3BZEA

The human non-classical major histocompatibility complex molecule hla-e
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
273
structure length
273
Chain Sequence
SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Subtle changes in peptide conformation profoundly affect recognition of the non-classical MHC class I molecule HLA-E by the CD94-NKG2 natural killer cell receptors
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 273
sequence length 273
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bzeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bzeA01
1S7WB 4YGVB 4KTDL 4XNQA 4MD0B 2IBGA 4N9GB 4IJ3C 2V17H 5E8PB 1DBJL 1LO4L 3N1PC 1C16A 15C8L 2PYEA 1S8DB 4NQED 2BVUA 8FABA 1G9EA 3C5JB 4XT1C 2Q3ZA 4RFNC 6FABH 5D2NA 4N0CD 3TEUA 2PO6A 1AFVL 4P2QB 2Q8AH 4OI8A 4YGVA 4MD0A 4N9GA 2XTJC 3C5SA 5E8PA 2BDNL 1B2WH 4LSTH 3CZFA 5JR1H 1S8DA 5I2IB 1OAKL 1H15A 2H1PL 2QLVB 3C5JA 5HGBA 3VGDA 4ZUUB 3DUUA 1AC6A 3MV8D 1S9VB 5TFSH 4PJGB 1VEOA 4LSVL 3DSFL 1NC2A 2FEEI 2J4WL 2VR4A 1Y0LB 1LK2A 2CKBH 2HJKA 3MRPB 1V7ML 5IVXE 2Q20A 1R5IA 4WUUD 4Q9RH 4NN7B 2VDPL 1T1WA 3B8SA 4K8RC 5DDHA 3NA4A 4JM2A 1LDPH 5CHNA 4P2OB 4KTEH 3MRPA 5DUBB 3HC0B 1JWMB 3GB7B 3MJ7B 4PJEE 2GAZB 4X7DC 4XNUH 5BRZB 1MCHA 1CN4A 1F3JB 1G7JB 1OLLA 4Y5YC 1RUKL 2AJXL 3U48A 1MRFH 35C8H 4LSUH 3FJTA 4G6FB 4XWGH 4KRPD 4POZC 4FQ1H 1H9VA 1IKNC 3G5VA 3HC0A 3GB7A 4WFGD 3MJ7A 5J13C 4XMPH 3FN9A 2GAZA 3QUMA 4YHKH 4OGXH 5AUMA 2MWCA 4JO2H 1F3JA 2P47B 1CI5A 3RRQA 1OT2A 3BPNB 1QKZH 3AS2A 4XVJH 1UC6A 3N1FC 4AENB 3X14A 5IROA 1BWWA 4QRQB 1JGEA 3GUTA 3MODH 1QO3B 2G75B 4ZFGH 1PEWA 1VGKB 4L8DB 2DIAA 5CSZA 1QPXA 2E7CA 2M2DA 1F90L 3P4OB 4O9HL 4QRQA 4DK3A 1D9KA 2X1XR 2GJJA 2G75A 3OR6B 1W0VB 1XGUB 4XNYL 4OD2B 1VGKA 4L8DA 1Q0YH 2FR4A 1QFHA 2X1QA 3EZJB 4DZ8B 1R5WB 1YDPA 5ESVB 5SWZD 1HCFX 2HA1A 4EN3A 4YIQA 2XZAL 5I1EL 5EOQH 3IF1B 4UUJA 4HGWA 3QIBA 3OR6A 2WNGA 1NC2D 1XGUA 4JZJA 5F1NB 2H32B 4TUOA 2OSLA 1A1OA 1R5WA 1W8NA 2YPLB 4W6YB 5ESVA 4DZ8A 3I85A 5DD6A 3LB6D 1OHQA 3VCLB 3OAZK 4JR9L 3DXAD 4YDJB 1RHFA 3IF1A 1A9EB 1D6VL 2HAZA 2GTZB 4QHNA 1YJDL 5F1NA 5T3ZD 5AZEL 3CXHK 2JB6A 5HDBF 1BQHG 4MS8D 2CLZB 1KJVB 4LCYA 3EOTL 4NKIL 3OJ2C 2UUDK 4YJZL 4PTTA 5I1JH 2QSCH 4F7PB 3EO1B 4PGZA 2GTZA 2EDYA 3IFLH 5DUMH 4PLOB 2ID5A 4KKLD 3PV6B 4UB0L 1KJVA 2VITA 1X5LA 4NM8L 1GZQA 4I18C 1F00I 1QRNB 3FQNB 3MYJA 3BJ91 3C5ZD 3EO1A 4L9LC 4OKDA 1DQDL 3HI6L 1DQMH 1SMAA 2HVKA 3HE7C 5FM5M 5B22A 5CGYD 3BWAA 3QDMA 2C5DC 1F6LL 5DA4A 3ULVE 2A6DA 4FA8A 1DBBH 2C1PB 3FQNA 4EVNB 1OM3H 4XMKL 1XCQB 2FGWL 1KJ3L 4CVXA 4PRDB 5T3ZL 4KQ3L 4M1GL 4Z7VE 1T6WA 2O5ZL 1P1ZB 3ULUH 2P8LB 3WCYA 1XCQA 2Z4QB 1K8IA 2XN9E 1EJOH 4PRDA 2DLGA 5FUOL 1TPXC 1JUFB 2Q6WA 1A4KB 3VXMD 3MBEB 2W9DL 1P6FA 1FN4B 2C4XA 3BP4A 4Y1AE 3T1FB 3QQ3A 5DQDH 2P8LA 3RWDA 4PFEA 2Z4QA 5EBLA 2R4SL 4RAVA 4WTZA 3QIBD 1YEFH 3TO4C 2YUVA 1JNNL 1X9QA 4Y4FA 2AV1B 3HG1E 4U3CA 4HXBH 1JUFA 4FZ8L 1A4KA 2D0FA 3MBEA 1FN4A 4Z7WB 1BVKA 2NZ9D 5L6YH 4RGND 4ZNEA 3C6LC 4FG6D 2FNBA 1YPZF 2YBRB 4ZDHB 4MB3A 2FECI 5EA0H 1UZ8A 2GQHA 4ZS6C 4Z7WA 4DTGL 2FH6A 4ERSH 5EU6D 4ZFFA 3T1WA 4HBCL 4GKNB 4MCZB 2JJUA 4ZDHA 4GUPB 5HHPA 3REWB 1MEXH 4KHTH 4HIJB 3QWQB 4YR6A 4B7IA 1OF2A 1VPOL 1ZOXA 3EJJX 1CFNA 3MXWL 4FQIH 3HI1A 4DUVA 2X4TB 4K3DL 1R0AL 1CK0L 2HMID 3QPQC 2R8SH 2WWMC 5DRNA 4XGZB 4GUPA 3REWA 1IMHC 3RTQD 4FXLA 5ECJE 5DZLA 1WIPA 3CH1B 1EFXD 5D2LB 3QIUC 3IDIB 4NZUL 3OZ9L 2J8OA 4LSQH 2BOBA 2A77H 3HAEG 4PRNA 4OGYH 4XGZA 1CS6A 1UKQA 1BGXH 5D2LA 2BNQB 3WHXA 5E00B 3BVNB 5EC1A 3A6BL 4WENB 4M93C 3D0VA 4NZRL 1BD2D 4OFKA 3OGCB 2WINA 3RJQB 1DANU 2FB4H 2NY4C 4Y5YA 3TH3T 1WFTA 4KJQC 2VDQH 3PWUB 4KRMB 4YDVA 3GMNA 2P42B 4ZXBB 1IKNA 2YN5A 1FYHB 3ZE2E 5FYJE 1N59A 1MREL 5DMGD 1UWGH 3C08H 3DO7A 4O2EA 3FAWA 2I9TA 4Y4FD 4L8CA 3GK8H 3ERYA 4JANB 1OAXH 1KPRB 1MCEA 1GJIA 3PWUA 4PS4H 4DAGH 3KNBB 1JZ4A 1Y6MR 4V1DB 4ZXBA 4HT1L 3O6KH 4X9HA 2CGRH 5BCAA 4Z7NE 4UZGA 2EO9A 2UWEE 3QRGL 4KVNL 1KPRA 3KNBA 4V1DA 1J05A 1VFBB 5BQ7B 3HCVA 3QUYC 3U2SB 3UBXG 3MOQA 3MCG1 1I8MA 2CR6A 3RJDA 3PQYD 1ZWIB 1IGIH 1A2YB 2XTJD 1JE6A 4BK4A 4JFPA 1UWXK 4MSWA 3V6ZB 3VH8G 1PEZA 2YPVH 2HT4D 5BQ7A 3WLWD 4U0RC 1LMKA 4ZPVB 2CXKA 4WDIA 2VLMD 3MACH 2EYSB 3HHRB 7FABH 4PB9H 1CTNA 2VLJE 3GSNL 5H35A 3C8DA 3QI9C 4AQ1B 3FAXA 4OCXH 3B6SB 2CJUH 1IT9L 1OARL 1TQBC 1FO0A 4G5ZL 3T2QA 1RUQL 1UKSA 3G5ZB 5DT1L 5JO5B 5FCSH 2OJEB 3WKNA 4K8RD 1BVZA 3SDXF 4XVUC 1BEYH 4PUBL 2GEEA 4OF0A 3W0WE 4XBGB 5C0AD 1F02I 1F4XH 4M03A 3C2AH 3G5ZA 2XY2A 5JO5A 3WIFA 2YN3A 5TQ2H 2OJEA 4FQJL 4I3RL 2CIIA 1T7ZA 4HX1B 2XZCL 4OZFB 4XVTH 5GJTH 1UQSB 3MLRL 4XBGA 3D69B 3GIVB 5C0CE 1RHHB 4HWZB 2E27L 4KJYB 5I8CB 4I18A 1HXMB 3MLZL 2F9BT 2IPTL 4PRPB 4GRWB 4ZD3L 1YUHB 3ALPA 4P0DA 4L9LA 3I3DA 3O4LE 3OV6A 1XZ0B 2V7HB 2DAVA 4APQC 4HX1A 3L5XL 4BQ9A 4UAOC 3D69A 2BSRA 3GIVA 2DI9A 4HWZA 4HS8L 5T5NG 3MLSL 3JV0A 4ZTPH 4KJYA 1P7QB 4FFWC 4BH8A 5I8CA 2Q1EA 1HXMA 4JKMA 4HSQA 4PRPA 3O41B 4PJHE 1T7VA 3U7AA 5IESL 2V7HA 4GMSL 3K74B 1UKTA 5MEPB 4JFQA 5I16A 4N8PA 1NJ9B 3A6CL 2ADFL 2X7LB 3DJ9A 1P7QA 5ISZA 4S1RL 4OZGB 4M1DH 3O41A 5DHVB 1FPTH 4R0LC 3PL6B 4FFZH 5D96C 1NGZB 1LEIB 1DVFC 1CDUA 4D0DA 5LQBL 5MEPA 5A1AA 1NJ9A 3MRKB 3QFJE 4H8WH 1NANI 5E2TH 1T03L 1R3IH 1OCWH 4OZGA 2HFGH 5F9JB 2DQUL 5DHVA 4H1LB 1NGZA 1YMMA 5LCVH 3Q1SH 1S78D 2MKWA 3QDJD 4WY7L 3MRKA 2AJSL 2LFGA 4HJ0D 1T6VN 3KGRA 3C6LA 1JHTB 1XH3B 1OGAD 2PNDA 3OB8A 5E8OB 4PJIB 3FQRB 3PG2A 4KI5D 1XR9A 3PHSA 1RZFH 2XI9A 1KC5H 3RVTC 4DW2H 1RFDL 2Y36H 1JHTA 1XH3A 2ERJC 1GC1L 4I2XB 3N1GC 1BREA 2J7LA 1CCZA 3NIDF 3PDDA 4PJIA 1G7QA 4UQ3B 5CEZH 3CX5J 1RK1A 3D5OF 3P9WB 2H32H 2P44B 3VXOB 5MENB 4U6XA 1D5MB 1IQWL 1QVOA 1U91A 2AJ3B 2KZWA 1KYOJ 3DGGA 4HK3N 4JG1H 5HGDB 2OYPA 3HE7D 3BUTA 3FOMA 2ORBL 5TF0A 1GGBL 4UQ3A 5EBGA 4JDZB 4NBXB 1GCFA 1MCKA 5DZOA 3QRFM 1FGNL 4HAFA 1KCVH 5JW3L 1IEAA 4HS3B 3VXOA 1Q38A 2Z35A 2AJ3A 5L88L 5HGDA 5J12B 2ZP0T 2NY4B 2ZUYA 3MRMA 2JCCB 1RUAH 1NBQA 4JDZA 3AVEA 1ZGLB 5ISZD 4MNGE 3MRLA 2F5BL 3JSSA 1CGSL 1ITCA 4R4BB 1N6UA 4ZFOB 3OKMB 3O6LL 2XQBH 1IAII 2JCCA 2ED9A 1Z3GL 1FVCB 1NCNA 5JNYB 1ZGLA 1S9WB 2RB8A 1DLHA 2APBA 3G9VA 3QNXB 4L3EE 1G0YR 4R4BA 4X8XA 2NX5B 3TO4D 4ZFOA 3OKMA 1PZ5A 3PGDB 3VFOB 4YHYB 2AK4B 5M95B 1TTUA 4L4VE 4HJJH 4HD9A 3P9LA 5JNYA 4X83A 1S9WA 2WIIB 1UADC 3R4DA 2MCG1 3QNXA 1V3JA 3FZUC 3RIAK 4KKAC 2GUOB 2VABB 5D7IE 5GSVB 3RPIB 2VQUA 3TT3H 2YPKA 5F97E 2D0GA 3RI5F 4G80B 5JPNA 1HINH 4F15C 4WW1A 4KV5F 4JO4L 2APXA 3OB0H 1U8MA 1NKRA 4UDTB 4R4FH 4YFEA 1FG9C 4U6HB 5FYKD 1JNJA 4NQEE 2VABA 4HLZG 1JGLH 3O6FC 3GIZH 1BJ1J 1KACB 4G80A 2YHGA 1JI1A 3KPMB 4JFFD 3LEXB 4YFDB 3PF2A 1YNKL 5IQ7H 2NCMA 4NN5C 2R69L 3LPWA 3UYPA 3EDDA 3AY4C 3MRDA 4U6HA 3EKCA 3RUGB 3N9GL 2WWMD 1XF2B 1A7OH 3QP3A 3QI9A 3MV8E 4LIQH 3QIUD 3LEXA 3NFNB 4P2RB 3WFEH 1TCMA 3FO0L 2ADIB 2Y07H 4WUKH 2J6EL 1IAOA 1MRDL 4WFHE 3KPTA 4P59L 3RUGA 1JTPA 5IFJA 4UI2A 1XF2A 5GGRB 1U0QA 2W9LA 3EYSL 4GXUN 4WUUE 3UTSE 1NMAL 3NFNA 1NFDF 4P2RA 2OR9H 4HGKC 2ADIA 4PJ8B 5DVLA 4EUPG 2QADB 1PG7X 3NACL 3JWOC 2YZ8A 5FYKL 1IQDB 5SX5K 5GGSB 4XNXH 3J8F7 2ZCHH 4OFYD 3FQXA 5IJVA 3L3OB 4KJQD 4LHUD 4U2YA 1U8PB 3ZSSA 4MHHI 4M7LT 5BVPL 4TTGA 4G8GB 4PJEF 2B39A 1GYAA 2ZKHH 2J8UE 3NCEB 1IILE 2CDFB 2ICWA 3P30H 3U7YH 5B3JE 4JCLA 5HYSG 2BSSB 3F6LA 3G08B 4ZTOH 3SGJC 1JZ6A 5I73B 3MJ8B 3KPLB 3IXAB 4NFDA 4ONOA 3LQZB 3RBSA 3SJVA 3LN4A 4OIBA 5FF6B 3MNWB 4YC2C 5ICXB 1NDMB 4LCWA 2AXJA 3RAJL 3CZJA 1KTDB 4MA1B 4PJDE 2NLJB 1KIPB 1S5IH 3G08A 3SGKC 2PTUA 1MHEA 3KPLA 3MJ8A 3IXAA 2PYEE 3LQZA 1CDBA 3QUYD 4ZUVA 3NA9H 1VEPA 2KBGA 5D2NE 4RFOH 4R0LA 3TBVA 1H5BB 1V8HA 3LKSB 2FJGB 5IW3A 1KTDA 2X5PA 1F97A 4W81A 3SPVA 2NLJA 3OWEA 3P4LA 5KSAC 3LRGA 1KIPA 3SBWC 5DD5L 5T5FH 3DSNA 4WU7A 1MCWW 4NQSB 5SWZE 4LCUB 2PF6A 1L9MA 1RK0A 3KR3H 1H5BA 3LKSA 4YHPB 3BKCL 3QEQB 1YEGH 4HPOH 3VRLE 5DFWH 5AD0B 2FYYB 5GSRA 4Z6AT 4R96B 3H9SB 2Z93B 4LCUA 1J8KA 3UZVB 3CSPA 3NN8A 2VN7A 3CC5A 4EI5C 4XVUD 2GW5A 4AEIL 4Y4KC 4PRAA 2IAMC 4JQXA 3QEQA 1Z2KA 3NPSB 2FYYA 3RHWK 2VZSA 1EVUA 1U8JA 3H9SA 5FKPB 1I3UA 4JM4L 1D5BB 1NBYB 1OP5K 3MLWH 1FAIL 1UM4L 4QHMB 1CLZL 5IB4B 1JWSB 4DKAA 1P7KB 2IEPA 1SBSL 1J0HA 4OF3A 2ITDA 4G9FB 1AD0B 4NN6B 4DGYL 4LNRA 1JGVL 1U8LB 4APQD 3OF6D 3O8XB 4YFLF 1CD0A 3QIWB 1CGTA 4MD5B 2VH5L 3RY4A 4QHMA 1QFWI 5IB4A 4OFDA 1LNUB 3SKJL 4XPTH 3V0VB 5DD0H 5EUOA 3SDCB 5A2FA 4G9FA 1AD0A 1I1FB 2AEQH 5I8KH 5DSCB 1U8LA 1JF5A 3O8XA 4IEFB 5ALBL 2NTFB 1JK8A 4DQOL 3CU1A 4HUNB 3QIWA 4MD5A 3ULVF 3S98A 1I4FA 2HJLB 5E4EB 4MNQA 1LNUA 1FYTB 4P46C 3V0VA 4AMKH 5JHDD 4FQQB 1OAZL 1DVFD 1HI6B 5DSCA 4GRWH 4NO0B 4C56A 1PBYA 1DBAH 3VJ6B 5EPMA 3TN0B 2ADGA 3ILPB 1T1ZB 2ESVD 1XF5B 5AWNH 1RMFL 5INDB 1N6VA 3SGDH 4C59B 1FL6A 2PYFA 1JTOA 3MRBA 3DVGA 3ARDD 1WCQA 4YFLI 5IR1A 1N6QH 5BOPA 3CVHB 5KVDH 3TO2A 4NO0A 2PW2B 3VJ6A 4MJ5B 1BLNA 1QLFB 4G8EB 2OP4L 2R2EB 3ILPA 1A4JA 1IFHL 1XF5A 5C2BH 1MCPH 5D1QB 1T20B 5ETUA 4JDTH 5HVWA 5IT2H 4KY1H 2YA2A 4RGNE 2VQTA 2LTQB 3CU7A 4FABH 5DHVH 1V7NL 1QLFA 4G8EA 1E27A 1A6ZB 2GK2A 3T0AA 1AE6H 3RVTD 2X9YA 2HT2C 4XXDB 5D1QA 5JDSA 4U7MA 1FNAA 5EU6E 1N0LA 4EI6B 1VB9A 2F53B 3O6FA 5KSVB 4KH2A 2G5RA 4PJBB 4H1LH 1A6ZA 5DWUL 1QQDA 5GGVL 5KS9B 4OCNC 3NFSL 1TCRB 4XXDA 4HUVB 3AY4A 5EBWA 3KJ6L 2EXYD 4X7SH 3F7VA 5F1OB 2JJTC 4KROD 2F53A 4NQTA 4PY8I 5HYSA 4EOWH 5GS0C 4PJBA 2LVEA 2VMFA 1HHGA 4KZDL 5EO9B 3BN9D 3CUPB 4Y8DC 5KS9A 2NYYC 1F4YH 1IJ9A 2R0ZH 2ZCKL 3QDME 4BSWA 1L4IA 1NEZG 1AO7B 1U8IB 5IK3B 3CFJB 5CLTA 4LLDA 1DP0A 4KPHL 2RQ8A 5I74B 5L9DH 4OI9A 1PQZA 2XA8L 4IMLB 2R0WL 3TBTB 4PPTA 2FX9H 1NMBL 4U1SA 4CU7A 2HTKC 3ULSA 5L2JA 3CUPA 5GZNC 1RPQA 4R90L 4KUZL 1H3PH 5KANG 5HYJD 3AM8C 4UT9H 1AO7A 3EGSA 5D7JC 3PWPD 2G60L 1A0QL 2VLRD 2OM5A 3AS1A 4IMLA 3TBTA 5FAAA 4MZ2A 1AGCA 2KQMA 3GBMH 1KGCD 4RGMC 1DEDA 4PGBA 1ZANH 3SE4A 3SE9H 3O81A 3UPCA 3I84A 5TJWK 4YH6A 2BXZA 3OHXB 1MJ8H 5BVJA 3CNKA 3RIAF 3ZE2F 1A9BB 2ZUQC 4FQLL 5F71A 1BP3B 1LD9A 4KKAD 1ZGLM 4Y19A 1WWWX 1K5NB 2X4UB 5ESQA 1UYWH 3L3GB 1H8OA 1OAYH 4HG4K 4UBDD 3UAJC 1MPAL 1G7MA 1HWHB 5I1KL 3EUUA 1AR1C 1ETZB 3OHXA 4ELME 1EEYB 4U1GB 5GPRA 4Z7NF 1FP5A 3CPLB 3OAYK 1IGCH 4OV6F 3W2DH 2B4CC 3O6FD 2NY3C 2UWEF 2X4UA 4H0HB 3CLEL 2XKUA 4I3SL 2BJMH 3ROLB 5KSAA 3PQYE 3OKLA 2HLAA 3MLYH 1ETZA 2XTJE 3SBWA 1EEYA 5GIRB 1F3DH 3CJJA 3S5LG 2DN7A 4LASH 2ZJSL 5HGAB 1BQSA 1JI2A 5IHUH 4ISVB 3MRGA 1TVBB 2FO1A 3NABL 3MOBL 2VWEC 2VLME 3OQ3B 4YHLL 3H0TB 3OXSB 3ZKNC 3ROLA 2VDOH 4NQCD 1CZ8H 1U3HB 5GIRA 2I60H 2R4RL 1HKLL 4XP4H 3P0YH 1TVBA 4CNIB 4EI5A 2IAMA 1NC4D 1I1AD 1DLFH 3H9ZA 2V9TA 2VZVA 2W9EH 4P9ML 4LPYA 1D5IL 1U3HA 3FT4B 1E6OH 2FIRT 1BPVA 1YYML 5C0AE 3QA3B 4IRSD 3C09B 3WE6A 3TLRA 1TMCB 4CNIA 2V9RA 5E94B 5J06A 5DK3A 3SKMA 5MEQB 4Z8FL 1CT8B 2DLFL 4O4YL 1MJUL 2WM0A 4IOSD 3BDYL 3G6JE 3KPSD 3V7MA 4EBQL 3HR5B 2HWZH 4B53A 1L7TL 4O2CB 2XG4A 1CLOL 3I75B 4U1LA 4B7LA 1TMCA 3EYOA 5MEQA 1CT8A 2AJUL 1NLDL 4Z0BH 2LU4A 3GMQB 5FB8B 4Q97A 4I48B 3S3SA 4HXAH 1I9JH 1H3UA 4X6DB 1AR2A 4K3JL 3TZVD 4O2CA 1CE1H 3D39D 4J8RB 2DL9A 1FH5H 1IGFH 3GMQA 4M4PA 5EO1A 3WNLA 1QPPA 2A2QT 1Q72H 4X6DA 4MX7B 1SY6L 4PJHF 1FV1B 1YNTA 2J88L 3O9WD 2UV3A 4J8RA 5CD5C 2DBLH 4UIMB 3HC4L 4HK3J 1MNUL 5IBUB 5HHNB 4NWTL 3ALXA 4WW2F 5ENWB 1FV1A 1YMHB 1L6XA 4LOUC 5EZOL 3DXAB 5HPOA 4K7PX 2EH7H 2OLDA 1CU4H 4CDHA 3V4PH 1HYRC 1LK3H 2F8VA 2I9LA 1NQBA 2PR4H 3ARFD 3IFNH 4Q0XH 4UIMA 2ARWA 4NRZB 4DWHA 5HHNA 3BZ4B 3BP5A 5A2JH 5ENWA 1YMHA 5C0RH 1RUML 3RWIB 4D0BB 4WFFE 3OG6B 4MJ4A 5DTFA 5T1KA 3TJEH 4Y4KD 1FRGH 1VDGA 4RNRB 2OL3L 1OGAE 4JQIL 3WS6C 4X5WA 1CD1A 3OAUL 3RHWF 2WV3A 1JN6B 4Q2ZB 4XC1H 3BZ4A 3GHEL 1A7PH 2P45B 3DURB 5H37H 4D0BA 3RWIA 3JTSB 3K8KA 1F4HA 2YWZA 2ZUXA 4ZUWB 2VDML 3LMJL 4ODTH 1EGJA 4HS6B 3WNMA 5E7FA 3LY6A 4MAYC 1CL7H 4KKBD 1KIRB 2AGJH 2V5YA 4Q2ZA 2IQ9H 3DURA 4NNXA 3IDGB 4LL9A 5JORA 3BEWB 4MQSB 5TGBA 3S36L 3JTSA 4N0YH 4HC1L 4JZNB 4WI5A 2DQFB 1QLRA 3N50A 4HS6A 5D7LD 1G7IB 2X70B 3IFPA 4P48A 1CFVH 5EZIL 4ENEC 2RJMA 5A16A 5DQJB 1KIRA 4XNZB 4JN2B 3E2HC 3IETB 3Q6GL 4FMKA 3V52H 4HWEH 4PBXA 2YS4A 4ZS7H 4Y89A 1G7IA 1JPSH 2X70A 1MFBH 5DQJA 4UV7L 2X9XA 4EKXA 3B9KB 2DMCA 4JN2A 4P46D 3VXMB 1M71A 3IETA 2NY7H 1QFUL 3GRWL 5DVNA 1NCBL 3AM8A 4NUJA 3BI9X 5ISZE 1WISA 1RZ7L 2QSVA 4W68A 1ZS8B 4TOYL 4KZEL 3NZ8A 3B9KA 1SM3H 2CPCA 5F7FA 4JG0H 3U36B 4N5UA 1GPOH 5EBMB 4W4NA 2OQJB 2WK2A 4RGOH 3EBAA 4DKEL 1YMME 4F9PC 4GKOA 4IMKA 3NIGE 1BM3H 1T21B 4M48H 4N8CH 5ILTH 5T1KD 4NM4L 5EBMA 3GMMB 4UOJA 2XT1B 1A6WH 4JDVB 4OSUL 5GRVL 1LE5B 1NCDH 3WMSA 4KHXH 4JFEB 3AMLA 5DD3L 2EICA 2IH3B 4K7FB 1J1PH 1ZEAL 5D7IF 2C4FT 3GMMA 4J3XA 2R15A 4OD1H 5FYKE 1L6ZA 1WZ1L 2YMXL 4JDVA 2YOCA 4P4KC 3RTQB 3WYRA 3CVHH 1LE5A 3CFCH 4GAYB 2DQCL 1N4XL 4JFEA 5D70H 1EFXB 3SO3C 3F65A 2YSSB 1R6VA 4OZHB 3EO9H 2DL2A 3C60D 5IBLD 1A6UL 1KCLA 3L3IB 4QCIB 4MQXC 4OCWH 4ZO7A 5FYLD 3OKOA 1SQ2N 1H8NA 1LQSR 1KPUB 1CFQA 2NYYD 5EOCH 3EFDH 3O3DB 4G6AC 3K2UH 4MB5A 4O2FA 3TNNB 1EO8H 3L3IA 1UZ6F 1BD2B 4QCIA 4K7PL 1IGYA 3WSQL 4QOKB 3U4BL 5DJAA 2LQRA 3CMGA 5GZND 4JPWH 1KPUA 5GRJH 2BVOA 3FQWB 3NCMA 3O3DA 1TVDA 5EZJB 5D7JD 5C1MB 5ABDE 3G6AB 3R06B 4QOKA 3GSNB 1NUGA 1NMCC 3K0WA 3DMMB 4KTDH 3VFVB 3ZZ1A 1IGJB 3FQWA 4NSKA 4NCDA 15C8H 3ZE0E 5EZJA 1A1MB 2CKNA 1LO5A 3G6AA 3R06A 4ZUTA 4WCYL 1REIA 3DMMA 5FYLL 2BCKB 1JHKH 1RU9L 5LGKA 3U6RB 1K4CB 1FE8L 4M6AA 3IJSB 2J8UF 4WWKC 5B3JF 1OAKH 2H1PH 3OBAA 3UPAA 2X10A 3HPLB 2I24N 2NY2C 4A6YA 5LGJA 4QY8A 3BRFA 3UAJD 2F54D 1WICA 2BCKA 5F21B 3U6RA 5F89B 1FZJB 3LDBB 3C8KB 5HDQH 2NY3D 3I2CH 4JHAH 3ZT6A 3HPLA 4Z7OE 1BBJB 4UMGA 2DQEL 1BZ7B 3TPUB 4PJDF 1I9RL 2V5SA 2VDPH 3HPJB 1UXSA 5IWLC 2JJSA 3OTTA 1ZHNB 1MI5D 2Q8BL 2W1NA 2CIKB 1GOHA 3O6MH 1WTLA 2BY2A 3C8KA 4NC2B 2CUMA 5AG8A 2WLZA 4PV8B 5CGTA 4LRNL 1IC7L 1ROWA 3D48R 3H8NA 4ZO6A 3QQ9C 5E6IC 2WZPD 1KPVB 5F9AC 4CN1A 3RBGA 4PV8A 3E6HB 2O5YH 3O45B 4NNPL 3VDAA 4HUKB 4XPBL 4NOFA 1XGRB 2BK8A 1KPVA 4XTRC 3JUZA 3BRDA 2B4CL 4BZ2L 5FUZL 4OLEA 5FV2A 4JM2F 3LS5L 4EDWH 4EQ2A 2Z0BA 2P5WD 4MAYA 4I4WB 5EDXA 3LD8C 1FJ1B 3O45A 3BN3B 4PBVC 4LVOB 4GT7A 2NY0C 4YHNB 5J6GB 4JVUA 4LKXA 4QRTB 1F90H 3IS1X 3DI2B 3CXHJ 4QO1A 4O9HH 4TYUA 2DYPA 4RFEB 2B1HL 1X5KA 1OTTC 3LAFA 1FNHA 3GI9L 1BZQK 5D93C 3D87B 4EZMA 5JLZB 4QRTA 4J3VA 3SJVE 4DKFH 4I13B 1YN7B 2XZAH 1U3ZA 4RFEA 1DEEB 3FFCD 3HZVB 5CINL 1KTRL 1E28A 3X17A 4C4KO 1T7XA 3FB7B 4HKBB 5GJSL 2KDGA 1IE5A 2CDEB 1UCTA 3EOAB 1NBZB 2XICA 5E4IA 3UYRH 4FFEX 3CLFH 1ZGLP 1DDHB 1D6VH 4CU8A 1DEEA 1HYSC 1YJDH 4HF5H 5AZEH 3QDJB 4MA8L 2MNUA 5CJOH 3S35L 4BZ1L 2CLRA 4U3XA 2YK1L 1E4XI 2FX8L 1JFMA 3EHBC 4U1HB 5LAXA 3RL2A 1NBZA 1B0GB 4HFUL 3TA3D 1KIUA 1DDHA 5D72L 4F9PA 3MV7D 5CP7B 2CK0L 1HSAB 3VFUB 1AGBA 4G6KL 3L3KA 4WNQB 3WL9B 4OIAA 3KXFD 5J8OA 1LO0L 5MHSD 4U1HA 1B0GA 3HNTH 4PJXE 1DQDH 3HI6H 1M7XA 3F6IA 5CP7A 3RGVC 1PW3A 4M6OH 2F74B 4M7JL 2VZ1A 5KAQG 4M6NL 1HDMB 3GSRB 3WL9A 3VE0A 2ZCLL 4YHMH 5HBBA 3MLXL 1YZZA 2OCFD 4M9OA 3U30B 4F7MA 1CXLA 3BSZH 1OY3B 2FGWH 5TDOB 5TE6L 1MVUB 1Q1JL 2F74A 3SQBA 1FSKC 3LSOA 1HDMA 1KF9B 5D5MB 3VD5A 2ATKA 4J6RL 4MA7L 1WSST 3D3VA 1C5BL 1MVUA 3T8XB 2PXYC 5C08A 4I0PC 2W9DH 3QAZB 4LQ1A 3WO4C 3U79A 5T3XD 1S5HB 5EUOE 3VXRA 4QT5B 1HQRB 5ANMB 5JMOC 2YD5A 3WJJC 4B50A 4E42B 3O2DA 3T8XA 1A6VL 2DQDL 4E9LA 5FFLA 4AZ8A 5F3BB 2C7UA 4ZOAA 3EDEA 1CYGA 4GO6B 1IC4L 4MNQE 1CTOA 4E41B 1ACYL 5IP4A 3CSYA 4MJ6B 4F8TA 3UO1L 2UY7A 4DN3H 1HQRA 3MRQB 5ANMA 2W91A 3PP3H 3PWPE 2RGSA 3HNSL 2J12B 3CSGA 4E42A 2OXGA 4Y8AA 5D6DC 5CP3H 3U46A 5E95B 2VLRE 2A6JA 1RZKC 4S1QH 4ZUSB 4JN1H 8CGTA 1XGTB 3TFKC 3HAEB 4E41A 4WWKB 3RZWA 3ZKXC 3MR9B 4HBCH 5GGTL 1JZ3A 4MJ6A 5FECB 1KGCE 2LVCA 3MRQA 2IJ0C 4HJGA 5A3IC 2O5XL 4HDIB 4M00A 2FATL 1A7BA 3QDHA 4O00A 5JTWA 1XGTA 3MXWH 4WWKA 3MR9A 1R0AH 1CK0H 2JE8A 2JLLA 1INEH 5T3XL 1N7ML 4ODSH 5BS0B 2GY5A 5FECA 1RIHL 5KSBA 5ITBH 3MO1B 5F3HB 3LHPL 2YD9A 4QWWC 3RL1B 4TVPD 4HDIA 3STLB 3U9UB 4JFFB 1HCVA 4OJFH 4N5EC 2VL5B 2DJSA 3MREB 4NZUH 3B2VL 4KDWA 2VO5A 2BVTA 3RZCD 1G7HB 1PAMA 4UILL 2BHUA 1GAFH 2HKHL 3QJHA 4P4KD 3MO1A 5CZVL 5J7CC 4TPRL 4ELMF 3OJVC 5IWLA 3U9UA 3STLA 4Z7WF 2E9BA 1PLGL 4IM8A 2AI0L 5ID0B 3MREA 1ZLVH 4WU5B 4OLWL 4L29B 4NT6B 2NXZC 4KDTA 2UVEA 4MQXD 4X6EA 4NZRH 3D3VD 3HS0A 1HHHB 5C08D 1URLA 1RD6A 4LP5A 5ID0A 5E6IA 4JCMA 4G6AD 3C87A 4WU5A 4JFHD 4L29A 2A74A 4NQCE 2VE6A 2HT3C 3Q2CA 5J1AB 3UZEA 3LVEA 3K1DA 4YDLB 1HHHA 4TVPL 4LHUB 2C3WA 2O26U 5FHAL 5E1AB 1QSZA 3T2PA 2BERA 3P11L 4OZIB 4YBLB 5JQ6H 3KVQA 1ZT7B 4ZPTA 5J1AA 3LZFL 4OLYL 5D2LF 4YLQT 1HK6A 2A6KB 2IF7A 3JTTB 4KVNH 5E08L 4NC1C 1IC5L 1UM5H 2N4IA 4NP4L 5E1AA 2ZSVB 1WIOA 1GHFL 3WEXB 4OZIA 3H6JA 4J4PC 3U0TB 3E3QC 4POYA 4WI8A 5TE7L 5E6ZA 3KWWB 4ODBD 2A6KA 1YYLL 4LRIC 2ZSVA 2I07B 1SJEA 3P77B 4BQ8A 1I8KB 4O58L 2NY2D 3U0TA 3EO0B 3QUZB 4C58B 2GJ6A 3D39E 3KWWA 1A47A 4DEPC 3GSNH 1JGDB 1RULL 3HE6C 4K9EC 1OARH 2I07A 3HUJA 1SJXA 3P77A 2X4RB 2IG2L 3QUXB 5DT1H 1B3JA 3QUZA 3OR7B 3LKNB 4JHBA 4JY6B 4TRPH 3VGAC 5KVMC 2E8ZA 2BZDA 1JGDA 4FQXB 4MGXA 3EYVB 3ZL4L 1T2XA 3NTCL 4LLWB 4AIZB 2HLFC 1F42A 1ZKAA 4Z18A 3QUXA 3PWLB 3UTZB 3T2NH 3WIIH 5FGBA 3V6FA 3LKNA 3LV3A 4JY6A 4Y16C 1R3HB 4FQXA 4F57L 3EYVA 1R3JB 4I9WD 3MLRH 3VD3A 4N1EA 3UTTA 2E27H 4LGSB 1GH7A 3PWLA 3MLZH 2NY5H 5I8OL 5K59F 4TSCH 1NAMB 2H45A 4CVZA 1MFCL 4XP9L 3BIKB 1R3HA 3RGVA 4ZOBA 4IRJB 5AYQA 4BFGA 5CUSL 4K71B 4RBPH 3HMWL 1R3JA 3ECBB 4F58H 4HS8H 5HHXL 5ADOH 3GHBH 3RIFK 2NY6C 4GS7B 2ZPKH 4NUGL 1NAMA 5IESH 1JRHI 3BIKA 5DVMA 3M1BB 4IRJA 3QG7H 4PY8J 1UA6L 4WI3A 3RDTB 2ADFH 1EHLH 1A7RH 2DQIH 4OF7A 1HZHL 4R97B 3BWUC 3PNWB 3SKOB 4YEEA 3GSWA 2PXYA 5LQBH 4GMTL 3O3AA 2G9HA 4I0PA 4J1UA 3SO5A 1NCCL 2DQTH 4V3DB 1XIWC 4MWFB 3H3PH 5JHDB 1RIVL 4NZJA 5DHYA 3PNWA 5FGCB 2OJZH 3WJJA 2BRRH 4AH2B 3WUZA 3H42L 1BWMA 1AKJB 1HWGB 4OCLC 2ESVB 1MFDL 1CF8L 1RUPL 2AJSH 4NHUA 4TULL 1A1NB 1KFAH 1FFPB 4OQTA 2VDLH 3ARDB 3F7PC 4XPHL 5GS2H 4XHJD 1HYSD 3LEYL 5D1XD 5JA8B 5D6DA 4PGCA 1AKJA 2C3HA 2WWKT 1WUNT 3MV9D 3DTXA 4YHZH 2VN4A 4GW4B 4PRBB 1FFPA 1RFDH 2O61A 1SEBA 4MA3B 5KW9L 3VW3L 1GC1H 2DM4A 4XCEB 4ZO8A 3UX9B 4UIKL 3KDMA 5I75C 3D85B 3MLUL 3DX9B 1I85C 2WBJD 3VDBA 4DVRH 2F19H 1N2RA 2FD6L 3HLAA 4OZGF 1OAQH 4XNMB 5EU7C 3BD3A 3GKZA 5DF0A 5DMYA 1JPTL 3KYNA 5F7UA 4MA3A 1IQWH 1H3GA 2W65B 4PJ5D 1T80A 3NCYP 3D85A 4Z0XA 2ORBH 4AEHH 1GGBH 4NQUA 5C0NC 4D3CL 1PKQA 4XNMA 1FGNH 1WWBX 1JZ8A 3P73A 3VFPB 1TXKA 1FNGB 4P5TD 4KROB 4NC0B 3FB6B 2R1WB 5CWSB 4XCYA 2PTTB 5F9WB 1K2DB 3WIHA 4PLJC 2C9AA 3TNMA 2WBKA 1KJ2L 2P46B 1J8HA 2F5BH 5JXEC 3MJ9A 43C9A 1GZPB 4KFZC 4YXKL 4PJIF 2HP4A 3FB6A 1UEYA 1XF4B 3O6LH 5CWSA 4OLXL 3JXAA 2PXYD 2PTTA 2OK0H 5FYLE 5E8NB 1K2DA 1TJHL 2KUTA 4DFIA 1Z3GH 1W2KT 3IDXL 5HYJB 4RQQB 1GZPA 1NCAL 3P0VL 4P3WA 2F58H 5BV7L 1HXYB 2IQAB 1XF4A 1ZHBB 2OZ4A 3JWDC 3ARUA 5CILL 3TPKA 2JIXA 2OBGA 4L1HA 2WMPA 4GLRH 3ALWA 3RY6A 4AM0A 2MJWA 5GISH 1ZA3A 4LLVB 3B2UD 1ZHBA 5C07D 5I0ZA 3Q5TA 2DM7A 2YA1A 3O2DH 3PGFL 3TFKD 4YEFA 2ZOKB 4ODHL 4MDJA 3SCMD 3E3QA 4D9QD 2QHRL 1KB5A 4L8BB 4DEPB 4G7VL 5DJ2A 3ZE0F 4YE4H 1DUZB 2ZOKA 1BZ9B 3QBTB 5FM4A 3MRFB 4HKZB 2M1KA 4HUXB 2EZ0C 4QWWD 3D25B 3X3GL 3L1OH 4L8BA 2ZUTA 5DJ8B 4JPKL 4OD3L 2P48B 4HWBA 4N5ED 2ENYA 4JPIB 1A6AB 2F54E 2EC9T 3NPZB 4JKKA 3HE6A 1DSFL 1BZ9A 2J6EH 1MRDH 2D03L 3QUKA 4HKZA 1X5YA 3SDAC 3T77A 4WV1C 5T1LD 4Q6IC 5DJ8A 4Y16B 3UBXI 1M7IA 3G9AB 4YUEL 4JPIA 4ONFL 3MFFB 4M7LL 5F6IB 2DD8H 4JPVH 2NXZD 2HH0L 4Z7OF 3GM8A 1UT9A 1S7UB 3CXDH 1MI5E 1MHPH 1EZVX 2OI9C 4LQFH 3LKRB 3M17A 2VWEE 5EOTA 2HN7B 4Y16A 3VWJB 1I1AB 1TNMA 1OP3K 1IAMA 3IKKA 3DV6B 3MFFA 4XI5D 4PYGA 5BVPH 5F7DB 2HT3D 5FYJU 2NNAB 3RX8A 3BXNB 1S7UA 1EDQA 1FZMA 1UXWA 4OLVH 2BC4B 5E2UH 3GJFA 2B0SL 2HN7A 5IMLB 5T5NF 3W81A 2JIXD 3KPSB 4PRHD 3DV6A 4NWUL 1L7IH 1QBML 3MUZ1 1F2QA 3R0NA 3X12B 1T04B 3DVFA 4UV4L 5TQ0L 3DOSA 5FA3A 4KVCH 4LCIL 2DRUA 4OT1L 4DUWA 1T7WA 2AABH 5IMKB 3RAJH 4P99A 2VKWA 4PJAB 2P5WE 3FMGL 5CSGA 3TZVB 3VMNA 1P4BL 1TITA 2H8PA 4J4PD 1PVHA 3UC0L 1CR9L 1QOKA 5HI5C 5KBNC 2CLVA 1U92A 4K94C 4ORGA 4ETQA 3MROB 1P9MC 4U7KA 5DD5H 3D18B 5DJCB 4DN4L 3O9WB 1XIWA 1C8PA 2VC2L 5L0QB 2AK1L 1YA5A 5IEKB 3BPCB 4PG2C 2XY1A 2DJ4A 3TWCH 3HE6D 3RNQA 4MXWL 4JRXD 3FFCE 1JVKA 2WAHA 5DJCA 2DBJA 4PRID 3MUGB 3AREC 3O2VL 3VFMA 4YPJA 3BX7C 3O2WH 2APVA 4FFVD 4LGRB 2EH8L 4CMMA 1A8JH 5GRVK 3ARFB 1DUYB 1IAIL 3BH9A 2HLFD 2AAVA 5D7SL 1CDJA 3QZWG 2MQ3A 2OR8A 5EWIL 1BX2A 2AJZA 3FB5A 2X4QB 4X98B 4WO4C 4GG6A 4JY4A 1QSEB 1IEBA 1I85A 3V0AC 2ICWI 1FDLL 1J5OL 4R4NC 1FAIH 4LARL 1DUYA 3PHQA 3MV7E 4QEGA 1VADB 1JHLH 2B2XH 2X4QA 4X98A 1WBYA 3BMWA 5DC4B 3QNYA 2YKLL 5I6XB 1JGVH 1QSEA 1NGYB 4ACPA 2EDLA 3UPRB 1VADA 3OKKB 3DYOA 1WCBB 4ODXA 3SKJH 3HFML 4PJXF 4K2UH 3GNMH 1JL8A 3OMZA 5D7LB 1NGYA 5ALBH 2V2WB 3L6FB 1I9IH 5IB3B 3JUYA 3GSVB 3OKKA 4PJFA 1WCBA 5F93C 2H2PC 5JXEA 1I3RB 3VFGH 4XPGL 4JFOB 1OAZH 4NO3B 2E7HA 3P0GB 1NAMH 2VZTA 2V2WA 3V6OC 4LVNC 4X6CB 5C6TH 3KLDA 5FK9B 4JKLA 1JYVA 1QEWB 1RMFH 2Y7QB 4QHUB 5L7XH 4YBQD 1PG7H 4HWUA 4TSBH 5T3XE 2DQGL 3CFEA 1YC7A 1I7RA 1RQ5A 2P7TB 4GSDH 3MA9L 3VWKD 4GG8B 2Y06L 1CL7I 1T0MB 2GTWB 5EUOF 1GOFA 1IFHH 1QEWA 1S9XB 3LKQB 1B90A 3MBXL 3QXDA 4IHOA 4QHUA 3PP4H 4YHIB 4P23C 3CH8A 3SHSA 4OTXH 1EVTC 5J6HA 3HMXL 1X4YA 4PP2B 3S3PA 3UTQA 4NO5B 4Z7QE 1VA9A 4F80A 5H2BB 3HNVL 4GG8A 5L2KB 2F5AL 2D7TL 1S9XA 1IKFL 4P4RA 1F3RB 2H2SC 4BH7A 1P2CA 1NGXB 1KCRH 2I25N 4OQTH 3F5WB 5CBEA 2KH2B 3DUHA 5H2BA 3S37X 1FVEB 5L2KA 2DDQL 5GGVH 4Y5VB 3NFSH 1FZOB 1NLBH 3KJ6H 1MCOH 1A6PA 3GMOB 4NQDB 1T83C 1PY4A 3TH2T 3BP7A 3ARGC 4U1JA 2OR7A 4CADB 4K23L 4L5FL 1LHZA 3TM6A 4X7EC 2X89D 3MGOB 4TVPE 1CXEA 4Y5VA 3L3DB 3C60B 4R26H 2QQNH 5T33H 4WV1A 4Q6IA 4CADA 1YY9C 4NCC2 1KB9K 1LP9A 1VGEH 4PLJD 3DX7A 3V5HA 3WUWG 2R0WH 3MGOA 5F72S 1NMBH 2HG5B 4LPVA 3QJFB 1JNLL 3DUSB 4KUZH 5JXED 1EBAA 4HG4J 4OQ1A 1BFVL 1AD9B 1B4RA 3QEHB 4U7SA 3WKMH 4PLKD 4BQBA 2GT9B 3D3VE 4QTIL 3HI5H 3T0EC 4L4TB 4G9DB 5MI0B 5C08E 2HG5A 2VUOA 5HHVL 3DUSA 1TJGL 3D9AL 1ZLUK 3INUL 3LPGA 4LSPH 1AD9A 4JFHE 4TQEH 4XPFL 3QEHA 2VUYA 3VXRE 4P57B 3A0OA 2GT9A 1MCIA 5KS9F 4L4TA 1FAKT 3ETBF 2AQ2A 3B9DA 4G9DA 4Z95L 4NZTH 3QCUL 2DIJA 4MNHB 4EIZC 4JFDA 4JJ5A 3E8UL 2NXYB 4G7YH 4OLZH 3AU1B 3V4VL 4R2GB 3IDJA 3ZHDA 1FBIL 3LRHA 2OTWB 3B43A 2OZ4H 1T0PB 3RVUC 5DYOB 1KELL 1MPAH 5I1KH 4MNHA 1S9YB 3MRNB 5D71H 4GAJH 3QWRD 4CRPA 2P8PA 5DJDA 1MLCA 3AU1A 2Y5TA 1MCSA 3CLEH 3S34L 2F54B 4N1HB 4YBHA 2OTWA 2R39A 5C71A 1I7TA 1N64H 1S9YA 3MRNA 5B38A 1CBVH 1QFWL 2EZ0D 5F7EL 3ARWA 5KSBE 3MOBH 5K9QI 5I71C 4YHLH 3JWDL 3C9NB 3C6SB 3ULUC 3X3FH 3I3EA 3AAZB 1MH5B 2AEIT 3BT2L 5E9DA 2GSIB 1C12A 2Z92A 3FO1B 4ZMAT 3AREA 2R4RH 3SDAD 3GGWB 2WUCL 3RGHA 3NIFE 4PGEA 3KPQB 4BSVB 3C6SA 1KEML 3V95A 4MCYB 3IJHB 1MH5A 5C0DA 3HC3H 4AYFA 2VXVH 4P9MH 4I5BB 3GMLB 3FO1A 4J3WA 1JPFB 1KCSL 5E8EB 1GXEA 3AGVA 1UM6L 1X44A 1VACB 4XCFH 5FA4B 4Z8FH 4Y1AD 1I9EA 3KPQA 1KENL 1NGQL 4O4YH 1AP2B 1DFBL 4MCYA 3IJHA 3ROOA 1MHCA 1SYVA 4I5BA 2BFVH 2C3GA 4I9WE 4NKQB 1JWUB 1MHHA 1YPZE 4PV9B 4F33B 1UH4A 4IDJL 1A14H 1VACA 5FA4A 2O93L 1ORQA 2AJUH 3ZDZF 2D7PA 1AP2A 4KAQL 1QNZL 3NVQA 4PJ9B 3S37L 2RIKA 4JFDD 1F4WH 4K3JH 1WGOA 2HJFA 2V2XB 4F33A 2GITA 1ZSDB 3SY0B 4G43A 5EULV 4R7NB 2FDBP 4MJIB 4ZSOE 1S3KL 4HIXH 3S97C 3T04D 4Q7DA 4PJ9A 1WFOA 5GS1B 4HZAA 3MRIA 1SY6H 4G42B 5HI5D 2V2XA 1G0XA 2UZIL 1B88A 1B4JL 3TYFA 1C5CL 5A2KH 4GRLC 4R7NA 4V2CB 1W8OA 3VGBA 4KMTL 5CCKL 2CKBA 4J23A 5C09D 1E6JL 3EYUL 4Z7UA 3V6OA 4QRPD 2FHBA 1MNUH 3BD5A 1BQUA 2MPAL 3CVIL 3ILQD 4NWTH 4NKMB 4JRYA 1R3KB 3P4MA 4S0TD 3TCLB 5KG9B 4KUCF 2GJ6E 3WNNA 1JV5A 3UZQA 1DE4B 2C1OB 4K55A 1BAFH 5E9DD 2X4NB 5I30H 4NQXA 5C0JB 4WVRA 5EORH 4NKMA 1R3KA 3HUJE 2VR5A 4OIIL 1HKFA 3TCLA 2I5YL 2XA3A 4P23A 4Y2DC 5KG9A 4KK5C 3PABB 3TA3B 4JQIH 5FGSA 2AEPH 3OAUH 2CUHA 5EIIA 4QXGL 5LWYH 5C0IA 3GHEH 1KUMA 4ZAKC 4YXLL 2V5RA 3MUY1 3KXFB 4P2YA 4WO4D 3MUJA 5IKCB 3QCTH 4NDMB 5FO9B 3PABA 1QYGH 1RI8A 4R4ND 4WI7A 1ORSB 3MNZB 4OB5L 2HFEB 5E2VL 5CJXC 3W11C 2VSDA 3FQTB 1CLCA 3IFOB 4NFCA 3HZKA 3UTTE 1QA9B 3TJHA 1T83A 4ONGL 2FIKB 5IF0A 2AV7B 5E5MB 3IGAB 3ARGA 3T4AA 2WW8A 3MNZA 1AJ7H 5EZIH 4PJ5E 4LEXL 2HFEA 3V5KB 1FL5B 1M7DB 5IV2A 3ARZA 4YK4C 4ZQKB 4HK0B 2JELL 4MDIB 5DS8B 2FIKA 5E5MA 3IGAA 2H3NB 5F1KC 1YY8B 25C8L 2VSCA 4CUCA 3KHQA 3D2UD 5DMIH 3DBXB 1EJ6A 4TNVK 5IW1B 1M7DA 1O5DT 2H2PD 3I50H 1CFSB 1QFUH 3PGCA 1RZ7H 5DS8A 5SWSD 3EOBB 2DS4A 2FHFA 2FWOA 1LE9A 4D94A 3UDWC 4L9DA 3DBXA 4U4BA 4JFZL 3VGGA 4J2XA 4KMLB 4RRPA 2VLJD 5AYUL 2VXTH 5TE4H 2V17L 3EOBA 5C86A 1Q8MA 3S4SG 2VLKA 5I19L 2P5ED 4URTB 5F7HA 1R3LA 4YHOH 4LNVA 3VXUA 1G9NH 3RWCB 5IQ9B 3BH8B 1N5AB 1ZMYA 3TGXA 4NHUE 2Q8AL 4JLRA 4P3CL 3VG9B 5CEXB 2D7MA 4NM4H 5KANI 4QXTB 3MJ6A 1B2WL 3FN0L 3DGCR 1F11B 3KPRB 3MNVA 5JR1L 1PJ9A 1TLKA 3RKDC 4OSUH 2BHZA 3BH8A 1N5AA 3OGOE 1I7ZA 4H88L 2N1KA 5HHMB 1TDQA 5TFSL 4NN7C 5CEXA 1I1RA 3FRUA 2BVYA 5C0CD 3KPRA 4D9QE 3V0WH 4P2OC 3AB0B 3S8WA 1MLBB 3BO8A 4Q9RL 3O3EA 4GBXD 5HHMA 1FZKB 3O4LD 4HIIB 3UTPD 3ABZA 3RZCB 3OX8A 1A6UH 1VENA 2GHWB 4KTEL 1BJ1H 2YUZA 3KPPA 3MJGX 4TSAH 5DMJB 4XNUL 3IAGC 4HIIA 4XAWH 3RVVC 1PKQE 4H8WC 3C8HA 3KLSA 3BPNC 1YY9D 4K7PH 5A2LH 5B21A 3X13A 3MLVH 2VXQL 4FQ1L 1ZK9A 5IHLB 2BSED 3CMOL 4XMPL 4MZ3A 1D6EB 5DA0B 4OGXL 1J9CT 4JO2L 3MRJA 1J8HE 1AQKH 1QKZL 3OJDB 3QFJD 5HI3C 4G6MH 3T0ED 2FJFB 1TZGL 1QFPA 1L9NA 5HYIA 2R0LL 5HY9B 1D6EA 1TZHB 4ZFGL 1G7LB 3WS3B 3VXQA 2X4OB 2VLKD 3QR2A 3OJDA 1LO2H 1CGVA 1B0WA 3L95B 3BP6B 3PJSB 4FQCH 2N7BA 1FHGA 3PIQB 1FG2B 2FJFA 2ITCB 5ACLA 4WCYH 2P8MB 1GRWA 2P1YA 3MZTA 4N8VB 5E1HB 1RU9H 4X99B 1RZ8B 4PRHE 4PJCE 1G7LA 4HH8A 4FTVB 5I17A 4WHTB 2X4OA 2IFFL 1YECH 1Q0YL 3L95A 5HPMA 3PIQA 4N0UB 1HH6A 5F88B 3KG5A 4X99A 4NC1E 4FTVA 1NKOA 4WHTA 4LEOB 1IM9D 4H0IA 4H20H 5IUSA 2DQEH 3QEUB 1I9RH 4AL8H 3QFDA 1T22A 1VERA 3GBNL 4LLMB 5F88A 5LGHH 1X7QB 4BFIB 4I8DA 1CGYA 1QACA 3IDMA 4HIHA 4WJ5B 4RSVA 4AG4L 4HEME 4DCQB 1YEIL 2Y1VA 5EU3A 3JV4B 2XWBA 3DIFB 1R24A 4JY5H 3ULUD 3QEUA 1CLYL 1AGDA 1X5JA 2R1YB 1JJUA 3CFBA 2QSCL 3B3IA 4LRNH 4JO3H 1ZHKB 1X7QA 4BFIA 2YEZB 4MVBC 5LXGL 4XH2A 4JRXE 4NKDB 1H0DB 1MCLA 3JV4A 5DD1H 3DIFA 2BOCB 1FFOB 2W38A 4LP4A 5ERWB 4NPYB 2R1YA 2VL4A 3FCTA 1AIFA 2B5IC 1ZHKA 4YQXH 2GSGB 4XPBH 1DQML 1HHKB 1H0DA 5EUKB 2WY3A 3PDGA 4BZ2H 5FUZH 2VLLA 2NR6D 3LKPA 4QRRD 2BOCA 2E6PA 3LS5H 4F2MB 2EKJA 4L3ED 4NPYA 2A9MH 5HHOD 1H3XA 4JB9L 1K9TA 1BQLH 2GSGA 2A6IB 3EJYC 1X5AA 2MQCA 1HHKA 4KQ4L 3WDIA 4WFED 3J7HA 4K3GA 1JYXA 1RZIA 1IRAY 3MBEC 1FFRA 4HCRA 3ULUL 1PDKA 1OD7A 3FHAA 2L0DA 4DOHE 3V5DA 4XMLH 5KSUB 2A6IA 1F58L 3GI9H 4ZOCA 2P24A 1FC2D 2PUQT 5HVHB 7CGTA 5IM7B 2G5BB 3VD4A 4FRWA 1YEDA 2BNRA 5I1HL 2EDQA 4IOIB 3ESVF 1EA9C 5JOPD 1D5XB 1RZGA 4KRLB 1X4XA 5KSUA 3NMEA 3BQUB 5J11C 1EEUA 1S7WA 4GRLD 4HXBL 3CAFA 3SN6N 5GJSH 3N85L 3BGFB 5IM7A 2G5BA 5L6YL 1A22B 3HKFA 3UDWA 5DLMH 4IOIA 2FX7H 3VXSB 1VEMA 4MA8H 2W92A 3BQUA 2YK1H 4WTZG 5C0BD 5EZLB 4P2QA 1I7UB 1LO3L 1UVQB 1A3LH 4ERSL 3ESUF 4WFHD 5D1XB 3LQAH 1PX4A 5I2IA 1NFDE 2ZUUA 3VXSA 1HHJB 1K6QH 3MV9B 1KJ2B 1U8QB 4QGTA 3UTSD 4PYHA 3B83A 4ZUUA 1MEXL 1Q94B 4KHTL 4Y2DD 5EZLA 4KK5D 1S9VA 1I7UA 3ES6B 4PJGA 5C3LD 4Q6YA 1UVQA 4FQIL 4MLIA 3NCJH 3OL2A 1Y0LA 4M9PA 2WBJB 5GRZA 1BBDL 2DM2A 3LPFA 2R8SL 1HHJA 4ZAKD 3SDDB 2AP2A 3THML 3ARBB 1Q94A 2Y4SA 3IDYB 1AXTL 3ES6A 1J11A 5BV7B 4O02H 4Z7QF 4LSQL 2DWDB 5BJTB 4GG6E 4P2OA 3ZYZA 5DUBA 5EU4B 4F3FB 3MCKB 1JWMA 3IKCB 3KJ4B 4OGYL 4UTBL 3SDDA 1H3TA 1VHPA 4IDLA 4KK9D 5BRZA 5EU7E 3ARBA 4IRZH 1JMZA 4LDLB 5J0BA 1BGXL 5C92A 1G7JA 4P5TB 3K2MC 4J6RH 2DWDA 3K4DA 1C5BH 4F3FA 5EU4A 4ZXBC 2QQKL 4LK4A 4W6WB 1N0XL 1MY5A 3HRPA 2FB4L 3NCBB 2J3SA 1U8KB 2K3TA 2VISB 2PYED 4TNVF 1RIUH 2DQDH 2MFNA 3C08L 1G9MH 4AENA 2PO6D 3GK8L 4P9HH 1OAXL 4PJFE 1QO3A 1NSNH 3RKPA 1ZE3C 3Q5YA 2VISA 3SDXB 4PS4L 4QHKJ 4CVWA 1FORL 4DAGL 3UO1H 4MMXC 3HNSH 3O6KL 2CGRL 2NY1D 3FT2B 4FFYH 5DHXB 3P4OA 5FUCC 5CD3B 2VTFA 3DI3B 1EEZB 1DL7H 1W0VA 4N0FB 1YN6B 2VIRB 4OD2A 5C07B 1DBKL 2R56H 2DMKA 3FT2A 2V7NB 1WC7B 2FATH 1LGVA 4Z78B 3BAEH 5DO2C 4RMUA 4OFPA 2XYCA 4JM2D 3SCMB 1VFAB 1WITA 4N0FA 1YN6A 1N7MH 2VIRA 3BFOA 3S88L 4YDIH 1RIHH 2H32A 1BECA 4LLQB 2YPLA 3K8MA 2EDDA 5E99L 2AKRB 3L3JB 1MCFA 1WC7A 3MACL 4Z78A 3VCLA 5T1DH 7FABL 2DJUA 4YDJA 1RJCA 1A9EA 5FYKU 4OCXL 4D8PB 2CJUL 4XRCB 1RJYB 1T5XB 2CLZA 4QHLB 4LLQA 2AKRA 3VFSB 2ZNWA 1U58B 2COQA 3QSKB 1UH2A 3BUYB 4F7PA 4OLWH 1UEMA 1JGUH 4D8PA 5F7LB 3QHTC 4G6FD 4XRCA 5T1LB 3PV6A 3U83A 4LLAA 5TQ2L 2W0FB 1QRNA 5INCB 2B5IB 3RVVD 4MVBA 5CJBA 4XCNB 2W0LA 2QL1A 4XVTL 5KSBF 2JK5B 1FIGH 1F2XK 2AW2A 1CQYA 3ET9F 5BW7A 1Y6KR 5EO0B 3I3BA 5J1SC 2C26A 2IANB 5LJYH 4GQ9L 5INCA 4EVNA 2C1PA 3BZDA 1D9KD 3V9FA 3NCYS 3NIFF 3IJYB 4KJWD 1T4KB 2VRAA 1E4XL 1OSPH 4ZTPL 4RA3A 4OLYH 2IANA 1MIEL 4EN3D 1P1ZA 5HXMA 5E08H 3VA2C 4NP4H 5DEGB 3PL6C 3QUML 3O4OB 1U2HA 1GHFH 2ZOLB 1K3ZA 1QSFB 2R29H 3O0RH 4Z9KB 1EIBA 3SOBH 1G1CA 3BDXA 3T1FA 3STZB 2E9JA 5C9JB 1YYLH 4FFZL 3NGBB 5DEGA 4JFDE 5CEZD 5J11B 12E8H 2ZOLA 4H8WL 1QSFA 1J86A 2AV1A 5JW4N 3G04B 3GJFK 3RI5K 1OCWL 3M8OH 4HQQH 1HOCB 1P7HL 4BK5A 2XACC 1ADQA 2YBRA 3QEGL 1FL3B 5LCVL 3Q1SL 4P2CG 2QQLL 4RCAA 3VFNB 3G04A 3CFIC 2GI7A 4NGHH 5C09E 1RJZB 4KWUA 4QRPE 4GKNA 4MCZA 5B39B 4PRIB 3KLHC 4JFYB 4KKCC 1RZFL 4HIJA 3T0VA 3VFNA 3EYQC 3QDMD 3U7WL 3KS0J 4PREB 1M4KA 2X4TA 5DZNA 4F57H 2EYTB 4MVBD 1RJZA 3VFTB 1AXIB 2ADJB 5E9DE 4H5SB 1FFNB 3QDGB 1B0RB 4U3HA 5CEZL 4PP8C 4H1LG 1NFIB 3DROB 3V79C 3CH1A 2M26A 3IDIA 4PREA 5KAQF 1EXUB 1ZA6B 4R9HA 1F45A 3HUJF 2CRIA 2EYTA 4N68A 5CUSH 3HMWH 4JG1L 3VFTA 2ADJA 1FFNA 1HNGA 3QDGA 1B0RA 5J12C 4OAWB 1NFIA 2DTSA 3B9EA 4NUGH 1YEKL 1NAKH 2BNQA 1LWRA 2GCYB 5E00A 1EXUA 5L8KB 2XNAB 3BVNA 5DK2B 1NL0L 5F96L 5IMMB 3ZDYE 3OGCA 1RUAL 4OAWA 2AVGA 3RA7H 5GGRY 1V3MA 1Q0XH 3FQUB 3MBED 5EH1A 5EC2B 1N26A 2GCYA 4ONHB 3E6FB 3CX5K 3MXVL 2XZQL 4ODVL 2XQBL 5IMMA 3QHZL 4PJ7E 1FNSH 4FS0A 4JANA 4NQVB 4YHYC 5I1IH 1UWEH 4I0KA 5GGSY 1T1YB 3QULB 3WXVL 3T09A 5EC2A 1IC1A 1HN1A 1A6TB 2OMNA 4HCRH 4U6YB 4LLYB 4WTXA 3GZKA 4TULH 3GKWL 1ZLWK 4G3YL 4NQVA 2HFTA 4F7CB 4KI1A 3QULA 5SWSE 3I6KB 2EECA 1A6TA 3VWKB 5IVXB 1VFBA 4Z7UE 3V6OE 3IDUA 4LLYA 3TT3L 3U2SA 2R1XB 2Q3AA 4JRYE 5K93A 1KLGB 1ZWIA 1ZT4B 1A2YA 4LVHB 4F7CA 4TTDC 5KW9H 3W82A 3L5JA 2D2OA 3D1MC 4UIKH 3V6ZA 4WGWB 1P4LB 5GGQH 2P5EE 4OUOA 5IVXA 4PJEB 5ELIA 5IB5B 4MJ2A 4XBEH 4WIQA 4ZPVA 4R8WL 1ODAA 2EYSA 2R1XA 3NAAH 2Q7NA 3QPXL 5I66B 1II4E 1JPTH 2XRAH 1ZT4A 2CH8A 3GI8H 3PWNB 1T0NB 3B6SA 3UJJL 1P4LA 43CAB 5TDNB 4PJEA 5IB5A 3T0BA 4GXUM 4HUWB 4X4ZA 4D3CH 4JZOB 3BPLB 1A7OL 4LIQL 1J10A 5I66A 3VI4E 3SEPA 3PWNA 3AMKA 3WFEL 2FLBT 1T0NA 4WUKL 4AEEA 2L7UA 3BHBB 4POZD 2PW1B 4PJ8C 4Z77B 2QADC 4HUWA 4BQ6A 2DI8A 2X2YA 1T5WB 1KJ2H 4KXZI 4LSSH 3T4YB 3OKEB 1OQOA 2JTDA 1OP9A 4OZFA 3UTPE 3GSUB 4JO1H 1UQSA 2X44D 2EDKA 3BHBA 1RHHA 4ZXBD 4OLXH 5LG1A 1Q9OB 4Z77A 5M7QA 1U6AH 4XNXL 4ESKA 1KXVC 2ZCHL 1T5WA 1YUHA 3IDXH 3GO1H 5KVEL 5MEOB 1XZ0A 4K8RL 3VXNB 1MFEH 3OKEA 5I1DB 1NCAH 4PGJA 5BV7H 4FXGB 4V1DD 1Q9OA 5I73C 2DQHL 2J1KA 2ZKHL 1IM3B 4BJLA 5CILH 3VA6A 2EDWA 3W39B 2WUBH 5MEOA 4QF1B 5I1DA 1TZIB 2E3VA 4ZTOL 5GRWA 3H7BB 4OCSL 4MA1C 4LKCB 3WFZA 2ED7A 2X7LA 1OB1B 3T0EE 1Q9LB 2IFGA 3PGFH 3PL6A 3JVGA 1H5BC 3W39A 4ODHH 1LEIA 2XPGB 2IH1B 2GIYA 5C3TA 2X4SB 2VLKE 4LKCA 1KNOB 2QHRH 3VXUE 4WFFD 3LEVL 2A9NL 2FZ3B 1Q9LA 3CFDB 3IVKB 1FVDB 5F9JA 5HYQB 4UTAH 1Z0MA 4H1LA 4WI4A 5DJXB 2XPGA 4I77L 4JQXC 3DX6B 5I1LB 4GFTB 1ZHLB 5BO1H 4NHCH 5T5FL 3X3GH 1UH3A 2VYRE 1I3VA 4YX2L 3MC0A 3LIZL 3MZGB 4PJCF 3CFDA 3WFDL 1JRHL 1J0KA 1FVDA 2BVPB 3KR3L 3QXUA 2N7AA 3KPNB 1DSFH 1YEGL 5E8OA 4HPOL 4ELKB 1ND0B 2D03H 3FQRA 5TF1H 1D5ZB 5DJ0B 1ZHLA 3RX7A 3D6GA 3NPSC 5GRUL 2Y5EA 2Q76B 2OTPA 3MV01 5JW5B 4I2XA 3WHE1 2HH0H 4CU6A 1NUFA 3QO1B 4ELKA 1NANH 1GIGH 2EEBA 4HMEA 3H3BC 4Z7VB 1FO0L 5H37G 4BUHA 1QG3A 3ULUE 5JW5A 4PRPD 1G7PB 5EFIB 5MENA 2Y9RT 4JFXB 2YC1B 1D5MA 4NN6C 2XN9B 3F7YB 4BFEA 3I02B 1FC1A 3QO1A 3O8XC 3BEVB 2QBWA 3K8LA 3QIWC 1CXFA 4Y1AB 4Z7VA 3VRJB 1P7QD 1CD9B 3SDCC 4HS3A 4RMQA 5EFIA 4JFXA 1QBMH 2XN9A 3F7YA 2Z9TA 3I02A 2NQCA 2FJHB 5KOVC 3HG1B 5D1ZB 5TPWH 2IALB 5TQ0H 4MQTB 2BY3A 1PGRB 3JV6B 4S11A 5FEBA 1SYSB 4BM7A 5E4EC 1W72B 2XV6B 4QRRE 2X1OA 4JGJA 2AEQL 4XP6H 5I8KL 2XKSA 3O3UN 3N0PB 1YMMD 5HHOE 3L7EB 1P4BH 5F1IB 4Y0GA 3HG1A 1H3WM 4F8QA 5DFVC 2IALA 1CR9H 1FNEB 4X9IA 3TN0C 1FVCA 5DJYB 4WFEE 1W72A 1EBPA 3NFPB 4OZ4B 3C6LD 4HPYH 1HILB 4E0RB 3OAZH 2NX5A 4MXQC 3L7EA 1DZBA 5F1IA 4X4ME 1V05A 3QWOB 3PGDA 3VFOA 1F5WA 2VC2H 4NFBA 3DETC 2AK4A 1FNEA 2AK1H 5F9OH 3WO3B 1ZVSB 5AWNL 4ZS6D 5DJYA 2XTLA 4OZ4A 3SQOH 4X5XB 3HZYB 5D1QC 2A73B 2WIIA 2VDKH 1DANT 2GUOA 2UUDH 5KVDL 5JOPE 4FXKB 2LTQC 4UT6H 5GSVA 3RPIA 3EYFB 3QWOA 4KC3B 4BZYA 2OTUB 1V5JA 1M1SA 3MPCA 1RAMA 1YEJH 4M7KH 5FV1L 4JDTL 5IT2L 1RURL 4X7FC 4X5XA 3HZYA 4UDTA 4XB7A 2EH8H 2A73A 3QPQD 4XZUB 2YZ1A 1CDIA 1IAIH 5EU5B 1IAIM 4FNLH 2ENSA 3KLHD 4X0KB 5D7SH 3EYFA 1ADQH 5CFHA 5EWIH 1OD9A 1UZ6E 1KN2L 3KPMA 4RAHA 5C0BE 1KULA 3DARA 1DBMH 3DRTB 4LCCB 2APWA 3T0DA 1GGCL 4QTHB 3KYAA 5CS7A 1XEDA 4F7EB 4M8QB 1I75A 3OKNB 5CZXC 1LEGB 1OAUH 4WI6A 2YKLH 3DRTA 4X7SL 3BGAA 4IIQB 2DKMA 3UEZA 4QTHA 3EDJA 5GGRA 4EOWL 5ADPH 1UG9A 2E9IA 1KN4L 2VKXA 2NY4D 4F7EA 2V2TB 3L9RB 5I74C 1MWAB 3OKNA 3RWGB 4PIRF 1LEGA 1YNLH 1OVZA 1JF1B 1AGFB 1G6RB 1QP1A 4PJ8A 2IGFH 5I9QB 5IEHB 4FQPA 2RBLA 3SE3C 4Y4HB 1PG7W 3FTGB 3ZO0A 1IQDA 5GGSA 5L9DL 2EEDA 1ZVYA 2UWEB 2XZZA 2FX9L 3SE4C 1MWAA 4GG6F 4LGPB 3L3OA 3WHE0 1NPUA 5C9KA 1U8PA 1JF1A 2X4PB 1AGFA 4V3EB 1G6RA 5KZCB 5IEHA 4G8GA 5DI8B 3P9MB 4Y4HA 1N5YH 5HDLA 3FTGA 5K9QG 2CDFA 2UWEA 2GJZB 1HQ4B 1QD0A 1KLFA 2BSSA 3GBML 2X4PA 2CDGB 2DQGH 5I76B 2BNRE 5DI8A 3BRGC 1E4WH 1BF8A 1IZJA 1S7SB 5E56A 2Y06H 5FF6A 1IAKB 3MNWA 5ICXA 4N0CC 1ZANL 1NDMA 2W0KA 3SE9L 2VLJB 3MBXH 4J3TA 2GJZA 3RWHB 1WBXB 3HB3C 1IL1B 2CDGA 5I76A 4U1GC 5MP6H 2R2HB 1T1XB 1S7SA 1QBBA 3HNVH 1UYWL 2VXSL 4PJFF 1IAKA 1LQVA 4ZFOL 1OAYL 3TIDB 1ZTXH 3QI9D 4TTDD 3RWHA 2FJGA 1WBXA 4P2QE 1ZXQA 3A67H 1CXIA 4U1IB 5FHBH 3W0WB 1YEHL 1IL1A 3DV4B 4X5LA 4LPTA 1CWVA 5F6HI 1T1XA 1IGCL 3W2DL 1KT2B 3DYMA 4FZEH 4NQSA 5JPMB 2DDQH 3CDYA 3G5YB 4YHPA 2BJML 2J5LB 4PR5B 5H94B 3W0WA 4P2RD 1KOAA 5C0CB 4J3SA 3DV4A 1NGPL 5AD0A 1U3HC 4LASL 2Z8SA 5IHUL 1KT2A 1OPGH 4R96A 3TYGH 1RJLB 5JPMA 2YXFA 2Z93A 3O4LB 4U1KB 4CJ0A 1WEJL 5H94A 3IYLW 2VDOL 3AXLB 5C0FB 4PJ8D 3RU8L 4UINH 4KMQA 2QADD 2DKUA 4XP4L 4WRLA 4KRPC 2XFXB 2FBJH 4PJHB 3P0YL 1RJLA 5DVOA 3C09C 5FKPA 1K85A 1JNLH 1DLFL 5BRZE 1D5BA 5M94B 1NBYA 5E2WH 2W9EL 3KYOB 4XX1G 4M7ZB 3AXLA 4YWGL 1E6OL 5C0FA 1KJMB 4G8GD 1JWSA 1P7KA 4FFWD 3SJVD 4WW2B 4N9OB 1EEQA 1YEEL 1MAML 1WAAA 1K4DB 5D6CB 4LCWD 5HHVH 2VDNL 4ODUB 5KJRH 1YJDC 5GHWL 2ZUSA 5C0EB 3R8BB 3QFJB 4P5KB 1QBLH 3GSOB 2WANA 4OZFH 5B8CB 1U41A 4WW2A 1U8HB 3SDCA 4Z95H 5F8RC 1I1FA 2CO7B 1DCLA 3HZMB 4LHQB 4HXAL 3TVMB 1MVFA 4X6FB 2NTFA 3K4AA 3V4VH 2B20A 1X6LA 1LP9F 1NEUA 1FBIH 1UWXH 2EDOA 2HJLA 3CDCA 4KKNA 1FYTA 5B8CA 4S1SH 3VRIB 1FH5L 1AGEB 1U8HA 3FHQA 1IGFL 4FQQA 3PXJA 3HZMA 3GMRB 1HI6A 4LSRH 1Q72L 4X6FA 3RPKA 1GL4B 3TN0A 4CBPA 1T1ZA 3BMVA 3OJMB 3PHOB 5INDA 5GQBA 1FGVH 2QQQA 3VRIA 1ZT1B 3LB6C 5L8LB 4MXQA 1NCWH 2HFFB 3CVHA 3QEQD 2PW2A 1QFWH 1QFWM 3KHOA 4MJ5A 3V4UH 5CEZE 5JUEH 1JYWA 5F7EH 1CGUA 2R2EA 4HW6A 4OCYH 2E6QA 2YPLE 1T20A 3H9SD 1ZT1A 2EH7L 2LABA 2IADB 1JFQH 1CU4L 2HFFA 1LK3L 5A2IH 3IFNL 1OTUC 4Y5XB 5IG7B 2WUCH 5K33A 3UJIL 5C0RL 1CICB 3TJEL 1KSRA 4FP8H 3VMOA 2IADA 4EI6A 1S7TB 1H8SA 2AXHA 4A2MA 4C57C 5KSVA 3MMEB 4TNWK 2AJYL 4XC1L 5SX4I 5BMFH 4MNGB 5CGYC 2JJVA 2Z31B 1TCRA 5IBUG 4HUVA 1KENH 1NGQH 4G9FD 1DFBH 2EIDA 4ODTL 4PG9B 4RDQG 1QRNE 1DQLL 4L8SB 3PUCA 1CL7L 3O8XD 3QIWD 1MQ8A 1U42A 4NNYB 2IQ9L 4XNZC 4MNQD 4MNGA 5EO9A 2Z31A 2RCSL 4L3EB 4KAQH 3ULVH 1U8IA 5IK3A 3S37H 2VQ1B 3CFJA 2A1WH 2ICCA 4UT7H 1CFVL 4L8SA 1HEZB 1EFQA 4C56D 4GXVH 4IOFC 1N3NB 4L4VB 1EMTL 3B9KC 3V52L 4HWEL 5JXAH 1WZKA 3SE3A 5D7IB 2EE6A 1CQKA 2CO6B 3ELAT 4NO0D 1MFBL 2OS7A 3F58L 4L4VA 2UZIH 1B4JH 4JKWA 1C5CH 4PGDB 4IMKC 2NY7L 3STBA 2JJWA 4KMTH 2XIDA 5CCKH 4GAGL 1XGYH 1MFAH 3FZUD 2NZ9C 3ZDYF 4NQEB 1GGUA 4RGNC 5D7IA 4MLSA 4ZNEE 3SDYH 4X7TB 1PZUB 3CVIH 4QXUL 1SM3L 3WXWH 3QNZB 4JG0L 4PGDA 5F7MC 5JZ7C 5LBSL 4WWID 5E8DH 5D1QD 5HHQB 1GPOL 2NW2B 1A9BA 4Z7WE 2KZ1B 4NQEA 3S36X 1W72H 4PJ7F 3SGEI 3H9HB 3RWFB 4N0CA 1K5NA 3L3GA 3MV8B 1KG0B 2WQ8A 1S7RB 4OIIH 4LIQE 1T3FB 3QNZA 4FQ2L 4LBEB 1BM3L 1VKXB 2UZYB 4M48L 4N8CL 2RFXB 5ILTL 5BZWB 2NW2A 3CPLA 3H9HA 3RWFA 3BKYH 5FOBB 4QXGH 2HMIC 2F53D 4WUUB 3UTSB 3MV8A 1VFMA 2IBZX 3T3PE 4KHXL 5KVFL 1T3FA 3SE8L 4CW1B 3RTQC 3RWEB 4LBEA 1RV6X 4Z7UF 5IFAH 2MOVA 3L5IA 2D4DA 4OD1L 1NDGB 5HGAA 2FRGP 2C3VB 1AI1L 1PKOA 5E2VH 4QYOB 4ISVA 4WUUA 5C7XH 4OBSA 3H0TA 3OXSA 3MFGB 5CZXD 5D70L 3ZTNH 5CBAB 3QQ4B 4ONGH 5IMOB 5D2LE 5LVEA 4KRPB 1AO7D 2J8UB 1NDGA 4Y88A 4OCWL 5GZOC 3RFZC 4S2SB 3ZTJH 2JELH 4G8FB 1WJ3A 2CD0A 5CBAA 3AS0A 3IDNB 1Z0NA 3QQ4A 4OGAC 1Q9KB 5EOCL 2BNQE 1MUJB 3FT4A 3K2UL 25C8H 4NJAH 3QA3A 4HKXB 3IU4H 3VI4F 5E94A 1DJSA 1AQDB 4S2SA 2G2RB 2CQVA 4JPWL 4PJDB 1X3DA 3DMMC 5GRJL 5JA9A 3TF7A 3IDNA 1C16B 1Q9KA 2PYEB 3HR5A 4S1DC 8FABB 1OL0A 4LAJH 3D0LB 4Y19D 2BHYA 3I75A 5D2NB 1MRCH 5FYJH 2PO6B 1AQDA 5AYUH 5E24E 2AJVL 1OQXA 4WHYH 5FB8A 4PJDA 4I48A 5KVGL 3C5SB 3T0WA 3TBWB 1MWAH 5ALCH 2FL5B 3CZFB 5I19H 3BKJH 2MQ0A 5DUPL 5HGBB 1H15B 3D0LA 5SWZB 2NY1B 1G6RH 3JWOL 4V1DE 4HEPG 4L3AA 3DUUB 3HB3D 4P3CH 1JHKL 3BJLA 5KSAD 4RMSA 1NC2B 2JJSC 2MTPA 3BZEB 3TBWA 3FN0H 5K9JH 2FL5A 1LK2B 4MX7A 5LKNA 2HJKB 1U3JA 5SWZA 9CGTA 2HT4C 3WLWC 4EQ3A 1R5IB 3LDBC 2NY5C 4H88H 2OXHA 1T1WB 3NCFB 1GGIH 4FQHB 1BIIB 5DDHB 4JM2B 5FUCE 4XAKD 1MJJB 5K59E 3BZEA 5CHNB 5DEFB 4JGUA 5HDQL 4NRYB 3I2CL 4JHAL 1PSKL 3DXAA 4EI5D 3G6DH 2SEBB 1NCTA 1SJVA 4B5EA 2IAMD 4FQHA 1BIIA 4XP1L 2HRPH 5IFHL 1MJJA 2LAAA 3MA7B 1U3HD 1TETL 3GSQB 3QXTA 4MS8A 4NRZA 3O6ML 5DEFA 4N90D 4NRYA 5T1MB 3G5VB 3R1GH 1M6OB 2HVJB 1A7NL 2SEBA 3QUMB 4OM0H 5SX5H 3C5ZB 5AUMB 3KYKH 4RNRA 1UJ3B 3I6LE 2BMKB 3MA7A 2R0KL 1AHWB 3GSQA 1JN6A 4NOBA 1HH9B 4LPWA 2VXQH 5T1MA 1KEGH 3CMOH 1M6OA 1WTGT 2HVJA 3X14B 4ZUWA 5IVZB 1JGEB 3GUTB 3C5ZA 4KUCD 2O5YL 4Z76B 1UJ3A 2BMKA 1AHWA 2KQNA 5CSZB 4LVOC 1HH9A 2Z8WC 3IDGA 1J0JA 1TZGH 3BEWA 4O5LL 2R0LH 4JZNA 4YZFE 4X80L 5IVZA 4EDWL 2DQFA 4GRWE 1D9KB 4PRPE 3K46A 4Z76A 5CP3A 2FR4B 3ULUF 1YDPB 1INDL 2EIBA 5C8JB 4LF3B 4EN3B 4YIQB 1J87A 1GC1C 1AC0A 4D0CB 4UUJB 4HGWB 3TH4T 3WD5L 3QIBB 5CSBA 4JZJB 2IFFH 4TUOB 1FLTX 1A1OB 2OSLB 3VXMA 5DD6B 5C8JA 4LF3A 1F4AA 4RGNB 4DKFL 2DQJH 1EV2E 1P53A 1HIMH 1ZS8A 4OZGE 1I3GH 5GS3A 4D0CA 2N56A 4RAUB 4QHNB 2JB6B 1S78C 3U36A 1B6UA 4LCYB 3VXTB 3BE1H 4HJ0C 1HE7A 5EU6B 3GBNH 3U1SL 2EXWC 1T2QH 4PTTB 2OQJA 5IOPB 4CMHB 3UYRL 3CLFL 3VG0H 4OCMC 1JTTA 1P69B 4RAUA 4BA8A 4AG4H 1KCUL 4HF5L 1YEIH 3WDJA 5CJOL 4KI5C 1J1OH 3OB0K 2VITB 2HT2D 3VXTA 4N0RA 2CXGA 1C1EH 4JE4B 1RZJH 1JP5A 1GZQB 1CLYH 1T21A 3L5WB 5EU6A 3MYJB 1C5DB 5IOPA 3BPOB 4PB0L 3BD4A 5LXGH 1OTUD 2HVKB 1OP5H 4PJIE 4F7TB 3BWAB 3QDMB 2IH3A 4K7FA 1TVHB 5FCUL 3VFRB 3VFWB 3L5WA 2A6DB 1C5DA 1B9ZA 5I1GL 3HNTL 3U30C 4CVXB 4I2XE 5GS0D 3DECA 4TNWF 2AXFB 4M6OL 3RTQA 4F7TA 4GAYA 1EFXA 5FO7B 4P5MB 4IBLT 4J12A 1TVHA 4YHML 1O7SA 5IGXH 2YSSA 3VFRA 4OZHA 3VFWA 1AXSB 5DJZB 2JB5H 4XBPB 1K8IB 3BSZL 4JQVA 5MENE 1CDYA 4JB9H 5L8JB 2AXFA 4KQ4H 2HTKD 2Q6WB 3S35X 5FO7A 4P5MA 3BP4B 5CEYB 3DPBA 3QQ3B 3QAZC 3DVNB 1AXSA 3RWDB 5DJZA 5EBLB 4LPUA 4XBPA 5AZ2H 4RAVB 3TNNA 1BD2A 4IOFD 1EGJL 3IS0X 5F9DC 1F58H 4Y4FB 4NO2B 3B9KD 2JCCE 2WP3O 1BVKB 5CEYA 1DBJH 1LO4H 5I1HH 3DVNA 4R6UA 4KRNA 5CKGA 5JW4Q 1BF2A 3GSNA 1QHPA 5GS0L 4NO2A 1AFVH 1UZ8B 4IJ3B 3HR6A 4ELMB 3KAAA 3VFVA 3N85H 1IGJA 1VSCA 4ZFFB 2BDNH 4HULB 5EIVA 4RFNB 1A1MA 1CGXA 4DN3L 2HKFL 2NX5E 5HHPB 3OKYA 5JZ7D 3PQYB 4YR6B 1OF2B 2XTJB 4AQOA 4ELMA 1AR1D 2AK4E 4S1QL 4JN1L 3U4EB 3RY5A 1CFNB 1LO3H 4LSVH 1K4CA 3DSFH 3HI1B 2J4WH 5DGRA 3IJSA 5DRZB 3FO2B 4DKDC 3WNPA 5DRNB 1V7MH 3MLPA 2EKSB 3PQYA 4JFED 1CE6B 4D9RD 3U4EA 2FGZA 5F89A 1FZJA 4KK8C 5DRZA 1JZ2A 3FO2A 4LHJB 1INEL 2BOBB 4L1DA 4ODSL 5EIQA 1BBDH 4KDTC 3NZHL 5ITBL 4YDKL 4PRNB 2MCPL 1BBJA 1BZ7A 3THMH 3TPUA 3ZKND 2EKSA 3HPJA 3DWTA 1AXTH 3LRSB 4OJFL 1CE6A 3CIQA 3NBNA 1RUKH 3WHXB 2AJXH 1ZHNA 5EC1B 5C0AB 2CIKA 3D0VB 1M05B 1GAFL 4UTBH 3RUGE 2WINB 2EC8A 5HJ3B 4Y5YB 3G6JB 3LRSA 5KTEL 2EDFA 1SEQL 4YDVB 4P2RE 3GMNB 5C0AA 1DQQB 5J13B 1M05A 5GZOD 1N59B 2Q86B 1Z6JT 2QQKH 3DO7B 4QOKD 1AY1L 4O2EB 3X11B 5HJ3A 1N0XH 4L8CB 2I9TB 4PJGF 3UROR 4YDLC 1CXHA 1O7VA 3G6JA 1SVCP 4OGAD 3E6HA 4PY7B 3DO3A 1XGRA 3R8QA 1DQQA 1MQKL 4XVSL 2Q86A 4ZYKB 1XCTB 4YBLC 4EXPX 2YD6A 3X11A 1TJIL 4GH7B 3DMMD 2E8YA 1BQHB 5FDWB 1QR4A 4DZBB 4I4WA 4S1DD 1FJ1A 5E70A 1QTYT 1FORH 4PY7A 4XNYH 4AIXA 1J05B 4YHNA 2VZ3A 3HCVB 5HYEA 4Q9BA 4G8GE 5J6GA 5JQ6L 4FHBD 4ZYKA 1I8MB 1XCTA 4DGIL 4M5YL 5I1EH 1BQHA 4LCWE 2R2BB 5FDWA 4DZBA 3V8CA 4JFPB 1UM5L 4MSWB 4JHZA 1DBKH 3TESA 4WDIB 5CD5D 5JLZA 5FIEA 3OAYH 4JR9H 1YN7A 3ISWA 3QUZC 5IBTL 5H35B 2R2BA 3HN3A 3HZVA 3F62A 3S88H 1FO0B 4LHUG 5I1CL 4LOUD 3EOTH 4NKIH 5E99H 3FB7A 4HKBA 4HBQA 3QUXC 1OGAB 1P5UA 2CDEA 3EOAA 5FGBC 2MHAB 1P84K 3IU3B 4FQXC 4HKJB 3LN5B 3RX5A 5J9PB 3QDJA 2V5TA 1A3RL 1KV3A 4UB0H 5GGVY 2EDJA 1D7FA 5E03A 4M61B 4NM8H 3WIFB 1OGAA 4TRPL 4A6YL 4HH9B 5ICYB 4HGMA 2DWEB