3U0PA

Crystal structure of human cd1d-lysophosphatidylcholine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
273
structure length
273
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSQDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGQASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLQGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
publication title Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 273
sequence length 273
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u0pA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3u0pA01
3EBAA 4DEPB 4KRPC 1C16A 5KSUA 2PYEA 3Q3GA 1BVKB 1P5UA 2E27L 1KEGL 1DN2A 5K33A 3O9WC 3HCVB 1AGBA 2B0SH 1EBPA 1P53A 5EBMB 4PJCE 4HMDA 2FB4L 4HJJH 43CAB 4UTBH 3ARSA 3NFPA 3Q5OA 3L1OL 4XTRC 4WUUB 3E6HA 3TF7A 4YK4C 5MEQB 2DQGH 2VLRA 2VOTA 4IS6A 3KPPA 3KPRB 5A16B 1CS6A 1OGTB 1WUNT 3K4DA 4K3EH 3P40A 4MZ3A 3P4NA 4CL7A 1U8QA 1TFHA 3U46A 5SX4H 12E8H 1DJSA 4U1SB 2IMMA 4FQHA 3SE9L 1R5WA 2F53B 4HG4J 1A7QL 4YGVA 2WINB 4KK8D 4NSKA 1ULVA 3QUMA 2O5ZH 4YE4H 2G60H 3EFDH 4PB9L 3WL9B 4G9DA 3UYPA 1J88A 1VGKA 3H8NA 1T83C 4ELMF 1I3GL 1I3RB 4PBVC 3RUGA 5J6HB 3MOBL 3ARBC 3NCJH 3W5MA 4N0FA 4GAJH 1PYWA 2EDYA 1NFDB 3QIUB 4M6NH 1FORL 5IGXL 1EFXD 2IQ9H 5D7JB 3L7EA 5DDHA 2M1KA 4R4FL 4L8SB 2BXYA 1P4BL 1CF8L 4KJQC 1CDBA 3MRNB 2DMCA 2E6PA 3FQUA 4JRYB 2PYEE 2R69L 5HI4C 3T2QA 1I8IA 3MLTA 1MHHA 2WUCH 3QPXH 3S5LB 1INQB 3EJYC 4FN0A 4PLJC 3DHMA 2LAAA 1MAKA 1FNSH 4FQLL 4KJWD 5HY9B 3U6RB 4HX1A 1LMKA 3TVMB 4XB8A 2HJFB 2BC4B 3OGOE 4XWGL 2J8HA 1H5BB 3O3DA 3O2DL 2FYYA 5IEHB 4G3YH 4YQXL 2IAMB 1MY7A 3TPKA 2BSRB 4PFEA 4MAUL 5JHLH 5EZJB 4L1HA 3BP6B 4PGDA 3ULUF 2LE9A 1LO5B 3GMQB 3BKCH 2R1YB 3RDTA 4R0LC 3QIWD 2E7LA 2K3TA 3T09A 1T3FB 1OP3K 2IANB 5C0GB 5JPNA 1MCFA 1BIHA 2CUMA 3IDUA 5JW4Q 3VA2C 4C83A 1PBYA 1MCOL 2R0WH 5KSUB 3KXFB 4ONHB 3RUGE 1HXYB 2PYEB 3E0GA 5E1HB 5CLWA 3Q3GB 1SJEA 3D2UA 2Z4QA 1FYTE 2CRMA 2BRRL 1D5BB 4LL9A 4RGND 1TTUA 1UCBH 2KDGA 3NFPB 5DK3A 4J4PD 1LDPH 4FFYL 2ZCLL 3E6HB 3G5ZA 2FLRT 2W1NA 2VLRB 4NQXA 1ZGLM 4IS6B 5C07A 1UWGH 3M07A 4QRRD 1I1CA 1JPGA 5DMIL 4UT7L 4HG4K 3V2AR 1AJ7H 2QV2A 3P4NB 3MUJA 4QRTA 4EQ2A 2NY0C 2N1KA 3U46B 1HHIB 4YBQC 5MEND 1GGTA 4PRAB 3RWCA 1A6WL 1XGYH 3JWDC 1R5WB 1JYXA 2X40A 1M7IA 3H3BC 5KOVC 4YGVB 5K9QI 4L4TE 1W0WB 4NSKB 5F3HA 3QUMB 4G9DB 15C8L 1VGKB 5I1GH 2CIKA 5IBUG 4DAGH 4XRCA 3VFWA 3O11A 2VIRA 4NKOB 5FYLD 4M03A 2DI8A 4U49A 4QGTA 4N0FB 4TUJA 2MWCA 2ZUYA 1EMTL 1PYWB 3JWOC 1FNGB 4G6AC 2F5BH 4P5TC 4GBXD 1N0XL 2YHGA 3MRBB 1RU9L 1QLEL 2RFXB 1NUFA 4JM2D 3FQUB 1MJJA 2RBLA 1I8IB 5E6YA 5FF6A 3LHPL 1J10A 1MJUL 4FXLA 4JRXD 2J8OA 1CLYH 1TJGH 3PG2A 3MV8A 3KPOA 1R24A 4AG4H 4B7IA 4C56E 1QNZH 3VFPA 1N5YL 1KV3A 1M7XA 1CD1A 4TSCL 2C1PA 1KIPA 3UPAA 5EOCJ 1S3KL 5C07E 2O5YH 3D0VA 1NBZB 5D2NA 2FYYB 4NP4H 4U1MA 1PW3A 4GG6E 2VZOA 5L2KD 4FFEX 2AXGA 3ZKQD 5TH2A 4YHZL 5HGHA 4Q9CA 5L7XH 3IGAA 2YEZA 3GK8L 2C1OA 3FMGH 4M7ZB 3HE6A 4OV6F 4PJHA 4MCYA 3LQMA 4PGDB 5CKGA 4LLMB 3MCG1 4QNPF 1XFPA 1N6UA 3FFDA 3RDTB 1CICA 4P2QB 5JPNB 1V8HA 2W0FA 1LILA 2CGRH 4LOUD 2IALA 3I50L 3Q1SL 4C83B 4UB0H 1DUZA 4JQIL 3O4OB 3TCXA 3R06A 1FQ9C 1P5VA 4FG6D 4WWKA 5DTFB 1NEZA 3TPUE 4LU5H 3D2UB 2KUTA 2Z4QB 2FX9H 4QHLA 5KG9A 3BKMH 2BFVH 2WIIA 1UEYA 1XEDA 1QFWI 2WP3T 1ZTXL 1YYLL 3TO2B 3JUZA 4R2GC 1IAOA 3V52H 3I84A 3T0EA 1CGTA 5LG1A 5IBLD 2ZWLT 3OJ2C 1JPGB 3T0DA 1R5VA 4XCEA 3ZE1F 3GHBH 3OG4B 3MLUH 4OSUL 4B7LA 4QRTB 2D7TL 3B9KD 2YK1L 3RWCB 3TP4A 1FNLA 5D2NE 5FYJE 2OK0L 1M7IB 1B4RA 4N5EA 4JFQB 4NN5C 4I18C 4P48A 2XQBL 5F3HB 3VWJC 3EYUL 4JFDA 3ZDYE 3CFEB 2B5IB 4NN6B 4F15B 2XKSA 2Q86A 3G5YB 3IRPX 4PJHE 3GEWB 4OCXL 4XRCB 1IFHL 3O11B 1ED3A 3GM8A 1EXUB 3TFKC 3GZKA 4FXKB 3UTZB 2QADD 2C4XA 1NCAL 1BIIA 3CH1A 5AZEH 1UWXH 4NO5B 1MREL 1BAFL 3CU1A 5FV2A 3BGMA 2IFGA 1RURH 3E2HA 2VXUH 2CUHA 4HH9A 4K9EH 4V1DB 1OOAA 5EIIA 2WLZA 1YEFL 4YNYB 1U8NA 2BX5A 1CLCA 3MV8B 5DC4B 2DQDL 4PJBE 3VXRA 2D7OA 1R24B 2P7TA 3KPOB 2OXGA 1CZ8H 5K9JH 2DI7A 3IDNB 2AXHA 5EOQL 3VFPB 3WFCL 3CNKA 5LCVH 4P9HH 2ADFL 2C1PB 4J3SA 4OZFG 1KIPB 5F1SA 3CZJA 5KZCD 3D0VB 4CN4A 1Z5LA 2Z9TA 3KYAA 4TTDD 5EZLA 3SDDC 3HFMH 4G8FA 4U1MB 4WI5A 3R1GH 3AM8C 2AXGB 2DWEA 2EDKA 5ANMB 4YXHH 4AL8L 1BEYH 1J18A 3L3KA 5KBNC 1I8LA 2C1OB 4OLZH 2OMBA 1WTGT 3HE6B 1T0PB 1JF1B 4MCYB 2EDTA 4KJPC 1U8KA 1INDL 4JY6A 5ID0A 1DEDA 2EEDA 5AD0B 1EAPA 1CBVH 4Z77B 4I0KA 2HFGL 1CICB 2AV1A 4G8GA 3V4UH 1AY1L 2W0FB 5GSVA 1IVLA 3O2DA 2YWYA 3GM0A 3MRJB 5CJOH 2GHWB 4P99A 2GTWA 1DUZB 4KKLD 3KS0H 3R06B 2W9DH 1IC5L 4ODXA 4WWKB 3T0WA 2NPLX 4P3CH 1NGYA 3AS3A 4QHLB 4HK3J 2WIIB 4I3SH 1OGAD 3MRPA 5EO0A 4IIQC 6FABL 5IKCA 2DLHA 1G9MC 2DM3A 1TZIA 3OKMA 3T0EB 4X6BB 5TDNA 4PJ5D 3OKOA 5KS9B 4G8EB 4JANA 1ES0A 3FQXA 3LKPB 1SJHA 2C5DC 3CDFA 4HZLA 3OSKA 4N0CA 2PTUA 1TMCA 3HMXL 1A7RH 4GQ9L 5KJRH 3C5ZA 1WT5A 4K8RL 2H2PD 4ZS7H 1LK3H 1FL5B 2D0GA 2P5WE 2EO9A 3MROA 5DJ2A 1CU4H 4JFDB 4HW6A 4G6FD 1QKZH 1V3JA 1XR9A 2Q86B 1U6AL 2HTLD 4RFEB 4DUXA 1ED3B 4PJGE 2A9NL 3CIQA 3TBWB 4UOJA 3JTSB 5TPWH 1N8ZA 1S7RA 2BNRB 1T4KA 2H6PA 8CGTA 3AMKA 4JG0H 1YNKH 1BFSA 5E03A 3MJ9A 3VXUA 5H35A 3E2HB 4LNVA 1WEJL 4HH9B 4YO0A 3HRZA 4OLYL 5EIIB 4H0HB 1G7MA 5I73C 3W0WD 5I8KH 4JO1H 3V0VB 3TH3T 1U8NB 1AXTL 4OBSA 2AVGA 3VXRB 1EVUA 2P7TB 2QQKH 4CU7A 2OM5A 5C0JA 2NW3A 3P9WB 3SE3A 4KAQL 3K74B 2Q87A 1WFNA 2OZ4L 4OFDA 4MNHA 1MCSA 3C60D 3UDWA 3WSQL 1D6EA 4R9HA 3GJFB 5F96L 4UUJA 5JA8B 5EZLB 4M62L 2AP2A 4G8FB 1EDQA 1A9EA 2DWEB 3EYOA 4FQ1H 5B4MC 4P46A 2QSQA 5D2LE 1NCBL 5JORA 2BVYA 4D9LL 4HC1H 5KVDL 1OLZA 4FTVD 5HHVH 2ICCA 1FP5A 1DQMH 1ORSA 1UG9A 1U8KB 1OW0A 3DGCR 1FDLL 4L3EB 3LD8B 2PW2A 3FKUS 5DHXB 4UDUA 4UV4L 4KQ4L 2AV1B 4G8GB 1GC1C 3O3BA 5GSVB 4PRBB 5CZVL 1UH4A 2LU7A 4XPTH 5H2BA 2GTWB 4OIAA 2NY4C 5EN2A 4RGOL 1NC4B 2X4OA 2YPLE 3IDYC 4K3DL 3F58L 3QNXA 4ODXB 1KBGH 1QR1A 4WUUD 1DQDL 5I1EH 1AXSA 4PJ8A 5DD0H 3I9GL 3KPRD 4GRLA 5CD3B 4OZGA 4JKWA 3ILQD 5E9DA 5EO0B 5EORH 4OCLC 5IKCB 5JW4M 1KCRL 4KZEH 3IU3A 1X5XA 3OKMB 3S98A 5TDNB 5HPOA 4JM2F 2AJSL 1Q9LA 1DL7H 5JNYB 4JANB 1ES0B 3FQXB 1IARB 3ILPB 4CDHA 4JHBA 3SE4C 4HZLB 1Z3GL 1E28A 3ZYJA 1GJIA 1TMCB 3LIZH 3OJDA 5IW6B 3H0TA 4WEMB 3C5ZB 5E2UH 3ARRA 3RWEA 4JPVL 2VLME 4C4KT 5IW1A 3EYQC 1CGXA 3QIUD 5DJ2B 4WRLA 2DD8H 3ZZ1A 5D7JD 3VH8B 3T08A 4Q9RH 4PJIE 1WFUA 2EDFA 3WHXA 3FTGA 4WEBH 1A3RH 4JRYD 2J8UE 1AD9A 1N8ZB 3RVTC 1MFNA 3SKMB 3LDBC 4WTZA 1QOKA 2H6PB 1WQVT 3RWFB 4G6ML 4PJ7A 2WBJC 3X12B 4WU5B 1ND0A 2H32B 1QLRA 3RGVB 3VXUB 1X7QA 1DQQB 1HOCA 1U3ZA 4HQQL 4YO0B 4CAGA 2A6DA 2VSCA 3U30C 3RU8H 1YEEH 3ULVL 3OX8B 3AC0A 3TVMD 3K8MA 3V4PH 3V4VH 4S1RH 1RIVH 4NC2B 2HKHH 5E2VL 5C0JB 3MLVL 4N68A 4ODBD 5GRUL 4YDJB 1VKXA 4PV8B 3R0NA 2IADA 1AI1H 4GFTB 4HT1H 1CLOH 4U1JA 3WFDL 4GRMB 4PGBA 4MNHB 3QG6B 1D6EB 4TVSa 4R7NA 2OP4H 4UUJB 3UJJL 3RY4A 2XZQL 1HYRC 3MOAH 4P46B 5JORB 4N0UA 2IAND 3QCTH 4P2OA 1K6QL 3BX7C 3CFCL 1ORSB 3ZDZF 4I0PA 2E9IA 2EH8L 4X4ZA 3T0BA 3B3IA 3VXQB 2PW2B 2PYED 4UDUB 3D1MC 3BZDA 1NLBL 4L29A 2I27N 1V5JA 3SKJL 4NJ9L 1HNFA 1Y18A 1FVDA 2DQHH 4WY7L 3U0WH 5CJXA 5EN2B 2ZUQB 5KSBA 1IGIL 1MF2H 3QNXB 2XV6B 1CLZL 5FK9B 5TF1H 4PJ8B 1T7ZA 2VLRD 4XVJH 5FECA 3OAZK 3HAEA 3PNWB 4OZGB 5EA0L 1F00I 4GLRI 1UKQA 5E9DB 1U91B 1D5MA 2NZ9C 1N2RA 1MHPL 1OAZH 1LEKB 3IU3B 2X4PB 4JO4H 5HI3C 1CXFA 2EDLA 3GSWA 4XP1H 4KWUA 2ARJA 3THML 1VEPA 3EYSL 1Q0YH 3VGAC 2C3VB 1DP0A 4XMPL 3PABA 3KLAB 2VXSH 1UZ8B 3Q5YA 3TO4C 1WWBX 3O8XA 4HBQA 1E28B 2DQJL 3NOIA 1X6NA 2IJ0C 3OJDB 4ZFFA 4K3JL 2HJKA 2DAVA 3BAEL 1MQ8A 3H0TB 4MNQA 4LBEA 2R0ZL 4Y88A 3ARGA 5EZIH 1HQRA 3FONA 5IW1B 3IXAA 4E9LA 4QF1B 2QJDA 3QUZC 2UUDK 3WHXB 2W9EL 1XZ0B 3FTGB 3U7YL 1ZLUK 1AD9B 3VGFA 3HMXA 1A22B 2DN7A 4PJ7B 5FEBA 3WHE0 4I0CC 5JIHA 2XN9E 1QLRB 3G6JA 1X7QB 1HOCB 5HDBE 2A6DB 1VA9A 5BO1H 5KSBE 5LQBH 4AJ0A 1KN2L 4X98A 4OJFH 4BUGA 4DGVH 2D4DA 3QEQB 1N5AA 5AG8A 3HG1A 2CIIA 5HGGS 3EO9H 1S7XA 4JHAH 4ETQA 4FQXA 1G0YR 1RZKH 2AEPL 2VSDA 3I02B 4XAKE 1GGIH 3QR2A 3SGEH 3D5OF 1VKXB 3MRDA 4N8VG 5I8CA 4HBCH 1MRFL 2R4SH 4FRWA 4U1JB 4PGBB 2IG2H 4OZ4A 4Z5RA 2I60H 3JV4A 1I9JH 2DBLL 2DMKA 1KG0A 2FEDD 4L3AA 4HIXH 3RDTD 3WFEL 4N0UB 4G43A 4P2QD 2DIBA 3RPIA 4BSJA 3K4AA 5F9JA 1HKLL 2KKQA 1MRDL 4XPHH 3ZTNH 3GKWH 4WFGD 4X7SL 4X4MA 4QHNA 1FNEA 2OZ4A 4L29B 5DVOA 5IVXA 4XPAL 2WUBL 3D2UD 3HE7C 4WO4C 1FVDB 1JNNH 2VDPH 1FH5H 1ZLVK 1UM4H 4I5BB 4ELKB 4JZJB 3EO0B 3RKDD 3WS6A 4KU1A 5FCUH 1ZLSL 3L3IA 3JTCA 1U3HB 4Y2DA 3WXWL 4W70A 5FECB 5C07D 1MNUH 3HAEB 5D71H 2OQJA 3FFCA 3G5XA 4CMMA 3LMJH 4NCC2 2OSLB 4MHHI 3UMTA 3B2UC 1N2RB 5ESVA 4WFFE 3GSWB 4LSQH 3AGVA 3REWA 5GGRY 3DJ9A 1IRAY 1YC8A 2H26A 3S3JA 1KTLB 4GQPH 3PABB 3WFZA 3CFJA 5D7SH 3ZKND 3P0YL 1YEIH 5EIVA 5KN5A 3I6LE 3UZEA 5DRZB 3QEUA 32C2A 4ZFFB 4MNQB 1E4XH 3ZKSD 3O2WL 4LBEB 3OV6A 4RA0C 1GAFH 3ARGB 4WWID 1IGYA 3L6FB 1HQRB 3PQYE 1KB9J 1KTKE 5DD3L 1SMAA 4LSVL 3IXAB 3QCVH 4MXVF 5JLZA 3RI5F 3SPVA 1MJ8H 2ED8A 4D3CH 2EZ0C 1YEJH 4QY8B 5DFVD 4BQCA 4V1DD 4X4ME 5LXGL 4XHJD 3SQOL 2MKWA 5IVXE 3DSNA 4U1IA 1F90H 4PYGA 1CK0L 1GHFL 5IROA 3MV8D 5BMFH 3S35L 2NTFB 4IDJH 3G6JB 3ECBB 2OR7A 5CEZL 4KDTA 4N1HB 3N1PC 4J2XA 2BVOA 3PWVB 2AI0H 3BMVA 5C0EA 4X98B 3UAJD 1M05A 1ZMYA 5DHVB 1YEGL 1N5AB 4HLZH 1FJ1A 3HG1B 2CIIB 3UPRB 3FFCE 1BP3B 3WN5A 2ZPKH 2H1PH 3BSZL 1S7XB 3OHXA 4FQXB 3GSNL 3TIEB 1HQ4B 3FHAA 4BSWA 1FNHA 4WFHE 5T5FL 3JWOL 5TE6L 3L5XL 2AQ3A 3HE6D 4Z5RB 2J5LC 3JV4B 3PL6C 4U33A 1KG0B 1WICA 4LPWA 1KCSL 4YXLL 4Q6IA 3BYTA 2H8PA 4JFEE 2KPNA 5ACZA 1IT9H 1CICD 3O45A 4X9FA 3L5IA 5IOPA 1XF1A 3ZKMD 4XT1C 5TGBB 5C0FB 5F9JB 5JDJA 5L9DH 1AQKL 3P0VH 1VGEL 2CKBL 1G9EA 5DGQA 4X6CB 4PR5A 3IFNH 3GSQB 4WWKD 3K8LA 1NFDF 3VRJB 4GRWH 3U7WH 4RIRA 4Y2DB 1FFNA 2H3NB 3T0ED 4OIBA 3S36H 3CX5J 1AR1D 2O93L 3ZE2F 1OAQL 2FJFA 3V8CA 4AYFA 3EJZD 2GKIA 2K7QA 3EIFA 1WAAA 2PKDA 1IILE 1NBYB 3G6DH 3VDCA 2GJZA 3QPQC 2YRLA 2H26B 1MCCA 3CFJB 5E8OA 1DQTA 1KB9K 4JFDD 32C2B 5IJKC 3OKYA 3ALPA 5D72L 3ULVE 4MLSA 4LVOC 2WIMA 4WIQA 5FKAA 1KELL 1WFTA 3B9EA 1DUYA 1REIA 4L9LA 1BWMA 2R4RH 3SPVB 3T4AB 2I26N 3X3FL 3H7LA 3KJ6H 2UY7A 5CUSH 3QG7H 4MQTB 3EOTH 1PEZA 3JSSA 4P4KA 4OD3L 3MRKA 4RAUA 5HVWA 2QSTA 4O00A 5HI5D 3VD7A 4HJGA 4U1IB 1IQDA 4EUPG 1ERNA 2VNCA 3ORJA 3VXRD 4G6KH 1JHTB 2UWEA 3C8KA 1J5OL 2BVOB 2Q6WB 5C0EB 1HSBB 4HKJA 1F58H 1M05B 4HWBL 2MMXA 1FJ1B 2ZUUA 1U41A 5FYKU 3R8BB 3TC9A 3ULUH 4HSQA 2EDDA 1RVFL 1QACA 3MA7B 3GGWA 5FO8A 1MCQA 1WZMA 4DOHE 2ZOLA 2X9YA 4JKPH 1OCWH 4K23H 5T5NF 4N1CA 2ERJB 1AGEA 1UENA 4DGYH 1JRHL 4S1SH 4L3ED 4U6HB 4Q6IB 4MJIA 2H8PB 2ICWA 5JR1L 3O45B 4G8GD 5CJBA 3QQNA 4OCYH 3H2WA 4E0RA 2Z8RA 3SHSA 4M93B 1XT5A 1KYOJ 4UOW1 1UACH 1E6OH 3WIFA 1FLRL 1NC4D 1BMGA 2FEEL 1BECA 5BOPA 5GRXG 4S1DD 4AIOA 3MLXL 1MCKA 4D0BA 1OP5H 2PW1B 1QRNA 2VTFA 3CX5K 1XR8A 4ODSH 1NDGB 1JNLL 2VDQH 1EO7A 1VFOA 3FRPG 4APQC 3CVIL 4RIRB 5DUMH 5BCAA 3GMMA 1FFNB 5F3BA 1N59B 2DDQL 3RTQA 4FNLL 1P7QA 1ZS8A 5T3ZH 2FJFB 1C08B 2ITCA 1S5IH 5CGYD 4OIIH 4Y7MA 2UWEE 1F3JA 5BZWA 5MHSD 4QRQA 3BIKA 4N0CD 2GJZB 4OZIB 4WCYL 2EYSB 3C5ZD 2F8XC 1B9ZA 1I1FA 2AKRA 2R2CA 2R0KL 1IAIH 4JPKH 4LLDA 5E8OB 3VRLE 4KMTH 2KL6A 5ITFB 4X83A 3VFGH 1TCRB 1MCDA 3ZSTA 3IFLL 1K9TA 1QBLL 3W82A 4OUOA 5L88L 3CSYB 4KTYA 1C7SA 4ACPA 5FKAB 1MI5A 1DUYB 4MD5A 4LARL 2MQ0A 3NAAL 5E2TH 5GGTL 4LQFL 4KRPB 3RGVD 1RZ8B 4HGWA 3VXUD 1QD0A 4FS0A 2W92A 4EDWH 4RAUB 1EJ6A 2ICWJ 4C55A 1MCJA 4O58L 5J11C 1JF5A 1KLUA 3B4NA 4NNPL 1B4JH 3FT2A 4HJGB 3UBXI 1UFUA 4Z7QE 1H3PL 3C8KB 1H8OA 3V95A 5GGVH 3ZMRA 4YK4B 2QTEA 2W60A 5DJ0A 2JCCA 3BD4A 3U9PL 2VXTL 2Y36H 4HUXA 4U1HB 4H0GA 3PWNB 4DVRH 3GGWB 5FO8B 2MCPL 3TJEH 3CJJA 2ZOLB 1WK0A 2V5TA 4P46D 3T65B 5KVGH 4NDMB 4OF3A 4GAGL 4I48A 2FJHA 5IR1A 1DVFC 1KYOK 2R23B 1P84J 3DSFH 4MJIB 2ICWB 3JV6A 5GHWH 4WV1A 4EN3A 3I85A 5HTSA 1UZ6F 4E0RB 4O9HL 1VADB 3GSNA 4JO2H 3RJQB 4ZS6D 4K2UH 3WIFB 4CU6A 4JDTL 1DBJH 2ARJQ 1MI5E 3M8OL 1T7XA 4P5TA 1IGCL 4PJ8D 1FVEA 1CGVA 1QRNB 4HH8A 2YWZA 3KLHD 1XR8B 1G7HB 3VGDA 5B22A 2KZ1B 5E9DD 2F5AL 2Z8SA 1ZHNA 1PLGH 1EERB 3GMMB 3H9YA 5F3BB 1Q72L 1E4KC 3T1WA 3BISA 3RTQB 2B4CC 3V5HB 3N9GL 1P7QB 2CKBA 2OTWB 1ZS8B 1UWEL 4JREC 1I8KB 3N1GC 1RHFA 3SDYL 5HYJE 4JQXC 5MP6H 5BZWB 1G7LA 4GKSA 2VDOH 4NQDA 1PG7W 1SY6H 4QRQB 1GC1L 3BIKB 5I1AA 1JPSH 3IKCB 4ZTPL 3VD9A 4E41B 5DJCA 1RV6X 3VXSB 4LVNB 3BZ4B 1EHLL 3HI5H 5EZOL 3SGDH 1A1NA 3S4SG 2DLEA 4MVBC 5DMGC 4JKMA 5JW4N 4XI5D 1DFBL 2O5XH 3MJ6A 1HCVA 1HWGB 3U83A 4HXBL 3V6FA 4R0LB 2K1MA 3B5HA 2CMRL 1GCFA 4MQXC 1MIML 2CDGA 2Z8VC 4MD5B 4OKVA 3QFDB 4HGWB 1EK3A 4LPTA 4UZGA 3MXVH 4MS8A 5DC9B 5ELIA 1KLUB 3MGAA 4QHUB 3QI9C 3FT2B 1BJMA 2XA3A 3QEQD 2HKFL 2FBJL 4OLUL 4Y4HC 4IDLA 4LFHG 2Q20A 3RA7H 3WKML 1GVIA 3ROOB 1D9KC 3IKKA 2G2RA 2W60B 4RISL 5DJ0B 3FQWB 1TQCB 1IC7H 4Y5XC 2JCCB 3NN8A 3Q5TA 1SVZA 1BQUA 4HUXB 1HHJA 5LGHL 1WITA 2GY5A 1CE1H 1FPTH 1H3UA 5KS9F 1MWAL 3OF6A 1P84K 2BJML 4YR6B 3MGOA 2X10A 2B1AH 5D5MB 2NY0B 5F7KC 3H7BB 3X13A 4I48B 3W9EA 5DEZA 2FJHB 5TFSH 5IR1B 4MA3A 5KVMC 2EC9T 5TE7L 2DKUA 4NC0B 4FFVC 1K8IA 4QXGH 4HWBA 4WV1B 1JWSA 4EN3B 2GJ6A 1CFVL 1NCDH 3GSNB 4XNXL 3QO1A 4R90L 5ADOH 2VDML 4O5LH 4U0QB 5HPMA 1JK8B 2F19L 4LSRH 1U3HD 3GBLA 4DKEL 1ZSDA 1UA6L 1U2CA 4P5TB 1EHXA 1TETL 2GTZA 3U36A 1FVEB 4U3CA 4QO1A 1J8HA 5IG7B 2Q8AH 1J0JA 5CGMA 5H37G 5I1KL 1RUPH 4AEIH 4DKFL 3FCTA 2CSPA 2X4TA 4Y4KA 1ZHNB 2APVA 2A6IA 1JGLH 1MQKL 3WD5L 2CKBB 4QWWC 2H41A 3ULSA 1I9RL 4K07A 2DQIH 3CSPA 4EQ3A 5DRWA 1G7LB 3CK0H 4GKSB 4IMLA 1F4AA 5JUEH 1U8LA 1AD0A 4NQDB 4O2FA 1CGSL 5JO5B 2DMBA 5ESAA 3LAFA 5I1AB 4O2CB 4EOWH 1T2QH 1JFQH 2PXYA 1IGML 1RJZA 5DJCB 4MNQD 4I3GA 3PJSA 3ARGD 3F7PC 4KVCL 3DMMA 3MCLH 5BS0B 2FO4A 4K9EC 2BMKA 1CIDA 1OPGH 1AGCA 2YD6A 1KCUL 4M7LH 4Y5YC 3UJTL 4HCRL 4H5SA 3V6FB 4KI5E 3UP1A 5IQ7H 1GIGH 2IQAA 4OFIA 4NRXA 4CMHC 3MC0A 4OKVB 1YY9D 2JB5L 4KHXL 3X14B 4NQCB 4P9HC 3UC0H 4PJFE 4M43L 2X7LA 2VMFA 4LSTH 5ENWB 2V2WA 3W11D 3KS0J 5EWIH 3TCLA 1GZQA 3BI9X 3MFGB 3HG1D 4LRIC 1W8NA 3OKLB 2BVPB 4TSBH 4X6DB 4R2GB 4PJDE 4YX2H 2QKIB 4FQXD 5ALBH 2R8SH 3UYOD 2G2RB 4MDIA 5JOPE 5GGTA 4JO3L 4M7KH 2OR9H 3NN8B 2GI7A 4JDVA 1T5WA 1HHJB 4KI5C 1CE6A 4WW2A 1A0QH 3FQTA 3VWKA 2XRAH 3MGOB 1J05A 4WHTA 3HHRB 3X13B 3V5KA 3W9EB 2VZUA 4HS8L 4Z0XA 4MA3B 4CDGC 2FGWH 4IRZH 4NN5B 3BRFA 2AJUL 3VWJB 3AY4C 1U95A 3HNVH 4I4WA 4IRSC 5FYLH 4XMKH 3U4BL 3UZQA 3GMLA 2GJ6B 3S97C 3KVQA 5LWYL 5J13C 1I4FA 3D25A 3QO1B 4JPIA 4M1DL 4N0YL 4X4YB 5HXMA 1NUGA 3BKYH 2EEAA 4TUOA 2FO1A 3MRRB 2IH3A 1CYGA 1MFDH 3FO9B 1YEKL 4HF5H 1ZSDB 1CDIA 2FX7L 4Y2DD 4MD4A 3TT3L 2GTZB 3WXVH 1JUFA 4KGLA 1I7UA 2DQTH 5C8JA 4TUKH 3CVHL 2DM4A 3D9AL 4D9QE 1J8HB 3KPSB 1UEMA 3DUSA 4N8VB 3VI3E 1XGQA 4Y2OA 1JNJA 1F3DH 1UCTA 3FCTB 5T1LB 3HB3D 2NY2C 2X4TB 1NBVH 1B2WL 3V5DA 1HDMA 1AIFA 5IB1A 5JW4R 3ULSB 1H3TA 3QDGE 5E6IA 1NGWA 2NNAA 3SKOA 4X9HA 1A6UL 1YPZE 5DRWB 4J6RH 3V0AC 4Y8AA 4YDLC 4IMLB 4EBQL 1U8LB 5D8JL 2A9MH 4UTAL 2PXYB 3T3PE 3SDDB 4NHUE 1Y6KR 5TQ2L 5IIEA 1FBIL 1MFCH 1KTDA 1UVQA 3PJSB 3ET9F 3WLBA 1S7SB 2W91A 3DMMB 3NPSC 4YFEA 2FO4B 3QRGL 5HHOB 1AGCB 1NCWL 5J12B 2XQYG 4Z0BL 2IH1B 2Y7QA 1R3KA 1CDHA 2IQAB 5IMKB 5FO7A 3U2SA 3GSUA 1PG7X 1CXKA 1J7VR 1BQLL 3NA9H 1CL7H 4H20H 1CN4A 1NJ9B 4LLUA 4DVBA 2X7LB 3U0TA 3BPCA 3ES6A 4NT6A 1JPTL 5TQ0H 2IPTH 1R3JA 3TCLB 5MEOB 1GZQB 3K0WA 4LSSH 1Y0LB 4JCLA 4F37K 1SEBA 4IIQB 3GO1L 2VZVA 3DUHA 4HK0B 1F4WL 4L8CB 4OZGF 1GGCL 3QEHA 1IBGH 1RFDH 3BP7A 4MWFA 1Q0XH 3MRHA 4K7PX 4M61B 1WWWX 4MJ5A 4M3JA 3GI9H 2D7NA 2WQ8A 4JDVB 1JTTA 1T5WB 1D3CA 4BZ1L 1BZQK 1CE6B 4U1NB 4WW2B 3ULVD 1B6DA 4K94L 4LSUH 1PDKA 1JWUA 3P4OB 3SE4A 3VWKB 4LRNL 5E1AA 5JQ6L 1J05B 4YFLF 4AEHL 5M95B 4I13B 4KROC 4Z7WA 5ADPL 5D70L 3GNML 4XVUD 5A2FA 4MQ7B 2ARWA 1CD0A 1QA9A 2HT2C 3MREA 4PUBL 1U95B 5GZOD 1KB5H 1AO7B 3KPNA 3H3KA 4WI9A 1S8DB 5T3XH 2MFNA 3I6GA 1I4FB 3D25B 1MWAA 2IH3B 2PF6A 2ESVB 1QVOB 2P45B 4R6UA 5HHQA 1HIMH 1C5DA 3SKUD 5I1HH 5C8JB 1I7UB 3QZWG 4KY1L 3SEPA 2WWMC 1KFAH 1T66D 4PJ7F 1NGZA 2CJUL 2HH0H 5I73B 1JFMA 1HZHL 3GIZL 2AXFB 2P8LA 2XY2A 1HDMB 4F7MA 5FUCE 5F7EL 1JVKA 1WF5A 5IFHH 1OTUC 2Z0BA 3AAZA 4XCFH 5E6IB 2IPUK 4YXKH 4WNQA 3WS3B 4R96A 4A2MA 5DEFB 3MLWH 5C09A 2X4SA 3MUGA 4LCYB 4H8WL 4IOSD 4QTHA 4I3RL 1DSFH 2VLJB 4RAVA 3MGTA 1A6VH 5I1IH 1CVRA 3DV6A 1C7TA 1UVQB 4W4OA 4ZO9A 4QRPA 5I9QB 4R8WH 3B2VL 3CDGA 1JWMA 4P49A 5C0AE 4JFPA 1QFWL 4Z7WE 3T0AA 5FV1L 4KRPD 2F74A 3OXRA 1MCBA 2XG5A 4PLOB 4YHLH 5FO7B 1KJ2L 2EH7H 5F7DB 3U2SB 3GSUB 4HFWA 5I66A 2P49B 4JY5H 1KF9B 5IP4A 3GBMH 3HPJA 3PDDA 4OTXH 1B0GB 1JIBA 1RZ7L 1U42A 4HWNA 3MRMA 3ES6B 4NT6B 3BRGC 3N1FC 2A1WH 4HCRA 4L5FH 4P23C 3S37L 3DETC 5CKAA 1LEGB 1SEBB 4WFEE 4NKDA 1LP9E 3STLA 3QEHB 3BP7B 2J3SA 4MWFB 3DTXA 1A6ZA 4OAWA 2KH2B 3MRHB 2YZ8A 3TYGH 4KKAC 3K1DA 5D7KE 4KK6C 1XF4A 4P3DA 3JV0A 1FZOB 4GXUM 3OZ9H 4RFOL 1JZ8A 1JWUB 1J86A 2R2HA 3KPQA 4MJID 4KQ3L 5C09E 5E1AB 4OGXH 5DWUH 2QSCL 4H1LH 4PB0H 4P5KA 3ARWA 4GAYA 2YD3A 3IU4H 5DK2A 1QA9B 5KTEL 4R26H 4KTEL 4KVNH 4QRPE 2Y06H 4G6JL 3ARTA 3OR7A 3DX8A 3I6GB 3BDYH 4FZEL 1QRND 4G8IA 4Q2ZB 1A4KB 4KJQD 1MWAB 3D48R 3KPLA 5HI4D 4JFHD 3NVQA 5FHAL 1K5NB 3SJVE 3U4AA 5HHQB 2VE6B 4YFLI 4LQ1A 4YUEH 2WBJB 1ZLWK 1A6TB 3TJHC 1E27A 3RTQD 1P7QD 4UAOC 4YHOH 1NGZB 2NY6C 3U30B 3T8XB 3G6JF 5A3IC 3DECA 4OCRH 2P8LB 5GJSL 5C70A 3BRDA 1KCGC 1TVHA 4LDEB 4E41D 3QIBA 4PGCA 4WNQB 3VXSD 1INEH 1I3VA 1LO4H 4KXZH 4ESKA 1TZGH 2X4SB 1I3UA 3MUGB 4X5LA 3CVHA 2D7MA 2EIDA 1S78C 3B9AA 4QTHB 4F9LA 4NWUH 3PP4L 3MGTB 4IEFB 4U3XA 3VFSB 4Y16C 1X5KA 5BVPL 1Q9KB 4Q0XL 1JWMB 2XPGA 4AMKH 2Y6SC 5A1AA 1J1XL 3SDAC 3BYYA 4C4KO 4K7PH 1VENA 1N7ML 3OAYK 4FQJL 4JLRB 4YPGA 3SCMC 4ODVL 1IC4H 1X9QA 3OPZH 4WO4A 5I66B 4PRDB 3HC4L 4X6CF 1UXSA 5CZXD 3EYFA 4JAMB 3O4LB 4YHML 3HPJB 4HKXB 4MCZA 5J8OA 3MRMB 1MFAH 1CR9H 4ENEC 4PG9A 4OV5A 1S7VB 4XCNA 2CH8A 1ZEAH 1SEQL 3MLZH 1CXHA 2DLGA 2F54B 3CLFL 4IOFD 4JFXA 4M5ZH 2IPKA 2V5MA 1EGJL 4ZYKA 2VAAA 4NKDB 1G7IA 4G7YH 4MD0A 3STLB 1A6ZB 4NZUL 4OAWB 2NY0D 1OP3H 4Z7NE 4ZDHB 4YBQD 3QHFH 1G6RL 2NYYC 3E6FA 3P73A 5CEZD 1XF4B 4P3DB 4M7JH 1A6AA 5DMJB 3KPQB 1TJHL 4XP4L 2I5YL 2FL5A 2NX5E 4EN3D 4N1EA 2XTJC 4UIKH 4O4YL 3GIVB 2Y4SA 1F02I 4JQVC 3ZT5A 4GAYB 3V6OE 3F6IA 3WNLA 5GGSA 3DVNB 1OP9A 5DK2B 5D6DC 1X5ZA 4N90D 2W07A 1RPQA 3T3ME 2EDQA 3C2AH 4G6AD 4Q7DA 4PJEB 4P5TD 3OR7B 4S10A 3DX8B 3WLWC 2H2SC 3QDMA 3KDMA 3KPLB 2V2XA 5ISZB 2R1WA 1P1ZA 1TVBA 1ZVHA 3O6KL 1FIGH 3D3VA 2BDNL 2R56H 4EIZC 1MCWW 5L6YH 3V9FA 1WIUA 1X5AA 1CDJA 2DL9A 2E3VA 3AREA 3P4MA 2DIJA 1OT1A 2BSTB 4ELMA 1W2KT 4M00A 4UQ3A 2VWEE 4NQDD 4PRHA 1JJUA 4HWEH 1TVHB 5HHME 3BKJL 3QIBB 5E2JA 4M7LT 5LBSH 4RRPA 2JELL 5BQ7A 3A6CL 3KLDA 1NH6A 4Z95H 5BS0D 4RBPK 4P9MH 1I75A 3DRTB 3TT1L 1AFVH 3L95A 3PL6A 4XPGH 1AJ7L 3O0RL 1IGFL 3WUWG 3L9RA 4DWHA 4JZNA 5ALCL 4PY7B 5BXFB 5AEAA 4LSDA 4FFZL 4HMCA 5GISH 3AU1A 2ZOKA 2CLVA 2B4CL 1XIWC 3O6LH 4LAQL 4NQCD 5EU5A 4PJ9C 4JFZH 5D7IA 1WBZB 5L2JA 4YPGB 3BEVA 5D7LA 3IAQA 25C8H 4MS8D 3PHSA 5KVEL 4ONFL 5HYSA 2AABH 1BZ7B 3HE7B 4WO4B 3DV4B 4DGIL 1UXSB 5DQJA 1MEXH 3HZKB 3EYFB 4YFDB 3M17B 2UYLA 3QDME 4R2GD 2ZUSA 4MCZB 3MV7A 4OV5B 4HK3N 3PGCB 3PDOA 5I30L 4QXUH 1OSPH 2DJ4A 3EHBC 4JFXB 4OD2A 3LRSA 3S4SB 2VAAB 1KJ2A 3L5WA 1G7IB 5KVFH 4HJ0C 1CLYL 3OF6D 5C71A 4ELME 2ICES 4NM4H 5I1CL 3NIGF 2F9BT 4JB9H 4OFYA 3HMWH 3QUMH 3VFNA 3P73B 1WAAF 1DQJA 1PKQA 1L0XA 4OZIF 1A6AB 1NC2A 4TULL 5DJZA 3IB4A 1FSKB 2LVCA 2KBGA 5SX5K 2GJ6D 3V0WH 5F7WC 1B3JA 3HZMA 5B39A 3MLSH 1KC5H 5GGSB 3VD5A 2OL3A 1U92A 1KT2A 5DFTA 4DW2H 1KSRA 1RZJH 1TTGA 1PZ5B 3BUYA 3TNNA 1VACB 1J8HD 1U8JB 3KPSD 2W38A 3KDMB 4KDWA 2V2XB 2R1WB 3U4EA 3QDJA 1JGVL 2QQNH 5T1LD 1P1ZB 1TVBB 5EB9A 3VI4F 1I1AA 4E42B 5D1QC 2EXWC 4C59B 3D3VB 1BBJA 4PRIA 5E00A 2X9WA 4J1UA 1JMXA 3H9SA 1QTYT 3P4MB 1LEIA 3KHOA 1UXWA 1S7UA 3SOBH 3VG9B 3JV5A 2OTPA 2BFVL 4UQ3B 1JPFA 2E9JA 3JWNC 1JZ3A 4F8QA 3ULUE 4PRHB 5B21A 1CDCA 4O51A 3V8OA 3V52L 3MLYH 2PXYD 5DJ8A 3SDDD 4MAYA 2YN5A 3FOMA 3IRZA 4LCCC 4D0CB 3DMMD 4F80A 5HHOD 3SKNA 1V7NH 4LGSB 2J5LB 3PL6B 4BQBA 4KJPD 4X0KA 5DQDH 1B6UA 5FM8A 5I15L 3L9RB 1RAMA 1NMAL 4JZNB 5JW3L 1YEHH 4AY0A 3NACL 2NCMA 2VDLH 4OCSL 5E08H 5I1JH 2AJVH 4X8XA 3AU1B 2ZUTA 2CLVB 5EU5B 1MOEA 5D7IB 5L2JB 1CI5A 3MRLA 5EOCH 2R15A 5D7LB 4NWTL 4U1GB 2N4IA 3ULUC 1ZGLA 1BM3L 1F4YL 1MCPL 5HYSB 1QFPA 4JFOA 2CK0H 3NTCH 4ODTL 5CBAA 2UYLB 4Y4FC 1J87A 3MBXL 3MV7B 2ZCHH 4WENB 4Z8FH 4RMSA 5DD6A 3TGXA 2VXUL 1I85A 1T0NB 4LF3A 4PD4J 1OARL 5F1OB 3WDIA 3LRSB 4PRIE 1RJLA 2O61A 1WV7T 4NCC1 1XF5A 3L5WB 5LGJB 5EO9A 1DQLH 1GRWA 3VWKD 1A14H 1T2JA 1TNMA 1NMBL 1A3LL 1ACYH 1CZ8L 3BDXA 1A02N 4I77H 3VW3L 5IB4A 3VFNB 5KAQG 4JHWH 1PKQB 4OF0A 1FZJA 3UYRL 1LO2L 2VAJA 4LSPH 5CZKA 5F71A 5DJZB 1AO7D 1RK0A 1EGJA 5ACLA 2FIKA 5E99L 3UTTE 1IEAA 3HZMB 5B39B 5E2WH 4LVOB 2V17H 3OB0K 4GUPA 2ESVD 3KYKL 1FNFA 1WFOA 1G6RA 2OX5A 4NJAL 5IQ9A 4LKCB 3M45A 1KLGB 3UCRA 4FQCH 3C09C 4YHPA 4MMXC 1F45A 3P9MA 4P0DA 3QDJB 3QQ4A 3N85H 4Z7VB 1MUJA 5EBGA 1K4CA 4YAQA 2QR0A 3IDJA 1RUQH 3CMOH 4UILL 1BBJB 5GZNC 5E00B 3H9SB 3UEZA 3QYCA 5E6ID 3WIIL 4NKIL 1LEIB 2EYTB 1UXWB 3TA3C 3FQNA 1JPFB 4I3SL 4TPRL 4JGJA 3RVXD 3FN0L 1D6VL 4G9FE 4ZAKC 4TN9A 4QNPE 4MB4A 1RUAH 2VLJD 2JCCF 4MAYB 3UJIH 1QHOA 4HPYH 4MA1B 1CQYA 2YS4A 4Q6YA 5B4MD 4HUUA 1HSAA 4UT9H 3RWHB 4LHUG 4HMEA 1V7MH 4EDXB 3AS0A 2VLLA 1DN0A 1S9WA 3O3AA 3C9NA 5D5MF 1BOGB 3NFNA 1KJVA 5DEGA 1I8MB 5GGVY 1EH9A 1RIHH 1H3XA 1Z6JT 2JJUA 1OAUH 2ZCKL 1FAIL 5GJTH 2HTKC 5CJQH 4AH2A 4ZS7L 5DT1L 2GSIB 1I7TA 4XP6H 3WFBL 4DN3H 1Z9SA 2GCYA 1DLFH 1JE6A 1YYMH 4S1QH 3LEVL 1MCNA 4JFOB 2F15A 2DYPA 3CX2A 3ZE1E 5CBAB 3OKEB 3FAWA 4PD4K 3SE8H 4MA7L 2VDNH 4IJ3C 1IZKA 5C6TL 4APQB 2X09A 1YNKL 1BF2A 2E27H 1KEGH 2A83B 1F2XK 3OTTA 5DD6B 2Z31C 4J3VA 1RJLB 5GSRB 5FUZL 4PRPE 5CD5D 1FG2B 5FHBL 3QCUL 3U9UB 2FB4H 5EO9B 3D85B 1RHHA 3L1OH 4HUWA 5AWNL 2Y9RT 5ILTL 4JFYA 5I2IA 5C9JA 3UBXG 1WTLA 1GGUA 3IJHB 5FOJA 4PP1C 1G9NC 3EYQD 3FT3A 1FZJB 1EFXA 1JGDA 4KRLB 2ADGA 3PXJA 1XGTA 1RK0B 3ZHKA 4YWGL 3OKNA 2EIZB 1S5HA 1IEAB 5CS7A 5CBEA 3D69B 1I7RA 4POYA 4J3OC 3FT4B 3SE9H 4LGRB 1A7QH 4GW4A 3RVTD 1LNUA 3RY6A 3ZDXF 4OGYH 5IQ9B 5K59F 2WBJD 4PB9H 1KACB 1HH9B 1A4JA 3SDXA 4YHPB 2BHYA 1I3GH 4FQPA 2YD4A 3P9MB 5J11B 3QQ4B 2EO1A 3MOBH 4XP9L 1K4CB 1T1ZA 3SN6N 4YAQB 2WQRA 1FORH 1P9MC 5IGXH 2VC2L 1RK1A 2QR0B 2BY1A 4WJ5A 4L8DA 1KIQA 4R4FH 4W6YB 5D7KD 1P4BH 1CF8H 3LKSB 3LS5L 1GOFA 3PV7A 3R4DA 2NR6C 5DD0L 4LPCA 4GG6F 4X6DF 3EOBB 3FQNB 4JM4L 4OD1L 3NH7L 1YMMA 3QUYC 1AQDB 4WHCA 1D5IL 4GKNB 4UV7L 4LIQL 2DLFL 1R3LA 4FQLH 5GGUA 1HSAB 1YY8B 2HYMA 2OLDA 4HV8B 3RNQB 5DJ6B 1J1OL 3HZVB 1ZT7A 4XWGH 2HVJA 2VLLB 1HKFA 1DN0B 1S9WB 3O3AB 1MIEL 3C9NB 3O2DH 3NFNB 3SBWA 1KJVB 3T2OA 4HGMA 4NGHL 4YQXH 3VFMB 1ZOXA 2BRQA 3TBSA 1W8OA 2P24B 4RZCA 4MAUH 4AH2B 1GPOL 1CTOA 1CD8A 1FL3A 3IT8D 3O4LD 1I7TB 1OB1A 2GCYB 4S0TD 2GAZB 1FVCB 4HDIB 4QRRA 4TNWK 2DYPB 3BXNA 2F54D 5C3TA 1NLDL 4UINL 2YD1A 3LY6A 1OSZA 1MCOH 4KK8C 2NZ9D 4M02A 4F37F 3LKNB 3G6AA 4HLZG 3GFUA 4YJZL 3O6FC 5EFIA 1TXKA 3QNZA 3T4YB 5LJYH 2RCSL 2BRRH 3V4PL 3O6ML 4XNYL 1RIVL 4HUWB 1FO0L 4FFYH 2ZCLH 1QSEB 1R5IA 4JFYB 5I2IB 3UTQA 1F11B 5DMIH 4UT7H 4MXQC 1VFMA 3RY5A 1LD9B 1ZA3B 5J6GA 4OCMC 3BH8A 1M6OB 3C6SA 3FQRA 2HJLB 5DFWH 3IDGA 1OT2A 4M3KB 5LAXA 2B39A 5E4EC 4GBXA 1XGTB 4A6YA 3S88L 5D93C 4R7DA 3AUVA 4KJWC 2HWZL 3OAZH 3B6SA 1I7RB 1A6WH 5ISZD 4ODWA 1EX0A 4GW4B 3MJ9H 5I0ZA 3WYRA 4HIIB 5IMOA 1LNUB 5C92A 2ED9A 4GXUN 2VZ1A 3SDXB 4ORZC 4RGNE 1NAKL 2Y25A 4GO6B 5C0RL 1T1ZB 1EMTH 4TVPL 1NQBA 1PVHA 3NABL 3QI9B 4XNMA 2C4FT 1RK1B 4QRRE 5CWSA 5B3JF 4YDKH 4L8DB 1KIQB 3EGSA 4Y4HB 2IBZX 4DKDC 1ZA6A 1N0XH 2QHRL 2XNAB 3QIBD 5L2KA 1D9KB 1RU9H 2YKLL 1T89A 3CLEH 5ICYA 2FATL 3LHPH 1MJUH 3DROB 1YMMB 5MENE 2CD0A 1H8NA 5FA3B 4NM8L 1XGRA 2ENSA 1R3LB 5FM4A 2GIYA 4U7SA 3GRWL 5GGUB 3VJ6A 1N5YH 4NQEA 2VR4A 4WW2F 4TSCH 3FL7A 3RBSA 2YZ1A 1S3KH 2DICA 1S9XA 3ESUF 3FB5B 5FYLE 1NPUA 2LQRA 4J4PC 4OCWL 2ZG3A 5L0QC 1PQZA 5HGBA 4LEOA 4YHZH 1G7QB 3TBSB 5C6WH 4JVWA 3HE7D 2AJYL 4RZCB 4WO4D 2E7MA 3GK8H 1FL3B 3O2VL 3UXFA 1OB1B 5JHDA 3W2DL 1CVSC 1FHGA 1P4LA 4JRXE 4WU7B 3BXNB 2I25N 2UZYB 3LS4L 3I50H 3Q1SH 5T1DL 1OSZB 4JQIH 1EBAA 4X7TB 3B2UD 5B38A 2GITA 1OLLA 3G6AB 3B9KA 1JZ5A 2Q1EA 5EFIB 3KPMA 4JJ5B 3AFLA 3WFHA 1U0QA 1ADQL 2RIKA 2APWA 1ZTXH 1YYLH 3VFOA 5L2KE 1T04A 3NCMA 4LVHC 3MCKA 3TESA 5SWZB 3UTQB 3LN5B 4HEPG 4JM2C 3VMNA 1T20A 5J6GB 4EZMA 1MFBL 3BH8B 1ZLVH 3FQRB 5JXAL 3IDGB 4GKZB 2R29L 4ZMAT 3L7FA 5LAXB 3RWIA 4OSUH 4U6XA 2AJ3B 4YPJA 4R7DB 2D7TH 4Y5YB 2YA1A 2EZ0D 2YK1H 3QDMD 3B6SB 1EJOL 3K4ZA 2OK0H 1DANT 3BZFA 3DXAB 4NC1E 1J9CT 5IMOB 4CMHB 1WZLA 2Y23A 4P59L 4BH8B 2XQBH 3ROLA 5IHUL 5M7QA 3D3VD 2HN7A 3EYUH 4M6OL 4Z18A 4Z78A 1HHHB 1MCWM 5LGKA 3TZVC 5TE4L 5J1SC 1NL0L 3NFSL 4OCXH 2VZTA 3MZTA 4Q9QL 4Y0GA 3WDHA 1XH3A 4NRZB 4XNMB 1NCAH 1RY7B 3QUXC 2DKSA 5CWSB 4XVTL 3EGSB 4PRHD 4NNXA 1MREH 3MO1B 1BAFH 1ZA6B 3SO3C 1MH5B 5F88A 1UJ3A 3GHEL 5INCA 1F97A 2XTLA 2JK5A 5D71L 3ZDZE 5ICYB 2GYSA 1YEFH 4HKZA 5DVNA 3C5JB 3S34H 4AT6B 3FO2A 3PL6D 3V7AE 2DQDH 4NC1C 1XGRB 1EEQA 2ORBL 5I8OL 4NCDA 2ZSVA 3LB6C 5EOQH 4NQEB 4OM1L 3WFCH 3O81A 2ADFH 4ODHL 4UT6L 3EKCA 4NRYA 5E95B 2VUYA 3WV0A 1S9XB 3W9DA 4JPWL 5IVZA 5D7LD 5HGBB 5C0CA 1BBDL 2D9QB 5IBLC 4AL8H 3VFUB 1BD2B 5J13B 3LH2L 3E8UL 1GAFL 4I2XE 1ZANL 3LKRB 3HAEH 2Z35B 3DI2B 4GW5A 4HIEA 5EU3A 1E4WL 3MV7D 5JHDB 1ZVSB 4YDIL 2HFGH 1LO0L 1AY1H 3GSOB 3GI8L 1UB6B 1HE7A 3MLRL 5F9DC 1ZT1A 3QAZC 4UU9A 2NY2B 5B38B 1IC5H 3ARYA 3MNZB 4GOSA 4KRMB 5J56B 4I1NB 3NA4A 2HT3C 4P5MA 3KPMB 1T5XA 3QPQD 4OFYD 3WFHB 3T77A 4ZTOL 2RR3A 4CVXA 1K3ZA 2QADC 1T04B 5HDLA 4YDLB 1GYAA 2BSSA 6FABH 3E3QA 3INUL 3LPWA 3MCKB 3QXAB 4X5XB 4M6ML 1JGEB 4EXKA 3DX9A 5H94A 1T20B 4Y5VC 1YECL 3NPSB 2VXVL 3NIDF 3L7FB 3RWIB 4HZAA 4U6XB 3QWRA 5I74C 4F2MA 1DDHA 5IV2A 3HMXH 1U8HA 2K7PA 5EC2A 1FO0A 1L7IL 4K8RH 1FE8L 3QDJD 5MERB 2MKLC 5BW7C 5BV7C 4KKCC 3LPFA 1M7DB 2L7JA 5JA9A 3PGDB 1J0IA 4Z78B 1BHGA 3RPKA 4TTDC 2XXMB 4ZSOB 5AYUL 3H9SD 1U6AH 5JDSA 3ARFA 1UQSA 2A9NH 3CUPA 1NANI 1XGPA 1XH3B 4PJ5E 3QHZL 5IFJA 4P23A 5ECJE 1DBKL 4NNXB 4ZNEA 1HYSC 3DBXA 4PS4L 2X4QA 4MAYD 4N0RA 1WEJH 5INCB 5C2UB 4OLYH 2JK5B 5FIEA 4TOYL 3QXUA 4HKZB 4QXTA 3QA3A 4KKLC 4QT5B 3FO2B 1AXTH 1P69B 3I3BA 4IHOB 1BVKA 3T0VA 4KAQH 4WHYG 3E3QE 4CADA 3HCVA 5F1NA 5ID1A 5EBMA 5GS0L 4NRYB 2OZ4H 3K2MC 2GQHA 3WSQH 1E6JL 5F96H 3W9DB 4M62H 1NAML 5IVZB 2NY5C 3T0XA 5AYQA 5C0CB 5BVJA 1NCBH 2FHFA 1AHWC 4D9LH 3IDIB 2X4RA 5A16A 5KVDH 1BOYA 1VSCA 3GRWA 4PJEF 1FDLH 4GW5B 1BLNB 4HIEB 1WSST 5EU3B 4APQD 4DK6A 4UV4H 3W0WE 3JVGA 4KQ4H 3EOYG 5I1LB 5CZVH 3CSGA 2VKWA 3B43A 3BHBA 4NHCL 3SDCC 4OLVL 2OJZL 2F53A 4LP4A 1KPRA 5ICZA 4RGOH 4AENA 5ESQA 4EI5C 3ME0A 4UU9B 4K3DH 2HA1A 3F58H 3T04D 3B8SA 3T2PA 3D85D 3ISWA 3WNOA 3WL9A 4R4BB 1DQDH 3VXTA 3FB7B 4X9IA 4P5MB 1YN7A 1T5XB 4E5XA 3I9GH 4ZNEE 3T77B 1I3RA 4KZDL 4CVXB 5J6HA 4MXVE 4KK5D 2Y5EA 3TBTA 2J6EL 1FFQA 1NFDA 3QIUA 1KCRH 3DYOA 3TN0C 5FUOL 3OBAA 5E70A 1JYVA 4L8SA 2AJSH 3DX9B 1U93B 1DBAL 3JTTA 5H94B 5F9WC 2JJSA 3MRNA 3MUZ1 2X42A 5I16B 3A0OA 4CGTA 1J1PL 5E6ZA 3S5LA 3RVUC 1I7ZA 1ADQA 3NIFF 4F2MB 1Z3GH 5IV2B 1BVZA 4GMTL 5EC2B 1FO0B 4PJXA 1Z0NA 2IMNA 4LNRA 4XPBL 3SCMA 3RKPA 4JPVH 4WUUE 1T22B 1W0VA 1PAMA 5KANG 3H3PL 2FD6L 4KTDL 5GRWA 1T1XB 1QSFA 3KPRE 5E56A 1JI1A 4FFWD 2QBWA 2IAMA 2AJZA 4MXWL 5JDSB 4XBEL 4AEEA 3ARFB 1UQSB 3CUPB 1XGPB 3UBXA 5I18L 3EFFA 3BDBA 1FZKB 2NXZB 5MEPB 5IFJB 4G6MH 4P23B 3BP6A 5SWSA 3LQAC 2D0HA 3GMQA 3BN3B 2F53E 4HQQH 3C6LA 1T3FA 5C0GA 3IS1X 1DTUA 3LKOB 3ULVH 1A1OA 3WO4B 4QXTB 4X6EB 1H9VA 2YPKB 3I2CL 5EU6A 5HSFA 5IFAL 2OI9C 4RQQA 5E2VH 3KXFA 4MGXA 4ONHA 1HXYA 4R3SA 3MLVH 5IB5A 1L6XA 4Z9KB 1NFDE 2PO6A 2IFFL 2Q76A 5GRUH 4CADB 5FFLA 5F1NB 1S7TA 2EDNA 5ID1B 4KKBC 4JQVA 4QTIL 5D6CA 3WFDH 4Z6AT 4G59A 1JN6A 1D5BA 5FXCH 2E8YA 3TLRA 5J3HD 3UJJH 5D6DA 4JRYE 1UC6A 2ITDB 1HXMB 2XZQH 5BVJB 4L1DA 3ZE2E 3SGJA 5EC1A 4BZ2L 2DYPD 2X4RB 1BX2B 1JGUL 4BQ9A 1K6QH 3P30L 3CFCH 4XXCC 2EH8H 1X5JA 2ENYA 2DQUL 5IB3A 5DXWA 5J57B 3DGGB 2A73A 1BPVA 1NLBH 3SKJH 1QFWM 4NJ9H 4M6AA 1HHIA 4ODUB 1IAKB 1QSFE 4WI8A 4PRAA 4WY7H 3BHBB 5ICZB 1KPRB 5I0DA 3NCCB 3J7HA 4ZFGL 4AENB 5ESQB 4LHUB 4HWZA 1Z9MA 3MRGA 1W0WA 4XC3L 1GGBL 4XCCL 4OI7A 5A2LH 1IGIH 5D7JC 3K7UA 1CLZH 5C0DB 1LE5B 1QSED 3VXTB 1QO3A 1YN7B 4E5XB 4G42A 2YMXL 1Y6NR 4NKOA 5EA0H 3IJYB 4N8CL 1CGUA 3RI5K 3TBTB 3GMNA 1MHPH 1FNGA 2IANE 3F8UB 3PGFL 2R1XA 3THMH 5FDWB 2A6JB 5BRZA 3JTTB 3EYSH 3MRBA 1F6AA 2P8PB 3PWLB 4PLKC 4Y16B 2RFXA 4J7RA 3KXFE 4XMPH 3TVMC 4MQXD 4NBXB 5C08B 3K2UL 2Z91B 1I7ZB 3BQUC 5TDPB 2DQJH 4BH7A 4PP2B 4K3JH 3MNWB 4KDVA 4PJXB 2R0ZH 4LNRB 4U1KB 3SCMB 4U2YA 5E8NB 5DVKA 4JO2L 5IUSA 1W0VB 5D7IF 1ZK9A 3QI9D 2VLRE 1QSFB 4Y4HD 1NBZA 2HRPH 2V9TA 4MZ2A 2AJZB 1YQVH 2W9EH 4QOKA 1G1CA 3I6KA 2BNQA 1D9KD 5ICXA 2GW5A 3U7YH 4P2YA 1G9NL 3UBXB 4KV5F 1ETZA 3EFFB 4Y1AA 5SWSB 1YMMD 4J23A 3G5VA 4LLMA 2IWGA 2W59A 3C6LB 2XZCL 1EEZB 4P2QA 1A1OB 1KN2H 5KSAA 2B2XL 5EU6B 4RQQB 3C5SA 4D2NA 2MHAB 3N1MC 1Q1JH 2J12B 4R3SB 5IB5B 4ZO7A 4FFVD 2AEPH 5DTFA 3TF7C 2PO6B 2Q76B 3ARVA 3E1F1 2XTJB 2D03L 1S7TB 1MRFH 3PWJB 5HDQL 3HI5L 1MPAL 1BZ9A 5D6CB 4WEUD 5CLTA 1JN6B 3TO2A 3MV9B 1CD9B 4GJTB 4B41A 2DBLH 2VL4A 4LEXL 1FCGA 4QGYA 3WFEH 1CDGA 3K81A 5EC1B 4XCYA 1ZT4B 3MSPA 2CRZA 1F4XL 1HKLH 1MRDH 1U3JA 1YMHB 5IB3B 4JEGB 4PREB 4X7SH 4QKXB 2A73B 2GSGB 2WUBH 1KTRL 4Z7VF 5JXEA 2D3VA 1RZIA 4QWWD 5DYOB 2C3GA 2MPAL 1NAMA 4YEEA 4HWZB 1TVDA 3MRGB 4JFQA 4UI2A 4ERSL 1ZLSH 3WXWH 3CFEA 5SWZD 1QO3B 4TRPL 3G5YA 4U0RB 5DUPL 4G42B 3VXPA 1SM3L 4ONGL 1RZJC 1MFEL 1EXUA 2EDJA 3V7AG 4FXKA 43C9A 1IGTB 3UTZA 3GMNB 2FECI 1KENH 2E7LE 4BQ8A 5EUOA 4P2QE 3TWCL 3AB0C 4NO5A 2R1XB 5BRZB 1AE6L 1F6AB 4IMKA 1Z9OA 5FGRA 4WFGE 4V1DA 4BFIB 1EA9C 3DXAD 3P0YH 1YN6B 4OLEA 4YNYA 1IZJA 3BO8A 5DD1L 2C3WA 1EIBA 3FAXA 2PN5A 3BGAA 1XIWB 4BH7B 1OD7A 1OVZA 2J6EA 3O2WH 3IDNA 1IC1A 2P43B 2OXHA 2VQUA 5DD3H 4LSVH 2XKUA 4QLRA 4TSAL 1KXVC 4LLVB 3NZHL 4NUGH 3Q6GL 4O5LL 3RDTC 5ICXB 4QOKB 3I6KB 1DR9A 2BNQB 2E7LC 5ANMA 1EO8L 5LXGH 1ETZB 3SQOH 5F97E 3V7MA 4Y1AB 2K9UA 1JF1A 1CK0H 3O4OC 1GHFH 5EO1A 3G5VB 2APFA 3S35H 5L8LB 5CSBA 2ZUVA 3DX6A 5CP3A 4ZPVA 5AD0A 1OAYL 4Z77A 1UZ6E 3BP4B 5ACMA 5CEZH 1P4IL 4NQED 3EUUA 5I76A 5KSAB 3MRJA 5FO9A 2NXYD 1YEGH 1A7NL 2X1WL 3C5SB 3IS0X 3P3YA 5IMMB 1EFQA 4KH2A 5FGCB 3GSNH 3KJ4C 1XCQA 5DZOA 3TIDB 2PR4L 1JFQL 4FXGA 4GRWB 2Z92A 1BD2D 5T5FH 3JWOH 3HA0A 1BZ9B 3L5XH 4XNZB 3VMOA 1UYWL 5MI0C 2FJGA 3FRUA 1KCSH 2CRIA 3IF1A 4V1DE 4DN4L 5JHDD 4X6BA 4PBXA 3WJJC 4J3XA 4XCYB 5E7BA 5KS9A 4G8EA 5E8DL 4D94A 3KYMA 3MV8E 4RMUA 4TNWF 3LPGA 3LKPA 5IEKA 1AQKH 1VGEH 2Q7YB 2CKBH 2NY2D 2YA2A 3SY0B 3B5TA 4NN6C 3WBDA 4V3EB 1RZIB 5D96C 1NAMB 1B0RB 1KEML 1FL5A 5GRJL 1NFIB 3P2TA 3QBTB 5ANME 3LEXB 3RZWA 1OAKH 5B8CC 4RFEA 4WW1B 2LVEA 3VXPB 2XWBA 2EKJA 3TBWA 1OAQH 4XHJC 3JTSA 43C9B 1TJIL 3MJ8B 2BNRA 4BFGA 3QXDB 5EUOB 5F7YC 4H1LG 3F7YA 3GKZA 2P5EB 5IBTH 2BHZA 2QL1A 1NGPL 2G5RA 2MJWA 2B1HL 3EJJX 2M26A 1EVTC 3UAJC 3BO8B 5SV4A 4LPVA 3V0VA 1W0YT 1A64A 1NSNL 5D2NC 4BUHA 5CFHA 2VXQL 3HC0B 5D1ZA 3F62A 1WJ3A 4YZFF 5D72H 1OY3B 4X7DC 1TQBB 2AK4B 1KELH 3T0EE 3T1FB 2EXYD 1MCIA 3HE6C 3PWPA 2YRZA 5KS9E 3X3FH 4CN6A 4BJLA 3GJFA 4Y4FB 4GH7B 2DM7A 1CICC 5JZ7C 4OD3H 4CVUA 1V05A 2N56A 2I9TA 3ZKMC 4H26B 4NFDA 5EO1B 2P8MA 1YNTA 4L3EA 2XT1B 5IJVB 3DX6B 2YD7A 4ZPVB 5F6HI 5K9OB 2DJUA 1J5OH 4QCIB 4PRBA 5I76B 4JFDE 2HFTA 5FO9B 3GBNL 3WNNA 1TDQA 4HWBH 2NY1C 1NC4A 2AERT 1L7TL 1MLBA 1RVFH 1XCQB 1O7VA 2HT2D 5CEXA 3T0EC 1VFBA 2BNRE 4NQUA 5C0CD 5SX4I 4FXGB 1KGCD 1AR1C 4LKXA 2Z92B 5CD3A 1YNLL 2VLKA 2YPVL 4YHNA 1JRHH 2FJGB 1T0MA 1ZXQA 3FRUB 3IF1B 3RVVD 3S8WA 5JR1H 3TBVA 4XPFL 5DR5H 1SYVA 5JNYA 3KYMB 1PGRB 3HS0B 3VXRE 1AGDB 1IKNA 5FAAA 5IEKB 1FLRH 3ILPA 4N5EC 5HHNB 3DI3B 1A3QA 3F7QA 1P9MA 3SDXF 5AAMA 4R4NC 1U8OA 3MLXH 3PWPE 2XWTA 4JY4A 5IW6A 2VDRL 1N64L 3HKFA 2IPTL 1JNLH 4JCMA 4NO0A 5C2BL 3CVIH 4R97B 3VH8A 3DIFB 4ZAKB 5IVOA 2DDQH 4FNLH 3E2HC 2XWBB 4L3EE 5HI5C 4MDJA 3SKMA 3RVWD 4G8GE 3RWFA 4FZ8L 3VFRB 3F7YB 1HH6B 3X12A 3OAUL 4JGMA 3QWRD 5EUKA 5E7FA 2JJWA 4WU5A 2G75B 2H32A 3RGVA 1LO3L 1DQQA 1GGYA 4HHAA 4WCYH 2X1XR 2OS7A 5KW9L 3OX8A 4PJAA 2R0KH 4MQSB 4BELD 3CFBA 1DCLA 3F7RA 3MJGX 2AGJL 3IFLH 1QBLH 4MJ6A 5D1ZB 5L88H 4QRSA 3ARFD 4KPHL 4UNTA 4YDJA 4PV8A 1I8LC 1T2XA 3CFKA 2NXZD 3PWPB 4LARH 4GRMA 1BFOB 4P23D 3DETD 3NAAH 3QG6A 4XP5L 5GGTH 3D39A 1PD6A 3LD8C 4LQFH 5DJDA 4HXAL 5MHSE 2CDEB 4O58H 2I9TB 3C08L 1QP1A 1OWWA 3A6OA 1RIUL 4KKAD 4NNPH 4NUJA 7FABL 5LVEA 1GOHA 2P8MB 1YNTB 1IKFL 3VXQA 3RQ3A 2JLLA 4TVPD 1H3PH 2DBJA 2Q8BL 4HAFA 2AEQL 2BY3A 5BV7L 3KR3L 3QFJA 1U8PA 2FSEA 4UNUA 3U9PH 4MXQA 2VXTH 1MLBB 5CEXB 2MCPH 3O41A 2G9HB 1VFBB 1ZGLP 3OGCA 5FK9A 1BJ1J 4MSWA 4Z7UB 1Z0MA 4LKXB 4F57L 3PNWA 4AIZB 4GAGH 5CGYC 3VXUE 1N4XL 2VDKL 2VLKB 1U91A 4FQ2L 2P1YA 4YHNB 1T0MB 3EDFA 1LEKA 2X4PA 1LE9A 3ZHDA 3QXWA 4N0CC 2DQEL 3TBVB 3HUJB 5AZ2L 1SYVB 4M4RA 3C5ZC 4O9HH 2C3VA 1K85A 3P11L 2F53D 1FL6B 2ZG2A 1IQWH 3KLAA 3QB7C 1UZ8A 5T5NG 4K71B 3CXHJ 4JDTH 4XMLL 1PSKL 3M8OH 4XWOC 3F12A 2AJXL 1U8OB 1IGCH 2XWTB 3OQ3B 4JY4B 4F7EA 3GJFK 2EDEA 3D39E 4RDQF 2F5AH 3HNSL 3WEXA 2GK2A 4NO0B 1FG9C 2NY5L 1S78D 4C58B 3MBEA 4QF1A 5C0NC 1II4E 3QUYB 4LLQA 1Q72H 4RWYL 1SBSL 3P9LA 4GG8A 1GH7A 3N9GH 1XZ0A 1UWEH 4Y16D 3VDBA 4MDJB 4X8JA 3SDYH 3WIHL 5C08D 1U8IA 2Y6SD 4U05A 2J4WL 1QBML 5EUKB 1GC1H 4I9WD 1KCLA 1WIPA 4HLJA 3SE3C 4ZTPH 1ZLWH 2A38A 4HHAB 2WZPD 3QT2A 1EHLH 4UNVA 3SCMD 4PJAB 5EZOH 1ZKAA 4JZOA 3UDWC 3QEQA 3CFBB 1QSFD 4WI7A 4IOIA 4OZGE 5CILL 4MJ6B 3UTSA 1DFBH 4R26L 4Q97A 5E9DE 2Y06L 2JJTA 2IAMD 3I02A 4HXBH 4P46C 4QRSB 3MLPA 2CMRH 3V6BR 5C0IB 1MIMH 4NQVB 1QYGL 3CFKB 1A7PL 1EV2E 3QHTC 3FO0L 4RMWA 5SWSD 1LGVA 3VFTA 1M1SA 3D39B 5DJDB 3OWEA 3C6LD 4XNUL 1C5CL 4C57C 1U8MA 3BPLB 4DTGL 4TQEL 3O6FB 4NUJB 5J1AB 5EU6D 2HKFH 2FBJH 3GMPB 3R0MA 4M1CC 4OLUH 4P2RA 3KXFD 3L5JA 3WKMH 3OAYH 2PO6D 4PJ8C 4Y19A 2XTJD 1PG7L 4RISH 4GRLC 2EIEA 3QFJB 1U8PB 2FSEB 4I5BA 4ZFZA 4ELKA 5LGHH 1DBBL 4JZJA 2XI9A 3EO0A 1JL8A 1U3HA 2LTQC 3O41B 1MWAH 2BJMH 5E4EB 3OGCB 4UMGA 4MSWB 4PJ7E 1H0DB 5D93B 3WLWD 2H2SD 2W0LA 4PTUA 3QEGL 5GPRA 2Z93B 2OSLA 3PWUA 3LQAL 4LMQE 5TE7H 2X9XA 1LE9B 3CXHK 5E8EB 2V7NA 1ZWIA 3TZVA 3QEQE 1WBXA 1CFVH 4O02L 1KTLA 4XNXH 4R90H 2XFXA 2VDMH 5DRZA 2F19H 1HINL 4XI5C 3F12B 4J3UA 1UA6H 4DKEH 4U6VH 4PGJA 1TETH 1QFUL 4OQTL 1N6QL 2BY2A 4F7EB 1X5LA 2C7UB 3L6FA 3S36X 2H9GA 5I1KH 3WEXB 4DKFH 4MX7B 1KULA 4N0UE 2VO5A 3MBEB 1MRCL 1MQKH 4LLQB 2AV7A 4Z7OF 5BRZD 3P9LB 4GG8B 3WD5H 4MB3A 5A40E 1I9RH 4QY8A 2EYRA 1N0LA 1NFKA 4X8JB 4JFFB 3HR6A 5A2JH 1U8IB 1CGSH 3D0LA 3SGKA 1KIRA 4MYWB 5J9PA 1IL1B 3RWGB 2NTFA 2UY6A 4HFUL 1XIWD 1Q9WA 3ECBA 3MRIA 5L0QB 1IGMH 1C1EL 1KN4L 4HUVB 3OKDA 3U82B 1SHMA 3KWWA 3PWVA 1YQ2A 4KVCH 4JZOB 5DHVA 5K9KA 3UPRA 3B5GA 1MAJA 4IOIB 4ZFOB 3UTSB 1OQOA 3BWAA 3TIEA 1HQ4A 3UJTH 4HCRH 4QOKD 2IGFL 2J1KA 2BNQD 4P2OC 3LQZB 2CXKA 2ADJA 4I0PC 2OTUA 2JB5H 4Y1AD 4KHXH 4RBPH 3VFTB 1DBML 5ETUB 5F93C 4M43H 4HJ0D 3JBG7 1U8MB 2BP3A 1PKOA 3EDEA 5KSAD 5CJXC 5TGBA 5C0FA 4MNQE 1OTSC 4P2RB 2X1OA 1NGQL 1RI8A 3UPCA 1QPPA 4X6CA 4LVHB 1J8KA 5FGBA 1EEYB 2B8OT 3GSQA 4Y19B 4ZXBA 3WDJA 4JO3H 5TDOA 5HHPA 4ZFZB 4F7TA 1TNNA 3VRJA 5I71B 4UIMA 4WHDA 1VPOL 2H3NA 3ZO0A 1NEZG 4PTUB 3G6JE 2W65A 3MTRA 4HS8H 3PWUB 3QUKB 5BW7A 3O8XC 2AJUH 5GS0D 5C0BA 3U4BH 1NBYA 2V7NB 1ZWIB 3TZVB 1WBXB 5E4IA 3HG1E 5JXED 5LWYH 3DURA 3MRQB 2XFXB 3ARGC 4M1DH 4N0YH 4TNVF 4AIXA 3QUXB 1RJCA 1YEKH 2I24N 2FX7H 2PTTB 3TT3H 3X11B 3SO3B 5DRNB 3CVHH 5KAQF 5SX5H 3D9AH 3U1SL 3ZL4L 4CVZB 3LV3A 2H9GB 5FOBB 2YUWA 4W4NA 4RAHA 5JW5A 4GSDL 1YY9C 3VXOA 1G0DA 2AXJA 4K8RC 3T4AA 1B2WH 1O0VA 3IFPB 2JKXA 2P5ED 2AV7B 2HVKA 4MA8L 4XAWL 1DZBA 3BGFC 2EYRB 5CMAA 2LAGB 3W11C 1A6UH 1SMOA 4X6CE 1JHLL 2YD8A 1CT8A 1QUNA 1R0AL 4EBQH 3D0LB 5D8JH 2NY7L 2CLRB 1KIRB 2DM2A 5CEYA 5J9PB 4FQXC 3MRIB 1Q9WB 1RULL 5DJAA 4LCWA 4UTAH 1JHTA 3IAPA 3OKDB 1JZ2A 3JWDL 2ZKHL 1FBIH 3KWWB 2Q6WA 2D9CA 5F1KC 1HSBA 1AHWA 2AK4D 1YJDC 5K9KB 2Q3AA 1BVLB 2HLFD 3QRGH 2WNGA 4WI2A 1NUDA 1NCWH 4Y4FD 2E9BA 3BWAB 3LRGA 3MA7A 3WIHA 4D0DB 5FM5O 5IBUB 1H8SA 2ADJB 1KPVB 2BVEA 2OTUB 1BQLH 4I8DA 4F3FA 4RCAA 1C8PA 4EI5A 3QAZB 1NCNA 4U6HA 1YZZA 4BSVA 2AEIT 2RHEA 3BIBX 1JPTH 1KB5B 3NZ8A 2RQ8A 5DJXA 1X4ZA 3WS6C 4K55A 1UH3A 3GO1H 4Y2DC 1F4WH 3TN0A 4X7FC 1GGCH 3DVGB 4HUKB 2FLBT 2NY3C 2PW1A 4ZXBB 4NBZB 4G7VL 4NN7C 5HHPB 5TDOB 4F7TB 1NDGA 4OZFA 4BZ1H 1K4DA 3LN9A 3GJEB 4UIMB 5IESH 2HT4D 4K94H 1T03L 2NW2A 4LRNH 1N59A 4KHTL 4NIKB 5JQ6H 2JJVA 4L4VA 4AEHH 4B5EA 1MCEA 1U3YA 1Q9OA 3ZT6A 5ADPH 2WAHA 2W65B 1C08A 4FQIL 5D70H 1DE4B 3GNMH 1I9IL 1RZGA 3VFVB 5ABDE 5BV7B 4NFBA 3HNTL 5C0BB 4PJXF 1EPFA 5GZND 3D18B 4H0IA 2EDXA 4OZIA 3RZCA 3DURB 1F6LL 2EYSA 2X70A 2J88L 5ITFA 3KNBB 4YHKL 1TCRA 4ZAKD 1UM5L 5CSGA 3G08B 4KY1H 1HK6A 5GS1C 1I1YA 3CSYA 3C87A 2FX8L 1NBQA 3LV3B 5FYKL 4HS6A 2CJUH 5JW5B 2I07B 2BNRD 2VJXA 3PHOA 5IMLB 1HZHH 2W0KA 3VXOB 3GIZH 5IROC 3OB0H 5DI8B 2HVKB 5F7EH 4CNIB 4CKVX 1RZ8A 1F13A 1ORQA 4M9PA 1J12A 4KDTC 5CMAB 4YH6A 3WHE1 3O9WA 4OQTA 2HTKD 1CT8B 5CP7A 1OGAB 5D4QA 4XH2B 3WN5C 5IHBA 4H8WH 5CEYB 5HVHB 5DJAB 4I3RH 4LCWB 3VXMA 5C9KA 5D1ZD 3TV3L 5JPMB 3HPLB 3U0PA 1RZFH 2FR4A 3PIQB 4M8QA 1AHWB 2W0PA 3B2VH 2COQA 2ERJC 3MMEA 3PWPD 4CW1A 4U1HA 3LEYL 1QFWH 5HHXH 3ULVC 3PWNA 2Y07L 3ARUA 4Q6IC 3MODL 1PY9A 4OZHA 2MOVA 5FM5M 3NIGE 1BGXL 3T65A 2UZIL 1WAAE 1KJ2H 1WBYA 4NDMA 2E7BA 3SDCB 4OZIE 4F3FB 2ZNWA 4YHYC 2YC1A 4YLQT 2R23A 4EI5B 4MNGB 4H1LB 2ICEA 4BSVB 1RZ7H 5GZOC 1FZMA 2DTML 3EOAA 4G80A 5CINH 4PJCA 1OAXL 3QH3A 1T83A 1VADA 4DUWA 3RAJL 3NZ8B 5DJXB 3S37H 4U4BA 2X41A 3ARBA 5FYJL 4KUZL 3I75A 4XX1E 3TN0B 2CLZB 1ROWA 3T2NL 3BN9C 5F6IB 2OL3H 1UT9A 1T66C 5F9WB 1G7HA 3VI4E 2PNDA 4OZFB 4OI8A 1K4DB 5T33L 2VLKD 2AW2A 1KNOA 4RFOH 4NNYA 2NW2B 4KQ3H 1WGOA 3P4LA 3V5HA 2QSCH 4L4VB 2OTWA 1Q9OB 1I8KA 1DLHA 1F8TL 3EO1A 1RZGB 3GSRA 4OBRA 5KTEH 2VQ1B 2DLTA 4KTEH 2QQQA 3QO0A 4G6JH 3IKCA 2WK2A 5FYJU 3RZCB 4E41A 3VXSA 4FZEH 3BZ4A 4NO2B 2NR6D 1UJTA 2X70B 3CCHA 4ORGA 5FHAH 4L9LC 4FTVB 4NO0D 2YR3A 1KJMA 2IEPA 3SE8L 3QP3A 3QUYD 1NCCL 2ZJSL 1I1YB 1FC1A 2MQ3A 4P4KC 3LN4B 1C12B 4HS6B 4GS7C 4R0LA 5HYIA 2VB5A 4MJIE 1F4HA 1CDUA 1IM3B 4OCNC 1G9ML 3FN3A 3PHOB 5GQBA 3H6JA 2OI9B 5GJSH 3QFDA 1ORQB 3PUCA 3SGEI 3MUY1 4ZD3L 1XMWA 4OLXL 3O9WB 1MHEA 1NCUA 5CP7B 4QHUA 4WTZG 3EAKA 1G7JA 4ZUTB 1QRNE 3VXMB 35C8L 2Z8WC 3PP4H 3U0PB 4JFHE 4GRWF 3ROOA 2FR4B 2XA8L 4M8QB 1FGNL 2APTA 5BVPH 3FQWA 5HD8D 1CGYA 4Q0XH 1UM6L 3MMEB 4CW1B 4HIHB 1OM3L 1J1XH 1RUML 2X6MA 1VHPA 3D39D 4OZHB 5DJYA 4OGYL 1N7MH 4FQJH 4ZUSA 4EI6A 4YR6A 4ODVH 5D5MA 1CFQA 1WBYB 3H7BA 3O6FD 1ZHKA 2XKNA 5EPMB 3HC4H 4JDZA 4E41E 2YC1B 3VXSE 1SYSB 4YHMH 4X80L 2ICEB 5CGTA 1FYTA 1FZMB 3EOAB 4G80B 4M5YL 4PJCB 1JHKL 1SEQH 3QH3B 4GKOA 4HGKC 1C5BL 3QFJD 3QQ9D 3CLFH 2FRGP 1YA5A 3L3JA 4KMLB 4MXQD 3ARBB 3GMRA 1L6ZA 1EGJH 3RX8A 1JK8A 3I75B 3RTQC 4NZUH 4LLYB 4MLIA 5IG7A 5EUOF 1G6RH 2ZUWA 4PRNA 4RA3A 1KNOB 4NNYB 1TJHH 2XWJB 4XP4H 2I5YH 3IETA 2VERN 1E4XI 2R9HD 3BQUB 1CFSB 4O4YH 3HAEG 4LVNC 3MACL 1DLHB 4L4TA 1JNHB 2AAVA 3EO1B 3F6LA 1OTTD 3GSRB 5JO5A 3QO0B 4A2LA 2JCCE 4OM0L 4O2CA 1IAIM 1ODAA 5FCSH 4PGZA 5IT2L 4N8PA 4BZYA 3CCHB 1CDYA 4ORGB 4GMSL 5DLML 5IM7A 4X6FA 5BS0A 4NKQB 1KJMB 4XVSL 3O6KH 5D5ME 3MBED 2L7UA 2BDNH 3KHQA 1C16B 5CEZE 4PBWD 2YUXA 1AGBB 4JFFD 1MJ7L 2VR9A 1KOAA 1AR2A 4IRJC 5CZXC 4C56A 3OXSA 3X14A 1CG9A 3TEUA 4NQCA 4QYOA 1T6WA 3BKJH 4FABL 5ENWA 3ARDC 4N90E 3ZTJH 1TQCC 2JELH 1MHEB 3KPPB 3A6CH 4IOFC 1G7JB 1ZHLA 4GG6A 3TT1H 3OKLA 2BVPA 4LVEA 4X6DA 5F7HA 3UTSD 2QKIA 3O0RH 4WI6A 1IGFH 1U8QB 5ALCH 3WJJA 4M1GL 4HPOL 4FFZH 4FQHB 2B20A 1T21A 3MJ9L 2B4CH 2WBWB 1J0YA 4LAQH 5DJYB 4ZUSB 4EI6B 4WV1C 4EN3C 4NQDE 5KVEH 3NCYP 4POZC 4ONFH 1CFQB 1ZHKB 2XKNB 1IEHA 4DGIH 3RUGB 1WCBA 2XXCB 3BESR 4JDZB 3DO3A 4X4XA 4P2RD 3TPUA 1FNAA 4PY8I 1MLCA 4I18A 1KCVL 2ZNXA 1BWWA 1FYTB 3L7EB 4YDKL 5DDHB 2MCG1 3VWJA 1WZKA 5BS0E 4Y19D 5B8CA 1H15A 2O26U 5I30H 3RIFK 3MV11 2HAZA 4X4YA 3L3JB 3PP3K 3TFKA 5D1XC 3MRRA 1FGVL 2BVTA 3GMRB 3MLTB 3CLEL 3ZDXE 1MHHB 3FO9A 4EXPX 5K59E 4Q58C 4JN1L 3AB0B 1MSPA 5I1CH 4W6XB 3KPSA 4NQCE 1OF2A 4N8VA 4HX1B 1KIUA 5IWLC 4PRNB 5T1LA 3H42L 4X5WA 3IETB 3O3DB 4TULH 5AUMA 4F58L 1T7YA 3TZVD 2X1PA 5FYKE 3DX7A 4X6DE 4L4TB 3NBNA 3QUXD 5CAYB 5FB8A 3Q6FA 1X3DA 2X4NA 3WJLC 3SDDA 2R0LL 1RUKH 3AM8A 3IDXL 1MAML 1S7SA 3WNKA 5IM7B 4X6FB 1JGVH 2C3HA 5HHOA 3P0GB 4IBLT 3RNKA 4WUKL 6CGTA 4OGAC 1SJEB 2IH1A 4GXVL 3DWTA 4MS8C 5IMKA 2BY0A 3LB6D 4PJBA 4U31A 2N7BA 4S11A 2GJ6E 2WBKA 4U7MA 4C56B 3OXSB 1CG9B 1FLTX 3BT2H 4OT1L 4M4PA 4QYOB 1NJ9A 2L0DA 3KJ4B 3G5ZB 3S96A 5C6PB 4NQXB 5C07B 4UBDC 5MEOA 1MCHA 1ZHLB 4GG6B 1Y0LA 4QXWA 1J8HE 3KPSE 4IIQA 4Z7UF 1ZE3C 5MI0B 4HK0A 4L8CA 5I15H 2XZAL 4PGEA 3LOWA 1NMAH 4NPYA 5JW3H 1X44A 3NACH 1HI6A 4M61A 4OCSH 3VDAA 2PYFA 2QQLL 3HRPA 3UZVB 1T21B 5JIIA 2ID5A 4GLRH 1QHPA 4U1NA 3ZYZA 4YC2C 3HUJF 3P4OA 2X44D 5C7XL 4NWTH 1BM3H 1F4YH 1MCPH 1PFCA 3RIAF 2CIKB 5L8JB 2HT3D 5D96B 3VFWB 1G1YA 4ODTH 2VIRB 1WCBB 3A6BL 4TUJB 4MQ7A 5F7FA 4X4XB 5F7MC 1L0QA 3VMPA 4OB5L 3TPUB 3D87B 5T3XD 1MLCB 4I18B 3BD5A 4L3CA 1EZVY 3MBXH 3AMLA 3S6CA 5B8CB 2YXMA 1AO7A 1S8DA 1H15B 5HHOE 4ZXBD 4JE4B 1E4JA