4KPUB 4C2UA 4HGPA 4YNBA 1Q1QA 4XGNA 1QHXA 2HRDA 1OWNA 1WLYA 2A5YB 3WSTA 5LYJF 2J33A 1L3IA 3B9RA 4Z8XA 4XCXA 3WGGA 3NUQA 4JHLA 1J0DA 1QIFA 4MWBA 3IAFA 5IABA 1RM5A 2VTDA 3TS1A 3T12A 5LOVB 2OBXA 1U9ZA 4K3UA 2RGNA 1NJ1A 3WYCA 1TK3A 4KYIB 3F0TA 1A9OA 4FFVA 4I1PA 5H81A 2XT6A 4KQHA 1AQNA 5KUTA 1Z2OX 2Z5GA 4NRDA 4OEHA 3LDAA 4M7OA 4QOFA 1AXGA 3HS3A 1PTKA 3UUGA 2Q7XA 4ETNA 4JWKA 1FRQA 2FG6C 2D1TA 1AU9A 5B58C 3HZOA 4I4NA 4EYSA 3F98A 1O1YA 4TX1A 3LV8A 4BN4A 4NBKA 2PQ2A 5KWIA 5KI6A 4V0ME 3UWOA 1Z26A 1S2GA 3ENVA 3GJZA 1IVNA 1L8LA 4ILEA 4JI8B 1RQNA 2AS0A 5E2AA 3B7GA 1TIPA 2DHDA 1Y9AA 4D2IA 1VIDA 1E3JA 1DPFA 1XVTA 2ZYVX 1SELA 3ABIA 4BN0A 4ZQIA 4E0BA 2P2ZA 3ORFA 4DMLA 2DXIA 3NAQA 2NO9A 1O95A 2AN3A 4NBTA 2CJFA 1ORTA 4D6YA 1J20A 2ZRKA 4MROA 4BKOA 3ELYA 3GVCA 4H7EA 4B7ZA 4PAOA 5SY6A 3IHKA 1OHHA 1U99A 1EBUA 1MUUA 2F1IA 1D1SA 2I78A 1XBTA 1XCMA 2XB8A 2YQ5A 2FPMA 4M22A 4TWJA 1U04A 3DAFA 4TT3D 4NNPA 3TFOA 5F9MA 1CJBA 1Z3IX 3MGGA 4FR5A 2OV4A 5TS2A 4YUWA 5HHTA 4GRAA 1S6YA 2DFTA 4D96A 2Q5CA 2BHLA 4DIMA 1AKQA 1W93A 2QUBA 2YIVX 3AVTA 1GAQA 4J0DA 2GSDA 5LYYA 1OI4A 2Z6QA 3T0IA 3U19A 4RDCA 5FOBB 1NE7A 2QSUA 3DKRA 4LYDA 4DABA 1HFJA 1OV6A 3PC8C 3PQ6A 4BGDA 3GPDG 5I9BA 4CF7A 2JDID 2X86A 3HDGA 4MO9A 1R7RA 4YUVA 2P9CA 2VSOA 3EA0A 4CG0A 4QU0A 1PQWA 1B93A 4Q9NA 2A4KA 4X6YA 2GZMA 2ZI4A 3EY9A 3LM8A 4LXHA 3WISA 3MN1A 4GE0A 4J4HA 3IQGX 4I1YA 3N0WA 5EERA 2PKQO 1QPBA 4G1MB 4A8HA 4D8VA 2WKWA 1NP3A 1PL8A 4FE7A 2W2MA 4Z4QA 721PA 3CC8A 2W6ID 3LLVA 1E8NA 1N3LA 4DPKA 1G60A 1PP4A 1C29B 4G25A 2X2FA 2Y0CA 3A3OA 4S2UA 4XUCA 3S55A 3ZBUA 4WXRA 2CD7A 2JGDA 1NMEA 4EUSA 4MA4A 4P83A 3QM1A 3EEFA 3WHLA 4F9TA 3BL6A 4DLRA 3HXLA 1SVKA 1CXZA 4M7WA 4QNNA 5JR3A 1TYDE 1A9TA 1SKBA 2DQYA 2HA3A 4E5VA 4F5WA 5ABPA 5LP6F 1Q14A 1R5NA 4IV0A 5NLLA 3U7EB 3QF7A 4DCVA 1F38A 2V7BA 3I6YA 1TDJA 3RODA 1ZK4A 3EZXA 4GZ5A 1M0TA 4E5DA 3TZKA 1HTWA 1YZKA 3SAJA 4WLVA 3RUEA 1IZ7A 1YJXA 5ICEA 2Z8YM 1D4ZA 1ZGJA 4RW0A 2DBRA 3UHAA 1OBOA 3I8OA 5C46F 1FDTA 4ABTA 1CJTC 2PL5A 3DM5A 4FEEA 1SM4A 4O8ZA 3GLIA 2QW0X 2CXNA 1SVNA 3RCBA 3GLIB 1Z13A 2BDTA 4YBZA 2D2VA 1MXFA 3C1AA 4KITB 2NPOA 3GHYA 3IV6A 5ALYA 1D8TA 1JZQA 2JAHA 2ECFA 1R1DA 5EP1A 4CDNA 2FSHA 2C7PA 4AJEA 2AR9A 3R6GA 2QQ5A 4OIMA 4EQZA 3EUWA 3NV9A 2WJYA 4HP8A 1W0KA 1U3DA 2PGLA 4MAMA 4WVLA 1PBTA 3QTLA 4U39A 4X1KA 2CSXA 2YN0A 4X1KB 3TG8A 4BKMA 4JI2B 3EMBA 3KUKA 2EG9A 5K0GA 3DOCA 5KSOA 4OQZA 3TXXA 1MR3F 5IM5A 1DJMA 4KFSA 4V2IA 2ZKLA 4FNGA 4IPTA 2D7CA 2O4CA 3NJ4A 2WUWE 3OUZA 2WBLC 2LR0A 4ITUA 2AVDA 3VO9A 4UULA 1ZM9A 3PQ2A 4H4EA 1PEAA 1ZH6A 2G9VA 2YCLA 2XCRB 1QYCA 5CFRA 3KJGA 2GJSA 3TZEA 2DBZA 5DN6D 4LFAB 3CA8A 4LECA 2R1ZA 4GQAA 1LDEA 2ZB2A 4PIPA 4G1BA 3ET4A 1GCGA 3DOOA 2BVNA 2OXFA 4XVQA 2QT1A 3PLRA 3SEQA 3VVCA 1ZVQA 2PLFA 4X3CA 1IUNA 1WQ3A 1AZWA 3NHRA 3L5KA 4JJKA 1C3VA 1NDUA 1QKKA 3VU9A 3BGVA 3T61A 1AN9A 1TVEA 1GDHA 2YUIA 3VU9B 3OOHA 2WA2A 3PIIA 1Z82A 4MP6A 4IOJA 1LXCA 3W5SA 1XL1A 4MYRA 4BFUA 5GZ6A 1P4AA 1QIDA 3WL7A 3X44A 3UAYA 3TH5A 1I9GA 1T3LA 4YI3A 2DX7A 3C98A 3GFOA 2ID7A 2JI8A 1NBME 2AI1A 2HPAA 3E7FA 1OT5A 4FGWA 4P81A 3UWKA 2I4LA 4PRKA 2X0RA 4M1WA 3O3CA 5HJ7A 2JZCA 1V41E 3G6WA 3PSAA 1N3YA 5DBHX 2B61A 3Q6NA 3WK5A 4P3NA 2AEJA 2RBKA 4OAOA 4TTRA 3K4QA 4HL6A 2PU5A 4REQA 4HFMA 4ZQBA 4NCAA 2D8AA 1G6OA 3KSAC 4I1IA 4REQB 2CW5A 2C4WA 4F06A 4LQLA 2QW8A 1U7PA 5CM2Z 2AG1A 3LC7O 4NE2A 3UMRA 1JR3E 5EHGA 2A1IA 1SHKA 4NU5A 3WGVA 3GJSA 1U8XX 2AH5A 3ZNOA 4AJ1A 4EY3A 2BHTA 5FBHA 1FQKA 1Y81A 2C5SA 4XE5A 4C88A 2VO1A 2R00A 4XTRA 4JDPA 4II2A 4RPKA 2DUJA 1SXPA 4LRWA 1B0PA 1WW2A 2A67A 3QEMA 2LCFA 4CLDA 3QEMB 2P9TA 4DG5A 1M1ZA 1E2BA 3PKIA 2F3PA 2X4IA 1K8YB 3RIEA 2OB2A 5FLYA 3IS3A 4J94A 3JVEA 5ADVA 1JG4A 2PV0A 3P97A 4LRYA 1KS9A 1NI4A 2W83A 3PHHA 4PAMA 4ZCTA 1VXOA 1NI4B 3N75A 3MJEA 4LHZA 3QLVC 1RQLA 1FDUA 2Q6VA 3V4SA 1H05A 5FWNA 4E11A 2AJCA 1BE1A 1W6RA 1A3CA 4AJPA 2G09A 4LXIA 1J2UA 3PITA 5KQRA 3RS7A 1LVGA 4JQOA 2V7QA 2R6FA 1A4XA 3WRYA 5DZSA 2HI0A 3RAPR 2VLIA 4CEIB 2A84A 1I0ZA 2Q5EA 3K20A 1O4WA 5D7NA 3ESQA 3GFSA 4X64B 3A4MA 4RA9A 3BMQA 5CB6A 5DLDA 3RWBA 4RA9B 2WOJA 3BMQB 5C51B 1IEXA 3RSHA 4K0KB 2ZJZA 2C07A 1QVWA 4FN4A 4GMXA 4BBJA 4GZLA 1CY0A 3WI7A 1QBGA 2Q3EA 4GQIA 4D5EA 4U00A 3FPEA 5T6MA 1Z5NA 4CMCA 2WWHA 3RRYA 1XQWA 3TQFA 5HYVA 4RIHA 1MJGA 4IQGA 2FQQA 4Q1DA 4F4FA 1UFQA 2TMKA 5EINA 1A0OA 3JYLA 1LBSA 1P4HA 4TGLA 4DANA 1JDBC 4UOQA 3ZV7A 3W5AA 1ZG3A 2QW1A 5LD2B 1HQYE 3ETNA 3KJHA 4KMRA 3W3ZB 5HJEA 2J5KA 3ZOZA 1JXAA 1WW8A 3FZQA 3P9XA 4HH1A 3GZ4A 2ZRBA 4PZEA 5IF9A 1C7EA 1HPLA 3AF5A 4EA8A 1L7OA 1BQ4A 2EV9A 3AY6A 3WLFA 1T8WA 3KYCA 1WQ1R 5ALIA 3VAAA 4QEDA 3DO6A 3KYCB 4K2HA 2ISSD 2ZBUA 2N0SA 2ZBGA 3O8QA 4G9BA 3VC1A 1OOEA 4Y6GB 3KLMX 3O8QB 1WCWA 2GBIA 3ZIAD 4M8NE 5JAUA 3S28A 2FWAA 3Q9SA 4N18A 3TGPA 4WZBA 3RAGA 4U9IS 4MGYR 1TC2A 1FUIA 1OVMA 1RVV1 4MITA 4UE2A 4WZBB 1J0XO 3HYNA 3OOEA 3V6MA 3VXKA 1HDGO 2LTAA 3KDPA 3CR8A 3NIBA 4M1EA 5HFNA 1V9CA 1UFRA 2YJ3A 4FEAA 3K4PA 4G0QA 4JXKA 1YNOA 4KWCA 3AUSA 4PC6A 2WAOA 3B6IA 2JLRA 1Q44A 1VCHA 3GJ6A 4M0MA 2ZR9A 4GLJA 3U4HA 3P9KA 3AJ8A 1G21A 3H97A 4YJKA 1F0PA 1PL7A 1BVYF 2CCGA 2HA0A 2X8BA 4NATA 1G21B 2ZWOA 4JOQA 3HWRA 2O8VA 4DWOA 2ZATA 4L4UA 2I34A 1RJWA 4MW4A 5BOVA 1XTIA 4CL8A 5AESA 1SZPA 3JZIA 4I5DA 4Q3CA 3R8XA 1XCBA 2XITA 1XC7A 5CR9A 3VHRA 4PO3X 2AK3A 3KJIA 2H8GA 2Z5FA 4IVNA 4K9RA 1ESCA 2C59A 4HATA 2CBXA 4QARA 3O8NA 2NZUG 1UCFA 1WBJB 1F60A 2JKZA 3A9RA 3F46A 4LKOA 4OOFA 2J08A 3ZK7A 2VNJA 2CVHA 4JBIA 4B79A 4F72A 1GQFA 2PJDA 2WKRA 3CWCA 1MO5A 3FKSD 3H2YA 4FHEA 2BHNA 4WERA 2EJUA 2JS7A 4RM2A 4BNLA 2KS6A 3QUTA 1ZCAA 3AVPA 4J6FA 1IUPA 2X9VA 4OSPA 4L0DA 1VL1A 3JATA 1M8GA 3ITDA 4FOSA 3HUEA 1NUUA 3AR7A 3JATB 3O75A 1OFIA 3GR6A 2QLTA 4HN2A 4Q4DA 3UAWA 5FDFA 5MGNA 3V4ZA 1PS9A 3ZS9A 3NBAA 4PXSA 4LN1A 3VNAA 4EGFA 5L4NA 4UZEA 3PC6A 4OJQA 4TSFD 4IEEA 1PZGA 4DBLC 1CUEA 2C0PA 3K9CA 4RVFA 3F7TA 3N8IA 4PWYA 1UZNA 3VU3A 1ENZA 3D6TB 3EXFA 5K0BA 2PYIA 1RHUA 3DLPX 2PS9A 2XDQA 3EXFB 5EHIA 2XDQB 3ZQ6A 5J4YA 4IHAA 1T6XA 2AA3A 4GVLA 1DQNA 1G5QA 1UADA 4L76A 3FF4A 2NYAA 4XW2A 2ZUCA 3STVA 4BY9E 2CB0A 5HE9A 3I9MA 1Z45A 1TJ5A 1TX4B 3H5AA 1EGMB 5KJ1A 3ND8A 5TGDA 1CC1S 2BPOA 4IDQA 3ZY3A 2HU2A 2C7RA 5LXTA 4FFSA 4L5JA 5CLLA 1YZGA 5LXTB 2A0YA 5FA5A 4NECA 2DHQA 1DG3A 1KAHA 4AN0A 3CONA 3HB0A 1U3FA 4K9DA 3CISA 4AY3A 4IWNA 4UNQA 3ZDQA 4RL6A 2EX4A 2VS1A 2JIDA 1FRVA 4JDUA 3Q7TA 3QEJA 2WD8A 3M3PA 3ZY2A 5GM1A 2JCSA 2BYTA 2EW1A 2AX3A 4OMDA 4QDOA 3RRFA 1XPJA 1PVVA 2QTMA 3VGPA 3K1ZA 3WSVA 3ASZA 2II6A 2QSJA 1G9SA 1PT5A 2XD9A 3TGLA 3IPRA 4FYWA 5JJLA 3RUPA 1SBCA 1ZIXA 4KODA 1H42A 4BHTA 1UMDB 3UATA 2PWAA 3FNHA 1THGA 2I7TA 3GLTA 3T4UA 4EKIA 4YRTA 3MUOA 3SFZA 3K70B 1VI5A 3PF8A 5KMGA 3RYCA 1X8KA 4J2OA 4KTVE 1WUJS 5AQEA 5KMGB 1JTEA 4CIXA 3D0KA 3Q8WA 5AIAA 2PZJA 5FBVB 2CDNA 5AKHA 3W8FA 1UAAA 1OVGA 4ANFA 2EJVA 6PFKA 4JI5B 5FEUA 3WWOA 4G1VA 4EDFA 3EA4A 3T5MA 1OGYA 4REMA 3WC4A 3WK9A 1GZ4A 2A3NA 1IDN1 5FTLA 1WL8A 3H5NA 2DY1A 4J7UA 2OD9A 5IVPA 4UW9A 4UNRA 1TJ4A 3EQ9A 3SBXA 4LOLA 1T3ZA 4G41A 1D2RA 3T7RA 4Y18A 2QI9F 3MAGA 2B8JA 3WIDA 4BQFA 3GOQA 5LZ4A 3U7IA 2BFDB 3C3EA 4RDXA 4LBVA 3ZWOA 3NR2A 4AN1A 1WSAA 5L7TA 2ZJFA 1Z0ZA 5DNVA 1JB1A 1EXNA 2GNPA 4KMMA 5AI5A 5AKYA 2VYNA 3JU3A 4EYEA 4G4SP 5HK8A 5JS2A 1RAEA 5EJAA 1XHEA 2XWBB 5E1BA 3PD1A 3NTLA 5JVDF 5KSYA 4E7PA 4MLDA 2ORIA 3UICA 1UEJA 5DBFA 2NZJA 5TGZA 5LP1A 4ZYZA 1D4FA 5JAQA 3NB0A 4LTNA 4ZCLA 4AYXA 2VA8A 3MHTA 1E1RD 2B20A 2BJVA 2GN6A 3K0AA 5AKGA 2O2EA 4FLFA 2A5JA 2AV6A 4ZQCB 3K0AB 1RCFA 5EXPA 1C7IA 1NUTA 2GHQA 2NGRA 2C77A 3H2JA 4AG5A 1UEXC 1TZKA 1MABB 1FTGA 5EP4A 5DXJA 1KKMA 2O3JA 3RB8A 2IKSA 3L6EA 5K2MA 3O2SB 3PFHA 1RIIA 2PIDA 1MIHA 3QKUA 1CJKC 4UVEA 4J0GA 2NT4A 2QBYA 3ZDRA 2EKZA 2QBYB 2UKDA 4U2EA 4DLNA 2V6FA 1QIHA 3W77A 1TUIA 4AJKA 1EUQA 3IDSA 4R5MA 5HG0A 3VR1A 3PJRA 4Q3OA 3RYTC 1BXRA 2PKXA 3HBFA 4O2AA 3RS4A 2ZS9A 3VU0A 4OB8A 2UYOA 1BXRB 4O2AB 1E6KA 1RQ2A 3BA1A 2XOXA 2IYXA 3DMDA 3G9UA 3NTXA 1C3OB 4UNSA 5F21A 3LP6A 1RKVA 5KQLA 1PR0A 2ID9A 1EWYA 2C2BA 4GOJA 4W5HA 4JMPA 3EULA 3ONNA 1HEIA 4Q0MA 4RMIA 3SIPA 1KO5A 3TFWA 3OZVA 3A6JA 4NCIA 3DCNA 4EMSA 4B4UA 4I8IA 1SAYA 2QE7D 2ODEA 5GIPE 5LP6B 5IZ4A 2FH5B 1M6YA 4DV2B 1UBKS 1GU1A 3COJA 3U80A 3HSKA 4V38A 2FWNA 1K2WA 5DH9A 3WGNA 1JE1A 3MCVA 3HB7A 3KV1A 4HO1X 4M46A 1P2FA 3V1TC 3SJAA 5DF1A 3U4QA 3FRJA 4XEUA 4LA4A 1N6IA 4BLSA 4GXQA 4BXOA 3U4QB 1L5NA 4DNPA 3UMGA 4BXOB 4AS3A 2QU7A 5U1PA 4NI5A 1M75A 5IYZA 5D1HA 3PC2A 2JPDA 1MKYA 3HNPA 5IYZB 1ST3A 4DTIA 2VCEA 2GM9A 3L8EA 5L3RA 1O9HA 3VR4D 1K5PA 4HN4B 4EY8A 4C01A 1AH2A 3ABRB 2VQ6A 4YHBA 5HKOA 4RVDA 4KR2A 2FVYA 3ST7A 4M76B 3MF4A 4FSHA 4L3OA 5K0LA 4R31A 4ZZ3A 1B14A 2FWJA 1EDDA 4BNGA 4F46A 4YRIA 3Q0TA 4RO0A 4MW9A 5EHQA 3FUTA 1CFJA 4ZDJA 1V9LA 2B9VA 4WKOA 1GNVA 5FTKA 3EVAA 5TQJA 1C8BA 2A2ZA 3N28A 2WMOB 4RACA 4NV3A 3CVXA 1PIWA 1ULZA 1L5LA 3PUKA 3S2ZA 1CUHA 2PZ8A 2I07B 4MRMB 1G5HA 3E3OA 4GI5A 4RHXA 5JSZA 3NORA 4B3JA 3W6NA 5JSZB 3EGEA 4ZKDA 1D2CA 3ZQ4A 2ZTSA 1E3DA 1Z5OA 2JFGA 2VYCA 2WE7A 1T2VA 5JZMA 2JIQA 1T6ZA 4RL4A 1ZCJA 4EY6A 5EJ9A 1NZJA 3HXPA 1BA2A 2KBEA 3B52X 3TZCA 4ZZ0A 3GEBA 4Y2TA 4JYMA 4HGQA 3U4AA 5DHTA 3W9BA 4NYIR 1YZHA 4BZXA 3DBVO 5BYKA 3HH8A 4JMLA 4A0HA 3I1IA 3OWXA 1TCVA 3Q9UA 3UAZA 3QBTA 4PVCA 3UCEA 4W9NA 1LRKA 2X7HA 3UPDA 4CDMA 2OXCA 2JI9A 3ZY6A 4EUNA 1L4YA 1FS5A 1PZXA 3T1NA 4P22A 3DFFA 4TT3A 1G59A 2XAAA 1CNEA 2V97A 4I1OA 3TQRA 1ZBQA 1WTAA 3QXSA 1WP4A 4P7FA 4QUAA 4M2LA 4GXRA 3RJTA 4XRRA 3Q8KA 3ZY4A 4WLEA 3TQHA 2XYRA 2FZEA 3PUYA 4L8YA 2D2EA 2X4GA 3KRTA 3MBIA 2WP0A 2IU4A 2DC1A 3C5VA 1XLUA 1Z4NA 3C45A 1COWD 4RV5A 4QO7A 2WEKA 4Q4CA 5IU6A 2Y2VA 3FPCA 4LWPA 2P6MA 3JAKA 5CGQB 1T0HB 2D1FA 3LGAA 4F7DA 5KJ6A 5TXGA 3JAKB 2XZTA 1E1MA 2X6QA 3JAMA 4HX9A 4GQBA 1N1MA 5CK5A 5CXQA 1O0CA 2OV2A 2DWPA 1QCCA 4PSAA 3CNLA 1J99A 1TYCA 3NYWA 3OX1A 3KR1A 1AUVA 4FGLA 4DVJA 5KYKA 1E9CA 3PXGA 1RAAA 1CQJA 1LSSA 3DO5A 4FFBA 1NMZA 4XQCA 4IUBS 3KHUA 1CQJB 3AF2A 5EUBA 3H18A 3ZV6A 3NNSA 4FFBB 3UJ7A 2FCAA 4C43A 1WUYA 3LY9A 1YD7A 3JQGB 3PI6A 5JAHA 4MKRA 4KC0A 2WSIA 4UAGA 3J80A 2DMRA 5JMPA 1R9NA 2A3RA 2BLNA 3KXDA 3R0VA 4GWLA 3MHPA 1IU9A 1LQ2A 4KXNA 2F17A 3T7CA 1MEEA 5JS1A 4KBYA 4ZI5A 1QIJA 3GYBA 4YAKA 1R4AA 4QTTB 3NASA 4RY8A 1USGA 3O1JC 1EFLA 1P0FA 1XZEA 4TTVA 3T38A 1VPWA 4G2TA 2CMHA 4YPOA 3Q8MA 1TE2A 2XJ4A 3FH0A 3OEHA 2YY5A 1J33A 1EK5A 2XMQA 2Y4NA 4JASB 4W7IA 1C0LA 5DTIA 1E79D 4D25A 1KVUA 1Q92A 4NEHB 3ZVMA 1QU3A 3ETDA 2QVLA 1AMUA 4WZAE 3K1YA 4S05A 4IYJA 3EEBA 5JXGA 3MJTA 3IBGA 3NMUF 4BWGA 3MLEA 3S1AA 1TA0A 1QG2A 4GP6A 2XWPA 4GUDA 5AW9A 1Z15A 3S1AB 4YT4A 7ADHA 4GI2A 3IQHX 3TR0A 2HV9A 1NM5C 4B7CA 3SK0A 2G71A 4DNQA 1R8QA 2ODAA 2O1XA 4C3ZA 2EJWA 4KSYA 1TTPB 2PXCA 1NSTA 5AI4A 1U3WA 1J00A 1D7AA 1VM8A 3PPWA 1SEPA 4RKYA 5T3UA 1F8XA 1LWOA 1V5FA 3AETA 3DW3X 4NU6A 4OGLA 4FR2A 3DB1A 3JWGA 3WRVA 4DIUA 1NSFA 3AETB 3K32A 3H2SA 4R3NA 3TZHA 4TTJA 1QM5A 4MDFA 3BE4A 3EBOA 2QN7A 5D3ZA 2YWBA 3C39A 5LA6F 1GL3A 2MIIA 1M9NA 1K3TA 3S27A 4B5KA 3GD7A 5KYNA 1YRBA 2AQKA 4DE5A 1QE3A 5JXHA 4YLEA 4BFCA 3U3MA 2A0WA 3O9ZA 2Y0PA 3FNIA 4L5AA 5E6UA 4F3NA 5FPHA 4GZ3A 5FHQA 3STYA 5E6UB 4YT8A 4OU5A 1ZMRA 2YY7A 4YTEA 1CJCA 4G8CA 4PFJA 3NHSA 4YO7A 3CRW1 1ML4A 4O4IF 2OCKA 2E85A 2XGMA 3K5HA 1KY4A 2A7QA 3RBZA 4E30A 1JI3A 3MUFA 4LW8A 5FORA 3ESZA 3ZWPA 1J0BA 2YINC 1KERA 4MHSA 1P29A 5LU9A 1X13A 5IDYA 4ZHQF 1W49A 1ZK1A 1JPJA 1Y80A 2E4UA 2VJBA 4YP1A 3DCIA 1NU8A 1Q20A 1SOAA 1L5FA 3G0GA 1Z28A 5FUWA 3VC2A 4CM6A 1R0CA 1KFCB 3TN7A 4LC0A 4ZVTA 4HUJA 2GEDA 4EPTA 3CY6A 1TGVA 1XQYA 3DLHA 3ZJ4A 3RSOA 5DYIA 1KY3A 4JR2A 3ZU5A 3A1VA 1KOFA 4ZEWA 2C84A 4BMYA 4V24A 3AHCA 5GQSA 5CVCA 2PGNA 4ITRC 3M34A 4TL9A 1ZC4A 2IIBA 2X9LA 2G28A 4Z9BA 4XARA 5BQOA 5I7FA 1P9RA 2HL6A 2P8SA 1Q5PA 3OQ6A 4NYMR 1C50A 5KOHA 1ISSA 1GPUA 2OPHA 5KOHB 3CU5A 1XZQA 3UCXA 1X0XA 1Q0SA 3RQIA 2ZWIA 4CMAA 2FTKE 1XRQA 1X7YA 1EYZA 4G97A 5AUPB 1U3CA 2COEA 2QQGA 2B99A 1X7YB 1IN5A 2VQDA 4LHXA 4LNVA 3CF2A 1NMQA 4G37A 4URVR 5IFKA 2ETXA 2OL4A 4HX5A 4HB3A 2WG1A 4LGYA 4CLRA 2YVLA 4WKCA 4CLRB 2VRCD 4MCHA 4W5RA 3I5XA 5HBGA 3ZQKA 2YWXA 4BVBA 1I32A 3I6MA 4OHFA 2FA9A 1TM4E 5LNK6 4ADSG 1O94D 4GGMX 1SUPA 4JFAA 5F64A 4DLLA 5KTOA 3IO3A 5HMMA 1YQXA 3KQWA 1II9A 2GERA 1M34A 2BBTA 4BATA 1M34B 5KYUA 3FCOA 3RV3A 5KYUB 4EAQA 5JRJA 1U0FA 3M6IA 3MS2A 3I04A 2HM7A 2Z2JA 5A4FS 2QRPA 5HQTA 1NHGA 2IU3A 5JNVA 3AEUB 4Z7OB 3IIKA 4L7QA 1GPDG 2VTEA 5BSTA 4BNYA 4JWTA 1W5EA 2OB1A 3DE0X 4FFMA 1LRJA 4QBFA 4G07A 4DJ5X 1BRTA 5KTPA 3DONA 4IILA 1WR8A 3KOYA 2LUOA 5IAEA 2CEAA 2GTPA 1HZJA 1GWNA 1VSUA 1G4UR 3UYKA 2X40A 2PGXA 3OECA 2W0SA 1NUQA 2R7KA 3KSUA 5IHPA 2CHUA 1UM8A 3SXUA 1L4KA 2EQBA 1ULBA 1MO4A 1K66A 1OFTA 2AOTA 3SXUB 1O5TA 4DMGA 3JZAA 4EL0A 2AOTB 4CFZA 4TLLB 1CRWG 5FFFA 3MMNA 1NW7A 2B78A 3IRVA 5UKDA 2BR3A 3RROA 4ARCA 2IS2A 2XAUA 2H65A 1DMRA 1V1MA 2MSWA 4QLBA 2XQIA 3R40A 3OCVA 1V1MB 3COSA 1JF8A 3KJXA 3WK6A 1VDMA 1A8QA 1VYTA 4UAJA 3BGOS 4WX2B 2FMXA 3OLWA 2ECPA 4AJLA 4BWVA 3A05A 3FTDA 4FX5A 4HLDA 1GZDA 1LU9A 3FVRA 3C14C 4EJSA 5HJ5A 1OC2A 4EJSB 1GPWB 4QXRA 2GXUA 1YE8A 1QLJA 1C7FA 3TVTA 1M1YE 3VOAA 4HVTA 4PYMA 3OUTA 2P5YA 2Q5OA 3AEXA 3VZCA 3VZSA 1L7XA 2VHCA 3HLTA 4NCBA 3BSSA 3ON5A 3HO1A 1H5UA 1WUTA 1F4VA 4GC5A 2WOOA 4F4HA 1JE0A 2AZXA 4KJZA 2JFHA 1PFUA 2X7XA 2WMYA 4DSOA 3OO0A 2PR7A 5IC6A 3ESDA 3C3CA 4DBLE 3A3PA 3OU7A 2VHYA 1KZ1A 2EL9A 2Y8EA 2YZGA 4FFWA 4WLFA 2QXUA 3HACA 4HNRA 1ZMOA 3Q7RA 3TSWA 3ZIAA 3JZFA 4KNYA 1GPMA 5ALUA 3DL0A 3F3YA 3TGWA 2V03A 2ZAMA 2GD2A 3MWJA 3R4CA 2QYTA 3ZWNA 3JQ9C 2AC7A 2LRHA 1L6RA 3JD3A 2XDAA 3FDIA 5D2CA 3Q9NA 2YR0A 1GU7A 3DYBA 2GAAA 3EMVA 1FNMA 3OQIA 3T35A 4E5UA 1GNTA 4DLAA 5C5CA 3OQIB 1NAIA 2BR4A 3QLUC 3V1KA 1G7TA 3L02A 2B5WA 2CNKA 1HR0B 2IDZA 1X9HA 2W71A 3FD8A 4EA6A 3SNKA 2N1BA 1EAMA 5KKAA 3I9OA 5ALQA 4FUQA 4ARZA 1ZA2A 4TRRA 4JGBA 3HJUA 1BS1A 3KQVA 4ARZB 2JHAA 4FBGA 2IV2X 4CU5A 3I5YA 3RTDA 3A2NA 1GAJA 1GUZA 4WA8A 3ZQUA 1LCIA 3LLSA 5AJYA 3HP1A 1O57A 1R10A 1F0NA 2IX9A 3EZYA 4QUGA 3WDLA 2WILA 3VC7A 3ZPXA 1JMYA 3H1PA 4K6MA 5AIBA 3U1VA 3EVBA 4PLGA 1SK8A 2OM6A 3BBLA 2BJHA 1JVDA 3P2YA 2NU8A 2BRUA 5I7WA 1Z7EA 2NU8B 6YASA 3A9UA 4TS9A 5B2EA 2E55A 1PDWA 3VSDA 3NW9A 4EATA 4IIJA 1E1QD 1W4RA 3RT7A 5I3CA 2J6IA 1ZW1A 4IIJB 5KJCA 5C53B 3EPLA 4N7MA 2QTVA 1FUUA 4GPZA 1NRJB 1C9NA 3VGJA 4EB6A 5AVUA 1OH7A 1VG8A 2QTVB 3AOEA 4EB6B 4RTNA 3HVKA 1F9AA 1BGVA 2Q2QA 2YY6A 4I55A 4XDYA 1A72A 4YIKA 5A6SA 3UMYA 1E98A 4I55B 2PZBA 1SOWA 3KEQA 3EXHC 2DWCA 5A6SB 4P4TA 1XEWY 2CYBA 2B2CA 2P9HA 2W2QA 4NDZA 3UT0A 2PX5A 3GMTA 3V34A 3ZWCA 3SZOA 4QC2A 3PZBA 1PK8A 4K6FA 1F3OA 4WW0A 3PQ7A 1QGYA 1YU6A 3JQFC 3GZJA 2XKJE 3K4HA 1CEXA 1PK7A 6AT1A 4KR9A 3CLUC 3ADPA 3MM4A 3WHIA 5A3QA 1Y1SA 1GARA 3IVRA 4MPTA 3O90A 2VR1A 2BGRA 3I01A 1N6NA 4JJAA 3V33A 4ALKA 4DM7A 4IRUB 3LT2A 1G8AA 3TSOA 1UBNA 2AJBA 1OXMA 1VHWA 3G3EA 4PPYA 2O7RA 4A8JC 1DVRA 5K0ZA 2IW3A 1H0SA 2WYWA 1HSOA 2PM8A 3BMCA 1P1IA 1VJ1A 2COKA 4TXJA 1U0GA 5CU7A 5KSZA 4JBLA 4KVZA 1RI2A 2BGLA 3L7YA 4XTCS 2UYQA 2OC4A 3AKCA 4IXDA 2V96A 3W4IA 2R2AA 1L8XA 4LXQA 3EWSA 3ETHA 5FR2A 1MZVA 4EFNA 1F17A 4FMPA 3AUKA 2P30A 4P32A 2XZPA 1E94E 1U8EA 3D02A 1FVHA 1HQKA 2EEZA 2JGEA 5FBLB 3W90A 8MHTA 5DWDA 2J67A 4XOUA 3ZTYA 1ABEA 5DWVA 1TO2E 2F3QA 2N3ZA 3DO8A 1CTQA 4K9KA 4PQFA 3UWMA 2D5AA 2O8BA 5KDLA 1RWKA 2J6BA 2FUCA 1KOLA 1KXJA 3NDPA 4EPRA 1H4VB 2EIXA 4RLSA 3QPCA 5C35A 4EHIA 3GVPA 2GUWA 1Q7EA 4EW2A 4BGUA 4PAQA 4F2DA 1MA0A 2G0NA 3K2QA 4D97A 2HMVA 1IN8A 3HXKA 4LXTA 2E5LB 3SQWA 3PFWO 3KU1A 1M83A 4R9RA 3OPVA 4HS4A 3P9YA 2X5NA 4OXKA 3IP3A 4AZWA 3CLTC 3HN2A 4CPDA 5FFNA 2MSKA 5AJVB 4KRXA 3TRDA 1E9SA 3EQ7A 4A0RA 4P3OA 2CWDA 3KPJA 5AR1A 4ZZ1A 5JNSA 1IBCA 2B2XA 2BELA 2BFFA 5DNYB 2TRSB 1D4OA 3CKKA 4ZU6X 1BH6A 2E6UX 2BFFB 1KC1A 1GSHA 2PKCA 4IGAA 4L07A 2IF0A 3BB1A 3FXAA 4P58A 5KVAA 3SYKA 3NCTA 4TOIA 2C3PA 2BZSA 2X42A 1LSJA 2G9QA 3WFIA 2YXNA 3OH8A 1ID8A 4IJ5A 1O96A 1TL7C 2WZDA 1EJ6A 3AUAA 2Z2YA 3VR4H 1O96B 4UU1A 3MTIA 2RHBA 3AJAA 4MX8A 4BMOB 3QVTA 3AFOA 1QRAA 2L82A 2OBFA 3LXMA 3KVVA 1GPAA 2O0HA 3B7WA 4Q1BA 2FEKA 4LJSA 3AVOA 2LVBA 5CLJA 4HRVA 4I0WB 4NU0A 1I13A 2FUKA 2GZSA 1HZZC 2CF6A 3B3QA 3EZLA 1EUDA 2HDNB 2QR3A 1JFFA 1NQUA 5FO9B 1EUDB 3JQ6A 2GBLC 1JFFB 4XASA 3S44A 1PHRA 1YVPA 5BQPA 3VR2A 2JFNA 3RSFA 5ENDA 1S0UA 4MV7A 4QBGB 5IUNC 2O8CA 2G4LA 1EUZA 5CDGA 2O8CB 2XMZA 4R68A 1L8OA 2C1EA 3G49A 4RHEA 3PD0A 2R79A 5JTWA 2IEBA 2B6HA 5AOVA 3LBIA 3SP1A 3BJEA 3IVMA 4INZA 4BNZA 5JI2E 4DF3A 1R18A 1Y3AA 5BW5A 5K0CA 1L9KA 2OAP1 3ROMA 3D5QA 3R9KA 3ZW8A 1E6MA 1KMMA 3OD1A 4YWJA 1J9EA 1JWAB 3O4IA 4K03A 3D9QX 3N0XA 3RSCA 4CIVA 5K03A 4ENTA 2WABA 2BEVA 1CRLA 1UK9A 2BEVB 3B1ZA 5B1HA 1K8RA 3QFCA 4B4VA 2C98A 1VRCA 4Q15A 5FTJA 4DC1A 5EXDA 3HCFA 1TMGE 4ZK2A 1P75A 2I6GA 3L7KA 1R00A 5JYDA 4XM2A 2PH7A 4JC4A 1MAWA 2MSCB 4HRXA 4YX9A 2W4QA 3QTBA 2WF6A 1VCIA 1XCJA 3ML1A 3O2JA 4R2KA 5D00A 5EI5A 3RYFA 4CMKA 4CR6A 4DDMA 3RYFB 3SM9A 4R7TA 2VUTA 3VRHA 3K9WA 1B0ZA 4F85A 1X74A 2P40A 2QD4A 2GVNA 4Q1VA 3OO1A 3C43A 3QIVA 4ZVPA 2HCTA 2D54A 3PVZA 5CNJA 1QV9A 1XR3A 1VJDA 1SKYE 3DFMA 4F1WA 2EKDA 4PC2A 1RACA 1SU8A 2HSGA 3D6JA 2K87A 1RWNA 3P1JA 4XQEA 4ENPA 3RAFC 4EO7A 3EY4A 2XVYA 1T2UA 3CLRD 3KZXA 2C9ZA 4E4TA 4B32A 1S4QA 1Y5RA 4LJ8A 4OUKX 4ESOA 4KZPA 1UDXA 4Z4CA 4TV9F 4RTPA 1ZBDA 2GEBA 3BMXA 4AKEA 3OSUA 2ZRPA 1P0IA 4K81B 3FGZA 1IWPB 5FBWB 4PYJA 5C1DA 3FNBA 1K9VF 1I4EB 4GD3Q 3EGVA 1F2TA 4AJIA 2VDVE 1IOVA 3CE6A 1F2TB 1GNSA 3DD5A 3LWBA 1V5GA 4HXFB 1Y8RA 1NXSA 3U49A 1Y8RB 3E3NA 3ZKWA 1HLPA 2ABWA 1EU1A 1JJBA 4KLZA 2D0DA 3ZKWB 4H3KB 4IGIA 2I2AA 2OXRA 5D5QA 1SK9A 2JBWA 3JQBC 3QSGA 3C3YA 4Z8YA 4N5HX 3MCZA 4IZIA 3IL2A 1VCNA 1J8MF 1TZJA 1CP2A 2DP4E 3BB4A 4DV1B 2ODWA 4BQSA 3BXFA 1EPUA 3CUTA 3F8WA 3N05A 1YMQA 2X14A 3T06B 3UVEA 2Z9DA 4Q34A 1T8TA 4LMAA 1JEQB 2NXNA 3OZFA 5FI3A 2ZCVA 2C42A 5LR6A 3N59A 3BAZA 4LDJA 1WUKS 2ZWVA 1U9JA 1Y3FE 3WY9A 4CU2A 5TEWA 3CBQA 4L74A 4QPJC 4GO1A 3V4FA 2NO6A 3D2AA 5DNAA 3RT9A 3P52A 5DASA 3QBEA 3O92A 3B6MA 4PBTA 2DETA 1Q7BA 2LKDA 13PKA 2OVFA 1RP1A 1IN6A 3A4IA 3NONA 3BSWA 5IDWA 5GADl 4N7RA 4UM9B 4CKWA 2FMTA 3IEPA 3IQWA 3QMPA 5C5IA 5GWXA 4CKWB 5KWVA 5FLKA 521PA 5CA0A 2I62A 4CLEA 2OLEA 3TEJA 1M2JA 5CAEA 4P0PB 3A9VA 5PNTA 5CA0B 1L9XA 4DM3A 1GCUA 5CAEB 3I5MA 1SB8A 3EGXA 5HUQA 2PRZA 4YJFA 3ZHCA 4DQLA 2YMQA 5T4FA 1HG0A 4YJFB 4D74A 4DDVA 4X3PA 4RD6A 1WIWA 1QZZA 2HGZA 2P9JA 3V9PA 2V7PA 2WICA 1RPJA 3QXJA 5C2JB 1T10A 3PEYA 3H9JA 1PZMA 1LH0A 1XXLA 2NTEA 1QVVA 3CEHA 3NKLA 4ZVNA 4B2IA 4FFRA 3F1LA 3NHLA 4MVYA 3RRJA 1W59A 1MDFA 1SD1A 4O4HA 3VZRA 1YCDA 4YACA 3ZGXA 2WJWA 4O4HB 1WSBA 1Q0ZA 5H9VA 1VG0B 1GYQA 3ZXSA 5JS6A 2NUPA 3AY0A 4I6EA 4PSUA 2NP6A 3UG6A 1WF6A 2NUPB 1ZXXA 3WWDA 4MJ3A 1E2EA 4NMHA 2H1IA 4QUJA 1M3SA 1P7YA 4RTQA 5K01A 2RHMA 1RHRA 4UD2A 3EEOA 4MW5A 4XVHA 1K6XA 1Z0IA 3L1VA 4N1AA 4ZCPA 3HZZA 2GXSA 3ANSA 5JADA 2VHUA 5KKNB 4F11A 2CKMA 2R4TA 2V7WA 2X2EA 2I76A 4RTRA 1J9GA 3BCSA 1DJOA 3MWFA 1ORWA 3RIGA 4FIZA 5LIPA 3F73A 1B6TA 1K27A 1KSFX 3PCTA 1IJFA 1AS0A 1P2BA 1EX7A 2BKUA 3O74A 1ODCA 1GYRA 2IF2A 3B9BA 4KKXB 3VDMA 4JB8A 2A4MA 3ZW7A 1PSDA 2NVOA 3AOGA 2Q3LA 3I6QA 3KLOA 5J4VA 8OHMA 2IH5A 4JXZA 4CG1A 4X20A 3ORQA 1KWKA 2ZR0A 3GT7A 1RXVA 4KIJA 1JYFA 4X20B 2FW6A 5JJ5A 3ORHA 3Q88A 4AZSA 1W52X 3FRHA 4IQ4A 2PLAA 1T4DA 1XZNA 2ZWPA 2G0TA 4N3BA 5B36A 1QKIA 4ZARA 1JUDA 4NAUA 1YXMA 3UT6A 1O6CA 1IG3A 3OLZA 3LC1O 3REFA 4FGUA 4JVLA 1QONA 1F7VA 4RA6A 1R6AA 4M9SA 5BN3A 5HA5A 3LVRE