3UPRA

Hla-b*57:01 complexed to pep-v and abacavir
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Drug hypersensitivity caused by alteration of the MHC-presented self-peptide repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uprA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3uprA01
3DX6A 2N7BA 4LLMA 3IS1X 4JAMB 2AGJL 3UYPA 5CEZE 2EDJA 4PG9A 3ROLA 1SYSA 2EDDA 3CUPB 4PJFF 1YN6B 4QRRD 3PWVB 2AJUH 1NMCC 5E9DB 5DZOA 3IFPA 2HFEB 3Q48A 5TE7L 3H6JA 1C5DB 3QDGE 5I16B 3H7LA 4M6OL 5CBAA 3QUXB 2J4WH 4R8WH 1H15A 4PJ7B 2H2SD 3QEUB 3S35L 4X6BB 3OKEA 4J4PC 4MQ7A 4HK3N 4MXVE 4Q9RL 1TCRB 2YXMA 3GO1L 1CZ8H 4U1NA 1HKLL 4JKLA 4XPBL 3MV8B 1HZHL 3KVQA 2CKBL 5FM5O 5B39G 4LIQH 2DBJA 3PXJA 3L5JA 3MNZA 2DM2A 2HT4D 2ADGA 1CL7L 1D5MB 4JFFD 3QI9A 4WI3A 5FHBH 2ZNXA 4RX4D 2C4FT 3CDCA 1KC5L 5CMAA 3PL6B 4R4BB 2FD6H 3MCKB 3DROB 3P4MB 2XPGB 3I50H 3A67L 3UPCA 4ONHA 3TT1H 2IH3A 2R1YA 3C08H 5FFLA 1J1OH 4NT6B 3U0TA 1GGIL 5KSBE 4GRWE 5KS9B 4XNUH 2EDTA 4JQXA 5ETUB 1NDMB 4PGCB 5I1HL 3NIFF 4FXKA 5TQ2L 1LE5A 5DVNA 1ULVA 1N4XH 2HVKB 3GSXA 4JFPB 1I8IB 1EEYA 3D39D 5D8JH 3EJYC 3KPMB 4EI6A 4G6AC 1GC1H 3AU1B 3MUHL 1B0RA 3NZHL 5I76B 3WFEL 1B2WL 4U1HA 3MNVB 1DQJB 4RMWA 1CR9L 5TDNA 5C0CE 1M7DA 5D96B 4AIXA 3CFBB 2VXSH 4YR6A 4XMPL 2XKSA 5HDQL 4Y4FD 3LHPH 5TGBA 4L8BA 3F5WB 1LK2B 4KKAC 5M95B 5BZDA 3QO1B 1WZKA 5D72L 1XMWA 4JE4B 3J7HA 1IQWL 3NOIA 1BZQK 5K9OB 4R7DB 4LVOB 3QUML 3TZVB 3KJ4C 4K9EL 5HHXL 3WFCH 1IM9B 2I9LB 1ZHKA 2H45A 3ZKND 3CVIL 2XQBL 1AR1D 2ESVE 1T20B 4M1DH 1MREL 3IDIA 3KPSE 5DQJB 2DWEA 1CDGA 2WP3O 3GNML 2QQKH 2EDFA 1FO0H 2VDOH 2P5WA 2NTFB 4GW4B 3CFJB 3NCJH 1QKZH 1WQVT 4CVXA 2AJSL 2A6KB 1N8ZB 1EJ6A 1RZFH 4XRCB 1V3KA 3WD5H 1V3LA 3DXAE 3B8SA 1YEFH 1A7NH 1M05B 3HC3L 4KRPD 4KPHL 5H94B 2GEEA 4FTVA 5E0QA 1F8TL 1T2XA 1EFXD 1U8JB 1UCTA 5D7LE 3GSOB 3WE6B 2XG5A 1UJ3B 4GKZB 3MOBH 3FTGA 1MAMH 4G7YL 5DUMH 1UWGH 1XCQA 1NBVL 4HCRL 2C1OA 2FCBA 5DFTA 4Z7UB 4MVBA 4K3EH 4S1SH 6FABH 4X4XA 4F2MA 2R39A 1PAMA 4H20L 2C7UA 3JTSA 3AM8A 4ODUA 4DK3A 5IJVB 3ZO0A 3OXSA 1A22B 3IDUA 3MBEA 4NQDB 1DFBH 4HKBA 2V2TA 1BPVA 5JORB 4X5WA 4XP5H 5EZLB 3TESA 1T83A 4CL7A 1K4DA 1PD6A 4FG6D 4RMRA 3WHE0 3BPOC 4L8DB 4ZUTB 4EN3B 2E6PA 4P4KC 4K3DL 2XZAH 1IGJA 3OGCA 4PJGB 5E2TL 4ZNEA 3IB4A 1OGAD 3FOMA 1RUKH 1BVLB 2CIKA 2W9DH 3HRPA 1LE9B 3PWJA 4PRDB 1DE4B 1B90A 4X8JA 5J1SC 5C0AE 1QFWI 4HUUA 5J3HD 4LLDB 1I7UA 1SEQL 2KBGA 3QFDA 1NDGB 3G08A 3RZCD 3QP3A 3QG7L 1I1YB 5KVEH 5KSBF 5H2BA 5TF1H 1DEEB 4I77L 1X5KA 5AYUH 3IDJA 2YMXH 2W38A 4GXVL 3OZ9H 4M3KB 4YWGH 3AS3A 5CJ5A 4XP1L 5GS0C 1UM5L 3HNTL 2EDNA 4NQVA 1UGNA 4NZJA 5IR1B 3FT3B 4NC2B 3REVB 1Q94B 4F3FA 3SDAA 3H8NA 4TNVK 3ZKQD 2BVOA 4S2SA 1TJHH 2DQHH 3FRPA 3CD4A 1A4JA 2AK1H 5HYSB 1UKSA 3UTZB 1X44A 1CCZA 3FO1A 5GS1C 1AKJD 3VGEA 4JANA 2WP3T 4S1DD 2L7UA 1LDPL 4YUEH 3A6CL 1AJ7H 3O8XA 5C8JA 4BFBD 3WFDL 4LSTL 1FYHB 1IBGL 4JM2C 2AXHA 5IEKB 3LSOA 1KEML 1C8PA 3G5XA 4PDCE 4KGJA 3C60B 4ZQKB 3LOWA 4JY6B 3RJDA 3U7WH 1F11A 5IVNA 3VD3A 4FFEX 1MQKH 2G9HA 3O0RL 1QUNA 3VXMA 2DL2A 5HYEA 4JRWA 1CDYA 1CG9B 2XNAB 4G9FE 2VDML 4HH9A 4PR5A 2BOBB 4O58L 3UZQA 3C6SB 1A0QH 3LKRA 1ADQA 5F93C 3FN0H 1KGCD 3RU8L 5MEQB 2LAAA 2EE2A 2A6JA 3VFRB 3MXVL 4Y7MA 1C1EH 1RV6X 1LP9E 3K74B 3W5MA 4X7SL 1YJDC 1R3JA 1CQKA 1LWRA 1XR8A 3MRCA 12E8L 5CGYC 4KRPB 2X2YA 1OF2A 2F53D 1KSRA 1EFXB 3RIFF 1LK3H 5C6PB 4MMXC 3TFKD 4HZLA 3TWCL 1PFCA 1QBBA 3EO9H 2ICCA 4TSBH 3LKNB 2VDPH 4MNQA 1OTSD 2AP2A 1VFBA 2EXYD 4P9HH 4LAJH 1AD9B 3I02A 5MP6H 4HGKC 1UM6L 2Q6WB 5HDBE 1AQKL 2X41A 3AROA 5GQBA 3QWOB 4Y1AB 5D7IF 2B5IC 4HEPG 1F2XK 1IARB 1QYGH 5IB2B 3TJHD 3VWKC 4PJ5B 3TBYB 1KTLB 1Y0LB 1DN0A 5DXWA 4KXZI 2VOTA 4BYHA 2YKLH 2VZSA 1DSFH 1FC1A 1B9ZA 4NM8H 1KJMB 3V5KB 3QIUC 3RWJA 4GG6A 2W91A 3MUGA 5LCVH 3KLAB 4LASL 3FT2B 2VLLA 3EZJB 1I1FA 2W59A 3LS5L 4MZ3A 4OLYH 3GM8A 4YIQA 1BM3L 2BC4B 1B6DA 4O2CA 4Y19A 5IK3A 5FB8B 5DJAB 3VDCA 4WENB 4NQCD 1RD6A 5I8EB 3PWPA 4AH2A 3UTSA 3DV4B 1ZSDA 4FS0A 4XNXL 2NPLX 4JLRA 3VFVB 1KCSH 3B2VL 2NX5A 3BE1L 1JNHA 1JCKA 3L3KB 2DS4A 2X4QA 3BH9B 1WV7T 3GKWH 2UZIL 3WJJA 1OAKL 1AO7B 3BKYL 1XZ0A 3MZTA 5MI0B 2UVFA 2ITDB 1BQHB 3VJ6A 2PW1A 3WXVH 1Q38A 2YHGA 4OTXL 5IQ7H 2B39A 1I8MA 1L0YA 2Z31A 4X6FA 4O4YL 1AKJB 4I3RH 3S88L 1GGUA 4M6ML 1IAOB 3I6LE 1F58H 2OS7A 3VXSE 1JHLL 1I7TA 4XCYB 1U3ZA 3PHQA 1ZE3C 5GSRA 5KSUA 3KYKL 4F15B 3MRBB 2EDKA 4XWGL 1DQLL 5I17B 3DSFH 4OZGB 3GSQA 4L3AA 3V9FA 5HHMA 1KN2L 2OTWB 2Y06L 5FUCE 4PRBA 4M43L 5DTFA 3TYGH 3NFSH 3MFFB 1IGTA 5GRUH 1HHIB 1OLLA 1RHHB 4N8VB 3BEWA 3UAJD 5JHLL 4M93C 4U1SA 4NFDA 3HI5L 3SDDA 2BSSA 4APQD 1VERA 2DQGL 2JELL 4X7DC 4YAQA 3QBTB 4S1RH 2VDKH 1J1XL 4BZ2L 5FYKU 3MZGB 5FKAA 2Y9RT 5DA4A 3P9LB 5ANMA 1WSST 3T2QA 4RFEB 3NZ8A 2KPNA 4BH8B 4Y2OA 3SBWA 2VKWA 2XY1A 3U0WL 1CE1H 1R3LA 5JZ7C 4JQIL 1G7PB 1A14L 4JQVC 5I15H 1CXKA 4UU9A 4Y2DD 4LVHC 4HK0B 4YHNB 1IAIH 3BJLA 1HH9B 3OR6A 1TQCB 4RGND 1F3RB 4G5ZH 5F9WB 3WBDA 1TZIB 3T0ED 4C59B 4OZHB 1Q9LB 3E3QA 2NTSP 5CSGA 1QFWM 1NEZG 4P2OB 3X14A 3Q5YA 2WBKA 3P0YL 1MJJB 2B0SH 1JRHH 2HMIC 2C3VA 2PR4H 5DJ6A 3MRKB 3VXRB 4WUUD 1RIUH 3S98A 1S5IH 2QV2A 4JFDD 1RJZA 1J9CT 1PVHA 4RDQG 1KN4H 3PGFL 1G9NL 4NQCB 3NFNA 5J1AA 3I2CH 1BGXL 3BD4A 2Y36L 3MNWB 1KPUA 1AC0A 1INQB 3H9SE 4X5XA 3JTTB 1FVEB 5AZEH 2P8LA 1N7ML 1VCAA 5J6GA 2NW2B 2NYYC 1J8HE 4LSSH 2JF1A 4HC1H 4DKFL 1OVZA 1VHPA 2WBWB 3KPTA 4PIRF 3WUWA 4YHZL 1YA5A 4RA0C 5F6IC 2CMRH 5L2KB 5EU6D 2V2WB 4JFED 1AIFB 4WY7H 1H8NA 4ZFOA 1G6RB 3MV9E 4OBRA 2J8UB 3V6FB 3BH8B 3KPOB 4KJPD 4ZXBC 5T33H 3HMWH 3LAFA 3MRRA 4YBHA 3L6FA 5K59E 5I71C 1XF2B 2CDGB 4KQ4L 5TQ0L 5DJCA 2G5BA 2HRLA 5F7LB 2IH1A 2X5PA 2F5AL 5A2KH 4X6DB 3GZKA 3W2DL 2R4SH 3STZB 1CXEA 4AG4L 1TJGL 5IHLB 1PYWB 1BOGB 2MOVA 3BJ91 1LO3L 1P84J 2A73B 3H3KA 4GRLB 3ZYOA 5CKAA 4ODHH 3QFJA 2DQCH 3LMJL 1LEKA 2BERA 3T2PA 3LQAC 1B3JA 4ZSOA 2WQRA 4U3XA 1CFQB 3LVEA 2FYYA 3QUZA 4XNYH 3TF7C 1DBBL 3RVXD 4XBEL 1UVQB 3MRDB 5IROC 1U8QA 1IGYA 3A0OA 1HK6A 3S3SA 5C09E 1XIWA 1GH7A 4APQB 3QDJD 3FB8A 4Z5RB 5DHVH 2X4SB 3K2MC 4PP1D 3DX8A 1DQDH 2NY5H 1VPOH 3PQYD 3ZHKA 1PJ9A 4J3XA 3EYVA 4FQIL 1OD7A 1QBLL 3P11L 1OP5K 1PW3A 2P5ED 4WFGD 1CICB 5SWSD 3ULUE 4K7PY 3VXQA 3WHXB 3NIGE 1CGSL 2VIRB 2DYPD 3WNMA 1U91B 4HWEL 1C7TA 4R0LC 5DQDL 2HFTA 4IBLT 2HN7B 2H32B 4QRTA 3SPVA 3EHBC 4HX1B 5ECJE 5BVJB 1MJ8H 1INDH 5IBTH 1YEDB 3T0EB 4XVSH 2VLME 2FO1A 5E03A 2VH5H 3MGOA 3M07A 1DJSA 1SJEB 2R9HD 4YHIA 3U83A 2FHCA 5E6ZA 3HZKB 5E9DE 3TLRA 4B0MM 2D7QA 3VXNB 4IOIA 2ZCLL 1ONQA 4IRJA 1DBKH 4D3CL 4JFDB 1JF6A 2QHRL 3F7QA 4L8SC 2VL5B 3BUYA 4KV5F 3FKUS 4A6YL 2GTWB 4PJ7E 4WTWA 3TCLA 1URLA 3GMLA 4FFVC 3U9PH 1RUMH 4WW2B 1UFUA 3WIHA 3VXUA 3I85A 3MRNB 4OZFA 1D6EA 2Z91A 5SV3A 4C57C 3MJ6A 1H0DB 2R4RL 2VABB 4QGYA 3OB8A 4RGOL 3MV8E 2R1XA 5GIRA 3ULVC 2XICA 2WBJB 4OLWL 4ZUVA 2AJYH 3D3VD 4MCZA 5K59F 4HAFA 4JFEB 4P2CG 2LU3A 3QCUL 5TDOA 2UYLB 4IMKA 4KDVA 2G5RA 3CFKA 4TOYH 3TA3C 3NA9L 4NJ9L 1QSEB 3NVQA 2OI9A 4GAFB 1FE8L 1I8KB 3TNMB 3L7FB 3DECA 5IEHA 1X7QA 4PJEB 3MMEA 3S8WA 1C08A 4TTDD 1PZ5B 5EUKB 2BVQA 3BRFA 4KDWA 1TVDA 1JP5A 1GIGL 4JO3L 4FQQA 3V6OE 5ESAA 2GT9A 4RAVA 2IQAA 5EU7E 3N50A 1OARL 5TFSL 4LSVL 4C58B 5CS7A 2HWZL 5FO8A 5KS9E 3ES6B 3TVMB 5KSAC 5J0BA 2IANA 2FBJL 1R5IA 3B9DA 3JSSA 3L3OB 3LEVH 1KJ3H 4LKXB 2D7OA 4WIQA 5FK9A 5DJYA 5DD3H 3UJTH 5D7IA 5I66A 1E0OB 4HT1L 1OB1A 3GI8H 5FV1L 5GZND 3GSNH 3WUZA 3L3IB 1RU9L 3WS6C 3WJLA 5KN5A 3KG5A 4EDWL 5E2WH 3VFNB 4JRYB 4PRPA 5E94B 2V6HA 2X4PB 3O6FA 5CZXD 3HG1D 3Q3GB 5DUPH 3RI5F 1KCGC 4WO4D 3QDJB 4D0CA 2B1AL 3DTXA 5L8JB 1BD2A 2X1OA 1T5XB 5T5NG 3NIGF 4ZO8A 4OV5B 1G9MC 1YNKH 1ZA3B 4WHTA 4CNIA 4Q9BA 3E8UL 2HT3D 2P5EB 4ZFFB 5JPNB 1OT2A 2FR4A 1QEWA 2OQJA 3DUSA 1A6AB 3GM0A 2OL3H 1WFTA 4ZUUB 2O5ZH 1OTTC 5EBLB 2PYFB 2QHLA 5DS8A 3TV3H 3P30H 4AMKL 4HJGA 3PJSB 35C8L 3VMNA 4FQJL 5E8PB 3MRHA 3DARA 2DD8H 1FAIH 2FJHA 1LEGB 4RZCB 2DL9A 5C7XH 3X13B 5BRZA 1TCMA 3A6OA 3DRQB 1UADC 5HYJA 5I73B 3PDDA 1ZHLA 2VXVH 4N0YL 2Q86B 4PJ7F 1BVKB 3HE6B 3T1FB 5I8CA 2XTJB 3FB6A 2FEDD 1YMHB 5GRJL 2OZ4A 1NC2A 5H35A 4FNLH 1NC4B 4GAJL 3IDYC 4JPIA 4Z7UE 2H9GB 3Q0HA 4YNYA 3OKLB 2O5XL 3BO8B 3GSUB 2R23A 3QIBB 2V7NA 1CDBA 2LV4A 3U4AA 1T89C 1V7NL 4NQDE 4XZUA 3MR9A 5IQ9A 1MWAB 1HEZB 1KIQA 4U6HA 3HTLX 2I27N 1U8KA 1U8NB 1INEL 4LSPH 3SKNB 1JNNL 2G2RA 5AYQA 3MXWL 5E4EC 5FDWA 5J11C 1EO8H 3D3VB 3PF2A 1EIBA 1U95B 4PJGE 1AQDB 4Z78B 5FAAA 5I1JL 1MNUH 5AEAA 1XGUA 2VTFA 4M62L 1U6AH 4K07A 4IOFC 1LO0H 5HYQB 4Z7OF 3SE4A 1KLGA 3O4OB 2MTPA 1HHGA 4ETQB 5KS9F 1NCCL 2NW3B 1RY7B 4IIQA 4PTUB 2VLRA 3C5JA 5I8OH 1XF3A 4IRZL 1ED3A 1BZ7B 2JJSA 1BBDH 3W9DB 2BFVH 4MJID 4J8RA 4NCDA 3AREA 4M7JL 4XHJD 4EBQH 5BV7H 4C56B 5GJSH 4PREB 1I9IH 1KXTB 3GJFA 3RTQC 3HE7D 1MJUH 5DSCA 4LOUD 4U1JA 4KUCD 4U05A 2R8SH 2APTA 2HLFC 2ZSWB 4ZS6D 3M8OH 4J3UA 1ZHNB 5D4QA 3V4VH 4U6YA 2QQNH 2DDQH 3VGDA 4QXGH 2PYED 1OAYH 3PHSA 3MRJA 4G6ML 1VA9A 5D2NC 3E2HC 25C8H 2NMSA 3BZFB 2ZZUT 3HG1B 2XXCB 1F5WA 5DDHA 5JHDD 2OK0H 1W72L 3NFPB 3OB0H 4BZYA 4LQ1A 4K2UL 4EI5D 5ELIA 1NANI 2AJVL 3DI3B 2BY1A 4KJYB 1AFVL 3R0NA 4PY7B 1D5ZB 5EWIH 1QSFB 2LTQB 4G8GA 1DQQB 3OR7B 3C8DA 1MHPL 4XPHL 4KZEL 1AXIB 5DEGB 1QBML 4J4PD 4OUUA 1ETZA 3QJFA 5J56B 4LSRH 2E9BA 3MQIA 2ZPKL 4FQLH 2VYRE 5EBMA 3TBVA 1JGLL 4NQEA 3D5OF 2V5RA 3JV4B 1YEIH 5IB3B 3JV5A 2XZCL 1NFDB 3LIZL 4ONFH 4FZ8L 4I8DA 4HIJA 1U3HB 4K8RH 1FLRL 1LHZA 4QTIL 1OP5H 3C5ZA 1IJ9A 4OD2A 3RDTA 1XGTA 3KPQB 2IFFL 1UM4H 4G8IA 5GGRA 4Y4KB 3D1MC 4Y1AE 1FPTL 4XCEB 5D1XA 3OAYK 1OM3H 4PJ5E 3U4BH 3EOAA 3IJSB 4NHCL 1E4KC 4YBLB 3AY4C 3O3DA 3IU3B 3CXDH 4PJGF 4Z76A 3L5WA 5FGCE 3FQUA 1UXWB 1TVHB 4FFZL 3GJEB 3SQBA 1RZ7H 5HGDB 3VDBA 4UBDC 2WIMA 1CWVA 1E6OH 3HFMH 2A74A 5IW6B 4G6AD 1D5XB 5DA0B 2E9WA 1YEKL 4MAYC 3SO3B 2PXYC 1YUHB 1NGPL 5EC1B 1I3GH 1BJMA 1NAMH 4XMKL 5I9QB 3CC5B 3SOBH 1C7SA 4CMMA 3CDGA 2ZUSA 4M5YH 2J12B 2X4UA 3O41A 2CLRA 3NACH 3MLYH 2D03H 2DMBA 5CSBA 2FNBA 4KKAD 1QQDA 5DRZA 3VRLF 1NUGA 5DHYA 4QRPA 3IKCB 1XF4B 3TPUA 1TTUA 5B39B 2ZNWA 4JN2A 5FO9B 2A6DA 1AO7E 4P9HC 4XNMA 1JUFB 5HGAA 3F7PC 3ZTNH 5KANG 5F44A 2UZYB 4RMUA 2EDYA 3HE7B 2BNQA 2CKBA 3VCLA 5C0GA 1AY1H 1PQZB 4OQ1A 3SE3A 5ACLA 4ZTPH 1YY8A 5DRNA 5EOCJ 4YK4B 3LS4L 4ZYKA 4AK1A 4ELKB 5ITBH 3FAWA 3OMZA 4JB9L 1XAUA 1W8OA 1P1ZA 3RX8A 3M17A 1T1XA 3VFMB 3KDMA 3BIBX 3DJ9A 4HFWA 3D0LA 1NGXB 4LCCC 4WFFE 1DBAH 3FMGL 4ODVL 3GSVB 5JHDB 3KS0H 3MLZL 1OTUD 4JZOB 4EI5B 3HNVL 4WU7A 5HHOD 2MQ3A 5MEOA 3CFDA 2I60H 2PTUA 2CRYA 4D9QD 3IGAA 4L8CA 1BFOB 3U1SH 3O2DL 2R29H 3ARXA 2JJWA 4OZGE 3VFSA 1BQLL 4OT1H 3JV6B 1DLHA 1KJVA 4PRIA 1U8OB 5CJOH 4DN3H 3TNNB 4Z77A 5FM5M 2ILLA 3NGBB 4GJTB 2AKRA 2GAZB 5K9JL 5IJKC 3WLBB 1HXMA 1FNGB 4G42B 1BWWA 5D1ZA 5IIEA 5DMGC 3T65A 1OGTB 5DRXB 3DURA 4QT5B 5HHQA 1BFVH 3N06B 4NZRH 3BZEB 3IXTA 1ZS8B 4GW5A 4U1MB 4BELD 3RRQA 4P4KD 2DM4A 3KNBB 2QR0B 5CJXA 2IAMC 3QYCA 4YBQC 1KNOA 3IJHB 3O45B 3IFOA 2O61B 3EW3B 4I48A 4LGPB 2YD3A 1RFDH 2YPVH 4Z8FL 2ZSVA 4X99B 1BJ1J 3GBLA 4H0GA 5L9DL 3QUMA 5EIIA 1IGFL 4JCMA 4O51B 1S7XB 5KZCD 3ELAT 1RZ8A 3A6BH 3T77A 43CAB 5GS2H 1E4XL 3GB7A 4F7CA 5JQ6L 1KCKA 5GRVK 3DNKA 4N1HB 4OZHE 4EXKA 4OF6A 2GJ6A 5GS0D 1QLEH 4HUKB 4JDTL 1QHOA 3BMVA 3V4PH 1IEBA 2VQ1A 3ULSA 1S9XA 3Q6FA 3MRIB 4L3ED 4NO0A 1HI6A 4NN5C 2FSEA 4YHOH 1T0NA 3UTQA 2VAAB 1CGUA 3VXRE 1KF9B 1WZ1H 4K94H 4F7EA 3DUHA 3HZYA 1OW0C 5T5FH 3IDGA 4XNQB 3V0AC 2IG2L 4K7PL 3S36X 5E5MB 5HDOA 4HCRA 5E6YA 4M8QB 1NMAL 1MRFL 5IW1B 4DGVH 4W4OC 5D7JB 4NFBA 3ZMRA 4UDTA 1ADQH 5CP7B 5DVOA 4JM2D 4P23C 4Y5XA 5F3HB 3QRGH 1MHCA 4JFQA 4M7LH 1KB5L 2X42A 1DVFA 4TULH 3SDXB 1BQUA 2AABL 3UX9B 2VZVA 3JTCA 4IRSB 4OIIL 3HR6A 4ZOAA 3KJ4B 2AXGA 1T1ZA 5L2KE 2XZZA 4HXAL 2XWTA 3F7YB 3LDBB 5CGMA 3LPWA 4HV8B 3JV0A 1FJ1A 3SEPA 2OMBA 1HSBB 1I7RB 2J8UE 2HVJB 2Z8RA 2CK0L 4KFZC 2NLJA 4KTDH 4OM0L 3H7BB 1YNTB 1JYVA 1FIGH 4WEMB 3CUPA 3FRUB 4PJCB 3PWVA 4P46C 5CD5C 1VGEL 1JZ3A 2NY1B 15C8L 4JGJA 5T3ZD 5CGYD 4X6DE 3MV7A 1I8LA 2FX9L 4LARH 1IZJA 1E27A 2ZJSL 3BPLC 3IFLH 1X4ZA 1A6WH 2X44D 1B4JL 3CSPA 4ELMB 4GH7B 3IFNL 2PO6B 2EDLA 3VG0H 4GAGH 4BM7A 5T1LA 4QY8A 3ETBF 2P8MA 3KXFD 5I30L 2IBZX 3DX9A 2OJZH 1PG7L 1T1WB 3VWKD 4L29B 3HNSL 4XI5C 1F4WL 3GBMH 4ZAKA 3HI6L 4JFHE 5FKPB 3MRQB 4IHOB 1JPGA 5FYKL 1U8PB 2XKNB 4WCYL 2VITB 5J9PA 5D5MB 2KL6A 4OM1H 2WINB 2EDHA 2XI9A 3QIUD 3RWDA 1ZLUK 5DD5H 1ITBB 3O2WH 2X1XR 2HJFA 2VERN 1EEUA 1FZOB 3RIFK 1RUPH 1EA9C 4O2EB 5DJ8A 4N1CA 3BDYL 1RZKH 5FCSH 1AXTH 4C83A 4I9WE 4BQBA 3C2AL 1T0MB 1HXYB 2EIDA 5T1KA 2MCPH 3U46A 1IMHC 2BNRB 2YEZB 5KZCB 5D71H 3CNKA 3ARGC 4MQXC 1M7IB 1P4BH 5IBLC 3PWLA 3I6GA 2F9BT 1K8DB 1AHWA 4CADA 4TUOB 3RWCB 1AGEB 3T0EE 1VFAB 4H8WL 1GGBH 1CGYA 1X5XA 1WZLA 2UUDK 4KMTL 1EK3A 4PY8J 4KRLB 1MFCH 3QAZB 3AU1A 1QFUH 2NY7H 2DQFB 2QL1A 1JK8A 2YA2A 1QRND 2YUVA 1FGNH 1S7SA 4WFHD 1LO2L 3E6HA 4G80A 4PV9A 5FYJU 5F88A 2ZUUA 5C0FB 2W0KA 3OWEA 1LNUA 4JFDE 1D9KA 1I1AC 4BA8A 5EU4B 3KYOA 3FQNB 5CJBA 3SDCC 3OAYH 4KY1L 4QOKD 1NCDH 5EO0B 2R0LH 1GAFH 1G7QA 4PGEA 1P84K 3I9GL 3MOAL 5EUOB 1KBGL 3QO0B 1G7HA 2EYTB 5DD0L 3WEXA 3HCVA 5JNYB 3RKDC 5DQJA 1JHTB 4WDIA 4F58H 4NP4H 1I75A 5F97E 5EZJB 3O81A 4X7TA 1KV3A 3TYFB 5TPWH 4V3DB 4OF7A 4JFEE 1KJ2B 1CXIA 5BVPH 1H3PL 3UXFA 1QSEE 1E4XI 5CAYB 2YPLD 1G7MB 4QHKJ 4PJEE 5TH2B 1MVUB 2BHUA 1U8MB 1FN4B 2XV6B 4NHUB 4NRYB 4QRRA 4AT6A 1AGFA 4YHKL 4MJ5B 1KXQE 2XACC 3H9HA 4OIBA 2A9NH 3FFDA 1I9JL 4J1UA 3WFBL 3RWIA 3B9KC 4R4FL 4KQ3H 1WGOA 4PG2A 1IEAB 3G6JA 1NEUA 3KPRE 5JZ7D 2B1HH 3KPNA 4N8CH 2GFBA 3QXWA 4I0PC 1IKNC 2GITA 4E5XA 4NBYB 2B5IB 3WFHA 5JW5B 1I7ZA 1RURL 2XRAH 3VWKB 4HW6A 4BUHA 4NKQB 4J7RA 5I1AA 4JRYE 3K3QA 1Q0XL 5F71A 1P7QD 4JFFA 4BH7A 3KYMA 3QNZA 4B7IA 1UA6H 5DK2A 3CMOL 4RX4A 1DE4A 3QDJE 3QIUB 2HMID 1N0XL 4NJAL 4KVNL 1MH5B 3DUUB 1YC8A 4ODSH 5B8CA 1MHEB 3F6IA 1U92B 5AUMA 2W65B 5HVFB 1X4XA 2IQ9L 3S4SA 4DUWA 1A6TA 3GJFK 4WI5A 2P5EE 4LNVA 4FQXB 3B9EA 4K23H 3RVVC 2FATL 1WBYA 3GK8L 3RGVB 1A6VH 1FFPB 1RMFH 4U3CA 4F9PC 4JVPA 1TMCB 2NYYD 4PGJA 1G9EA 1SEBB 1RULL 3SGEI 3LKQA 4NO5A 2DIJA 2GQHA 1XCTA 3D39A 5IM7A 4J3VA 5FGBC 5ICYB 5F1KC 1KT2B 1XF5A 3VH8A 4JG0L 1P4LA 5DD6B 3T0BA 4JN1L 2BSTB 4QHNA 5JXEC 1QVOA 2HH0H 2XTJE 2YD5A 2F54B 3EYOA 4ZXBD 3D69B 4MJ6B 4D0BB 2AEPL 4Y4FA 3TO2B 5E24E 5MERA 3T08A 4HUVB 3SCMA 1U9KA 2WQ8A 3ZE1E 1WITA 2ARJQ 4N1EA 3DHJA 2ZOLB 3DX7B 2P46B 2EXWC 5FOBA 4DFHA 4DGYH 1NBYA 1NEZB 2N4IA 3C6SA 3WYRA 2A83A 2OR9H 4NZTH 4WGVB 2A2QT 1CDUA 3OX8B 3DMMA 3JZ7A 5AWNL 4YDIH 5FUCC 5GS0L 3EO1A 1YEGH 3WV0A 3D3VE 4F37F 3BWAB 3RWFB 1NLBL 5JXAL 3GIVB 3WL9B 1DL7H 4N9GB 1NSNL 1R6VA 4BSVB 2BNUB 3QUYA 1U8HB 2YPLB 4MA7H 4M93B 4HS3B 1OSZA 3MODH 4I3SH 1IGML 5HHPB 2OM5A 3QCVL 4QXTB 3JUZA 5D2LB 4ZUWA 1VGKA 1A4KA 1GL4B 3SGKA 4E0RA 3D9AH 1A7OL 2CR6A 3NABL 3PABA 1BZ9B 3WKNA 1CDJA 4Q7DA 1X5HA 4RGMC 3QWOA 2YK1H 5DRWA 3WIFA 5C08B 4C56E 3VD7A 4M5ZL 2Y25A 4KVCL 1A47A 3B9AA 4NKDA 4WNQB 1MCNA 3JWOH 1T5WB 4OAWB 4LVHB 4RNRB 2UWEA 2Z92B 5HPMA 1M6OA 1Y6MR 3B5GA 1EMTH 3EHBD 5FYLE 2BCKB 1MRCL 2D7TL 5B4MC 5ITFB 1AGCA 4B7LA 2XFXB 4N90D 3T3PE 4P3DB 2P8PB 1TQBC 2C3XA 4OKVA 4MD0A 4JR9L 1P7QB 1GGCH 3MLXH 3HG1E 1OGAA 3WIHH 4OCWL 2Z93A 5SV4A 5DJAA 5FB8A 4OZFH 1LILA 3P77A 5GISH 4UV4L 3QQ3A 4QNPF 5TDPB 5KAQG 5T3ZL 3G5YB 4XVUC 3RZCA 4R2GC 4PRHB 1IC7H 1QSFE 3CDYA 4HWBL 2NXZC 4AY0A 4P57B 1MRDL 3GMPA 3L3HB 2GJZB 3BZDA 1L7TH 1EAJA 1FFOA 4FFVD 3WNLA 3V5DB 4GSDH 5IG7A 5J06A 4ODWA 3SQOL 2L0DA 1A9EB 8FABB 4NM4L 5ICZA 3V0WH 4JKKA 4ZD3L 4N0UA 1JWUB 5BOPA 3QXUA 2ICEA 4CJ1A 4M7ZC 4F9LA 5DVLA 3ULVD 1JFMA 1NMBH 1XGPA 3P4LA 3UBXI 3DO7B 3O2VH 4MA1B 4LLVB 3QWRD 1EXUB 1NFDE 3L3DB 1BBJB 4MQTB 3TA3D 4NWUL 3B83A 3VRJB 4FA8A 3CVHL 3ZE1F 1IAOA 4KZDL 1FCCA 4ZXBB 3OGOE 4U1KA 1P4IL 2LU4A 1VACA 5C0EA 1WEJH 4NQSA 4QCIA 2Y07H 1NGZB 4YEEA 3DBXA 3HB3C 4F57H 3X3FL 1C12A 2FGWL 5JOFA 1IC5L 3WO4B 3UEZA 2OTWA 3CXHJ 2UUDH 1ERNA 4NPYA 4Z0XB 2GSGA 1KTKE 4KWUA 2WZPD 4LHUG 5KSAD 5TE4L 2DKUA 5GGTL 2CJUH 3VFUA 1YDPB 2KDGA 5I1DB 1JZ4A 2QADC 4NUGH 5INDA 1CLYH 3QI9C 4XPFL 1JV5A 2DQEH 4WEUD 5E2UH 1T7ZA 2J2ZA 2DJUA 4LF3B 4J3SA 4Y16C 1ZMYA 1FZMB 2RGSA 4J23A 2F53A 2IMMA 1MFBH 3NTCH 2VJXA 1HILA 3M1BA 3V0VB 5LG1A 3T4AB 4A6YA 2VE6A 3HUJF 4OF5A 4N9OB 1EEZB 4G9DB 1DBJL 4OD3L 5T3XD 3Q6GH 3SJVD 3VMPA 2V17H 1VADA 2FJFB 4KMQA 4HG4J 1PG7W 3MREB 3L5IA 3BIKB 1Z9LA 1HH9A 5F9DC 3PGCB 4P5TC 2VLJB 2BJML 3TJHA 3ULUC 1N0LA 4X80L 5IF0B 1CN4A 1JN6A 1U41A 1E4JA 2E9IA 5KVDH 2C1PB 1OTTD 5E1AB 2OZ4H 4R0LB 2D31A 3QQNA 4I5BB 1J1PL 2OJEB 3MCLL 1T04A 1CGVA 1MCSA 2IPKB 5EA0L 4HIEB 4LKCA 2FO4A 5ALBL 5J4MA 2DBLL 2EO9A 4Z7VB 1KIPB 4EKXA 2J1KA 5CBEA 3RI5K 1RZGA 2FZ3B 4K3JH 1RUQL 4XBGB 3ARUA 4Z7QE 1FGVH 4P3WA 4UILH 5JHDE 4FQHA 4O9HH 4NQCA 1C16B 1XGQA 3I6KA 3UTTB 1Q72H 3QRFM 4YDJA 5FIEA 3X11A 1OCWH 2B7DT 1PEWA 4PJ8D 2R0WL 3QUXC 1JFQH 2ITCB 3MO1B 2W92A 1NBZB 4ZS7L 3GHEH 4Q6IB 4WHCA 2XN9B 3OAZK 1VB9A 3RPKA 5CSZB 3G9AB 1KG0B 1QSZA 1F4XL 1IT9L 2AV7B 4DW2L 5FYJD 3QEGL 4OKDA 3O4LA 1MQ8A 3QDMB 1LQSR 3BH8A 1NUNB 1FG2A 3U4EB 5DD1H 1H8SA 1N59A 3LZFH 4Y5YC 1KEGL 1JPFA 1T22A 2Q8AH 2BOCB 3FO2A 3TA3B 2B2XH 4LCYB 4MWFA 4OLXL 1CDIA 4OCRH 3GJFH 4NGHL 3GRWL 3PL6C 3MJ8B 4IOFD 4ZDHA 4UIMA 4H0HB 2JB6A 3NAAH 5C0BE 5C07D 3D2UA 3WNOA 4TVPH 3V6OC 1NGQL 5IMLA 2H6PA 4XNZB 1C5BL 1EGJL 3BN9C 5F96L 2E7LC 5GGUB 4JG1H 5EU7C 5LGKA 2WSKA 4FZEL 1NGYA 5KVGL 3T1WA 3MYZA 1UYWH 1A1NB 4U49A 2EEBA 3WO3B 1N2RA 3RTQD 2VISA 1X4YA 2VLKD 4GMSL 4M7KH 1D6VH 5C0IA 2HLFD 2X4TA 5KW9L 1N5AB 2MPAH 2B4CC 1MVFA 1HQ4A 1XH3A 4JZJB 4WJ5B 3QEQD 3T3ME 3GMQB 4XP6H 2A0LC 3WNNA 1FAKT 5F7YC 5CJQL 3I84A 4PUBL 2JCCF 3IETA 3MGTA 1Q9KB 4AENA 4JVUA 3SDXE 3SJVB 4PJBB 3S96A 3QB7C 4TTGA 4KUCF 2NCMA 3HC0A 4Y2DA 4LVOC 4DZ8B 3BZ4A 5JO5B 4GOSA 4U7MA 3UO1L 2EH7L 2RFXB 4G6JL 3V6ZB 2H32A 3FFCA 3TT3L 4RMSA 3P0VH 1R5VB 1R5WB 2R2HB 2VXTL 4P59H 2SEBB 3GMNA 4LLWA 2AJ3A 3MACL 3SGJA 4TSCL 1JWMA 1XT5A 2VDQH 3MLVL 4AJ0A 1UENA 1U42A 4D9LH 1BX2A 1HKFA 2ICES 2Z4QA 3LQAL 4FMFA 4AIOA 1CS6A 2NR6C 2E27L 2Y5TB 4PJCE 1FRGL 4RWYH 4S0SD 2W0FA 4WUUA 3ROOB 4MB5A 1CTOA 2V9TA 2CDEA 3BGMA 1WTLA 5FO7B 1UJ3C 1AC6A 1QFWH 1GGYA 1X5AA 4WUKL 5ADOL 1FNLA 4NC0B 5MHSD 5HI4C 1IFHL 2V2XA 4Q58C 1BWMA 4ELME 2ORBL 4P2QD 4AM0A 5JW3L 2APWA 3S5LA 4PJ8B 3MRNA 3B9VA 5IMMA 3FQRB 1F90L 3RWEB 3AMKA 2ADFL 3QT2A 4DVBA 4ZTOL 2IGFL 1CD1A 2P48B 3G6AA 2ATPA 4WRLA 4JHZA 3WLWC 4PJIF 4ZOBA 1QRKA 3IJYB 5TE7H 1U8IB 4M6OH 4OFYD 5EU6A 5D5ME 3S34L 3QIWB 4MCYB 1NCUA 3DGGB 3S35H 4LPUA 7FABL 1UH3A 4EN3C 5C9JA 3LEYL 3RL2A 3UDWC 1I8KA 4J3TA 1OAQL 3G5VB 4KK9C 4UBDD 3O3UN 5E4EB 3BAEL 1W72A 3OXRB 4Q9RH 5EUKA 4MAYD 1J05A 2PXYD 3GO1H 3FRPG 3K8LA 5EN2A 2FBOJ 1HKLH 2PNDA 1FO0B 4XPBH 1HZHH 3EBAA 2CKBH 2DM3A 4NOBA 4U2YA 2BNRE 3HI1A 3BKCH 4EEEA 4ZOEA 3BP7B 4K7FB 1KC5H 1NLDL 5EIQA 4Y4HA 4X4YA 3SGDI 4XC1L 3A67H 3OKKA 1MUJB 1WAAE 4KTEL 4JFXA 2CLZB 3ULVL 4LFHD 4Q2ZA 4ODXB 3Q3GA 1GGIH 2PW2A 5B3JF 5BW7A 1YEJL 4RSVA 1AI1L 5D2NB 5I1HH 2FX7H 3E2HB 5ACZB 1IL1A 4TVSa 1T5XA 3MRLA 5TQ2H 3PQYA 2HRPL 4XVJL 1U0QA 4Y5VB 5JPMA 3V95A 2ZUXA 5J7CC 2GCYB 4L3CA 5FUOL 5JOEA 2RAMA 4EVNB 5EUOE 3C60C 3NZHH 4YGVA 5SWSA 3WFEH 1B2WH 1N5YL 4FXGA 1CR9H 4MNGB 3QDGD 2PTTB 2DYPA 5EBLA 1MI5D 4LSQL 5TE6L 4GKSB 3PJSA 4XMPH 5HDQH 3LKPA 3QQ4B 3SE8L 2HKHL 3DLQR 4RZCA 4KXZH 1G0YR 5D72H 5CHNB 2Q87A 1X5FA 5I6XC 3MLTA 1JMXA 4JO4L 5D9SB 5FM8A 1AP2A 5IFJB 5SWZD 2G60L 5IVZB 2Z31C 1HDMA 4K9EH 3WN5A 5HHXH 1UACL 4LBEB 3IDMA 1T4KA 4NHUE 3CVIH 1MY7A 2XQBH 2EDXA 1A2YA 4KRPC 1MREH 2ZUTA 2ATKB 2R2EB 2YPKB 3FCTA 3GNMH 4NQXB 2IAMD 3FQTB 3U9UB 2ADIB 4YBQD 1EEQA 2D4DA 2CXKA 3UTPD 3PIQA 4HKXB 1MCEA 3OKLA 1EVUA 1M1SA 1FYTB 2AJSH 3GSUA 5T3XL 1EO7A 5I18L 3HC3H 3JWDC 4KPHH 3HZVB 4U0RC 2Q8BL 1F8TH 3MLWL 3IVKB 1G9ML 1HEZA 4KRMB 4UQ2A 4G7YH 3BP5B 1UC6A 2H3NA 4YHYB 2D7NA 3BQUB 4MX7B 2UY7A 4QLRA 3LKOB 1ZT7A 5C0DB 4PV8B 4Z78A 3TT1L 3KYNB 3N85L 3O11A 4H20H 2FX8L 4HPYL 3ZDZE 4F7TA 3HR5B 1A5FL 4YHML 4TNVF 3QZWA 1DUZA 1JGVL 3VWJA 1NCBL 2EYSA 2AQ1A 2PXYB 4PTUA 1YPZF 1N4XL 4R7NA 5C0CD 5EPMA 3TN0B 3O2DA 1PKQB 1L6ZA 4YHPB 4JO2L 4K3DH 3ZKMC 4PBWD 5E2TH 4P23D 3HUJA 4PGDB 4M3JA 4NNXA 4TNWF 1C5CL 2E7HA 3B6SA 4QWWC 4PD4J 3MRFB 4XX1G 1WAAF 3VE0A 2Z0BA 3KLDA 1ZLVH 1SEQH 4LLYB 3RKPA 3QG7H 1I3RB 1CT8B 4ONOA 3ARFB 3GUTB 4PB9L 4I77H 5FYJL 1YNLL 3KPSD 4HGWB 1S5HB 5MI0C 3RY6C 4ENEC 3EOTL 5DJDA 4HUWB 4KDTA 2F54E 1KENH 3DYOA 4LP4A 4WFHE 1UM5H 3HNTH 3IRPX 3LN4A 4WO4A 4JM2F 3NH7L 2NQCA 4POZC 4S1QL 3ECBB 2X89D 2MKWA 4P46D 1WUNT 5CD5D 1J0YA 5IB5A 2Y7QA 1ZEAL 4LCCB 4BZ1L 1U2CA 2RIKA 2YXFA 1U58B 2H8PB 1D5ZA 4HJ0C 4IMLB 4MGXA 3MJ9L 1CGTA 5E8DL 3WSQL 5DEGA 4UV7L 4OCLC 5I2IB 1J7VR 3QDGB 1LDPH 5A2JH 3A6CH 4JRXB 1MI5B 2MKLC 1W0WB 4WU5B 2WW8A 4LSTH 1IBGH 4GG8B 1MAML 1ZA6B 3EYSL 2APXA 3ARRA 1A3LL 2DLEA 4WW1B 2PCPA 3QUKB 4MD5A 4OF8A 1D3CA 1MLBA 4K3EL 2YBRB 5SWQA 4S1SL 6FABL 5SWZB 2YPLE 4AEIL 2Q3AA 4RBPK 3QXAA 2JK5A 4P0DA 2OTUA 2VDMH 4O58H 2ICWB 5D2LE 2VQTA 4RQQA 4O2FA 1QACA 4UOW1 2IAMB 4B50A 3RU8H 4JDVA 3TFKC 3OPZL 4KROD 1KB5A 2QQQA 5GZOC 1OTSC 4X7SH 5C08E 4JJ5B 2XZAL 5DUBB 5KVFL 4OQTL 5D6CA 12E8H 1F42A 3HN3A 2NNAB 1TVBA 4Q9CA 2AEWA 3ARGD 4MQXD 1TQCC 5HXMA 1P2CA 4MSWB 5F9WC 5IBLD 3TWCH 1FNAA 5IB1A 1HHJB 3GJEA 4HQQL 4R97C 1K3IA 3NN8A 5TF1L 1UM6H 2YUXA 4CGTA 1AQKH 3MA7B 4P2OC 5IW6A 2HLAA 5AYUL 2H2PC 4ONGL 5D1QB 1AGBA 5HY9B 3WUWG 5HI3C 3RVTC 2BXZA 5DMKB 3CFEA 5SX4I 1AE6L 3ARDA 4HMCA 4XCFL 1KCRL 1FL5B 3TEUA 4D0DA 4PRHE 1I1AD 4BSWA 5C0CB 5J6HB 4LASH 5BS0A 3SDCD 5BZWB 2DLHA 3CFCH 1P9MC 2X4OA 3LS5H 3LRSA 1WVZA 4C4KT 4MJIA 1S7VB 1BM3H 4FN0A 1U93B 2JCCA 4NDMB 3DPBA 2IBZY 4V1DB 3TBSB 1FZKB 5LQBL 5JTWA 3GSWB 2XQYK 4NRXA 2P47B 3G04B 5C0RL 2HTKC 4PRAB 4ZODA 1QLFA 4XNXH 1ZWIB 1BFSA 3RVWC 5ENWA 4JFOA 2PYEA 1QP1A 3B2VH 1LEIA 3GMRA 3BE1H 1H5BA 3KPSB 4U4BA 3JWOC 3OJDA 5A40E 2HFGH 2YD8A 1MQKL 5DJ0A 2C3GA 2UZIH 1JZ7A 1OAKH 4QRQB 2IADB 3FONB 1EV2E 4P46B 5INCA 5JQHC 4NOFA 3N1GC 4OZ4B 3MROB 4BQ6A 3NPSB 4WTXA 2W9EL 1KLFA 3VI4E 4LCUB 4U1IB 1PY9A 4U1LA 1JVKA 5KG9A 3BPLB 2Z8SA 3B9KD 3EZ8A 1D5BA 4OTXH 1T21B 4P2RA 1QR1B 3P4OA 3VFWB 3BEVB 4O4YH 2AK4B 5CKGA 4GRLC 4OFPA 3S88H 4M6MH 3CSYA 4RDQF 1OT1A 5DYOB 5BJTA 4J4PA 3RFZC 3REWB 4I0PD 1U3YA 5T1MB 1O7SA 4TSBL 5BXFB 1JHLH 3PWUA 1K6QL 3V79C 1KACB 4PJIA 3KYKH 3O6KL 5D2LF 3LKSA 2Z35B 1DQLH 4XWGH 1NKOA 1TZHA 2V5MA 5JIHA 4APQC 2BP3A 2E6JA 4Z7WF 4MA8L 5KSVA 4M43H 4HIIA 5GJTL 3F58L 3GSRA 1R3HA 2WV3A 3P73B 3RPIA 5HDLA 1DUYB 2X4NB 4OB5H 1NJ9B 5IT2H 2I26N 5JHLH 3GMMA 5CEZL 4QRUB 3RNQA 3UROR 4BKLB 2EIBA 3RUGF 4KROB 4QXUL 3L7EA 5F9JA 1YN7A 2ZOKB 2DQGH 2JELH 5DURB 2VLJE 2VZ3A 1CICC 1J1XH 1UWEL 1ZT4B 3BESR 4GKNA 3EGSA 4WI4A 3O9WB 3RVVD 5JLZA 1H9VA 1S7UB 3ARGB 3MUZ1 5EZOL 1FDLL 4ZFZB 4HWUA 4JPWL 2HFFB 3S35X 3U0WH 4PBVC 3L5XL 4XAKD 4GS7C 1RZIA 2Y23A 4JQIH 4Z7VE 4OZFG 5MENB 5F8QC 1A14H 2V9QA 3T8XB 4X9IA 4TPRL 3KLHC 4IS6B 3BHBB 4L4TA 5F1IA 3P4NB 3MRMB 1KPVB 4M8QA 5JXED 3UTTE 2FEEI 3EFDL 5IOPB 2QSCL 5DI8B 5A3ID 3H0TA 2I5YL 3KPPB 3BW9A 4KHXL 3UBXA 3ZDXE 5DQ9B 1XGRA 3V5HA 4M6AA 3SDCB 2LE9A 5L2JA 4Z9KB 2XN9E 4WW2C 1MELA 3CXHK 5DHVB 3VXSD 3ZE2F 5BQ7A 5F89A 3TJEH 5HYFA 2EXWD 3SKOA 4U3HA 3PGFH 5GGVL 1G9NH 2RHEA 1XFPA 3QDME 2HVJA 1BGXH 2WBJC 4MS8C 4XB8A 2EDBA 1S7QB 2Y36H 4X6EA 4JM4H 1CXHA 2IEPA 6CGTA 1N7MH 1YEHL 1MFDL 2Z9TA 4PTTB 4RIRB 2ED9A 4PJ9B 3V52L 4DKFH 4DTGL 4BFGA 3O3EA 4QYOA 3MRGA 3VXOB 3STLB 3BVNA 4YHZH 2BX5A 3VRIA 3T4YA 3TM6A 1ND0B 3FHQA 3LV3B 1ZTXH 4MXWL 2IALB 3SO5A 3QSKB 3OJMB 4LP5A 2DOCA 4ZMAT 4HHAB 5HHOA 3O6LL 5EFIB 3GBNL 1CE6B 5DJXB 5EU5A 4HG4K 4XXCC 1G7LB 4MNHB 5FA4A 4HS6B 4FABL 2VDKL 4YPGB 5EOTA 3TVMC 1MF2L 1T1WA 4KQ4H 4IDJL 5F3BB 2ARJA 3BPCB 3BGFB 3W2DH 4H25B 1Z5LB 2RCSL 4NRZA 4I0PB 5EC2B 4AG4H 4F37K 3PGDB 1Z3GL 3ZT6A 5DC4B 1JE6A 1LO3H 5B4MD 3VW3L 2Q76A 4I18B 4P4KA 5C1MB 4NUJB 1SJHB 3LMJH 4N0FB 2APFA 5C2UB 2EYRA 3SE9L 3C87A 4LIQE 4JFYB 1DBBH 4H5SB 3D25A 3SJVE 4IJ3B 5ISZD 4X6CF 4PJBE 1NL0L 3PHOA 4LEOA 3JUYA 2CLVA 4R2GD 3AREC 5E8OB 2EKSA 3ALWA 1YPZA 2EDRA 4DEPB 4GUPB 4YDLB 3CK0L 1A1OB 4PP2A 1RIHL 4WWKA 4LRIC 4Z7VF 5B22A 3OKOB 4NYLB 3H9SD 1ACYH 3UPRA 2UVEA 4H1LA 4FQIH 4R6UA 2YSSB 3NCFB 1RQ5A 1QBLH 3P11H 1J8HD 4L3EA 4RBPH 1L7IL 4UDUA 1T3FB 3OKMA 5L88L 1T0PB 4OZIF 1JGDB 1CGSH 3QNXA 4HWEH 1Q9WA 3MV9D 3DI2B 5ADPL 4OLZL 4Z0BL 3HE6C 5GS1A 2XTJC 2C26A 4HPOL 3C5SA 4CN4A 3GSNB 1ZOXA 4JM2A 3HAEG 4NSKA 1GCFA 1QLRA 4O00A 5ESVB 2EIZA 3HB3D 1ZKAA 2EICA 3QIBC 1Q9OA 1SBSH 2OP4L 3ZKXB 3ULVF 2GHWB 2ZCLH 4ZPVA 5T5NF 4D3CH 3FO0L 4K3HA 2QHRH 1GVIA 1FSKB 2HA1A 5EDXA 4A6YH 1S9YA 1BAFL 3CZFA 4UIKL 2BMKA 4RRPA 4K71B 4GBXB 4E42A 1JGUL 5ILTL 4PJHA 4V2CB 2GK0A 1A6ZB 3LN5A 3QPQC 2QADD 1MVUA 3QI9D 2P7TA 2GUOA 3C5ZC 3MYJA 4KC3B 4Y16D 4HKZB 3RDTC 2OL3B 1DQMH 2I07A 3R1GL 3VXPA 5ESQA 3RWHA 4ERSH 2R4RH 2DQDL 4RGOH 1A6UL 1ZLSL 4DKEL 4OLWH 3IF1A 1P5VA 1HSAB 4QRSB 4WV1B 4XCNA 1NANH 2DTML 4HWBA 3NA9H 4HWZB 1CFSB 2YA0A 1PX4A 5A2IH 5AG8A 1FE8H 3PV6A 5HGHB 4X98B 1J0KA 3KXFA 4RGMB 2GSIB 1MCWW 4X0KA 1HHKB 1UB6A 4U6TA 4H26B 4P5TD 2WWMC 5CILL 1GIGH 3ULUD 4JO3H 3IU4L 2VRAA 1KLUB 1A6PA 5C92A 5BCAA 4BSJA 1GZPB 1JMZA 4KI5E 2X7LB 3L3GB 1WT5C 1OARH 4LLQB 4LSVH 3F7VA 5TFSH 3TC9A 2YC1B 3QIUA 5GGQL 4NKIL 2MMXA 2VLMD 5HSFA 4XPAL 3CVHA 1ORQB 1S9VA 4RA3A 5D2NE 4XMLL 3WXWH 4G8FB 2P49B 1OQOA 3EYFB 5AD0B 4AL8L 2XA8L 4HUXB 2FWOB 1TPXC 5E9DD 3BYTA 4EDWH 3E1F1 4G8EA 5ISZB 1WC7B 4MNGE 4XPTL 3U79A 1EAPA 3QUXD 1W2KT 1CF8H 2B1AH 5GSVB 1HOCB 5ICXA 1TMCA 2BXYA 4ODTL 5GGTA 4OCYL 5E6IB 4N8PA 2P5WD 5ICYA 3VXTB 2IBBA 2J8OA 5JW4Q 3QDAA 1IAKA 3E8UH 4EQ2A 1JHKL 3EO0B 4U7KA 1QRNA 2CGRL 3MV8D 3U2SA 3DX6B 4LLMB 4M7ZB 2CRMA 4J3OC 1Z6JT 5BV7B 4PG9B 3ROLB 2I24N 4AMKH 1U3HC 1SYSB 1WFOA 3TO2A 1TNMA 3F8UB 5EORL 2DKMA 4WFEE 1BIIA 4FQJH 1T1YA 3GIZL 1FYTE 2OYPA 1PSKL 1K8IA 3IFPB 4QOKA 4AEHH 4B53A 3PL6D 5DC9B 5CBAB 4Y4KC 5GRZA 3QA3A 4GLRI 4MLIA 1A64A 2X1QA 5GGSA 4CMHB 4N0YH 4OSUH 4G7VL 3OKEB 4ODBD 3BN9D 4MQ7B 3AMLA 5GRJH 4YBLC 4GAJH 2CSPA 3BWAA 5I1EL 4OFKA 3S36L 1MOEA 4U1NB 3HZMA 43C9A 2O5XH 3MNZB 4HZAA 4PFEA 2ADGB 1PEZA 2NY0C 5DR5L 1V7NH 3QI9B 1VEMA 4PRNA 3SO3C 4EOWL 2CO7B 3SY0A 4E41A 1INEH 1AR2A 5HD8C 5I9QC 1QSVA 4D8PA 5CMAB 1JNNH 1WISA 2A0LD 2DMKA 3CFIC 1PKQE 3MXWH 3MX0A 3GSNL 5E5UB 4Z7WA 1BECA 5M94B 2EDWA 2RBLA 2D9CA 4ONHB 5E2WL 4Z95L 2IH3B 5HVHB 5I1JH 2R1YB 5I1GL 4JQVA 1A21A 4LHUA 4M62H 4M7LT 3U0TB 1J87A 1F3DH 2CKNA 3RUGA 3TBWA 3BWUC 1IM9D 3SDAD 1NCCH 1OQXA 3OJVC 2H1PL 1Z0MA 4FXKB 1LE5B 4LOUC 2IPTL 3GSXB 4IRZH 4P3DA 5I1LA 2VN4A 1EEYB 2W1NA 4YK4C 4EI6B 3OHXA 4G6KH 1B0RB 4M7JH 1PKOA 4FP8L 2NR6D 4LSUH 4U1HB 5TDNB 2VUYA 1M7DB 1EBAA 5K9KA 3GRWA 4BFEA 2CDFA 1FFNA 1Q1JL 4YR6B 2ENSA 4LLAA 4L8BB 1FAIL 5BZDB 3ZYJA 4EI5C 5DLML 4G6MH 1EGJA 3KJ6L 5HI4D 2VSDA 3NCEB 4PJDF 4X9BA 4LLUA 1T7XA 5E2VL 4JRXE 1MI5E 8FABA 3GMOA 3HPJA 2OR7A 1ZHKB 4UT7L 2ZWLT 1NAMB 1W72H 3IS0X 4YPJA 4K2UH 1IILE 5EG6C 3IDIB 3NGBC 5EOQL 2DWEB 1R3KA 3WLWD 1IC4L 3LCYA 4NQDD 2P5WB 2VL4A 5SWZE 1EXUA 3VFOA 4CVXB 4LMQI 2VKXA 2F58L 2GTZB 4OGYL 1ZHBA 3KR3L 2IC2A 2YRZA 4AEEA 4XPHH 4KZEH 4EN3D 3QWQB 1I8LC 4FTVB 1QBMH 4ZXBA 4PJXB 4KK9D 2Y1VA 4Y5YB 2EDEA 2ZPKH 3FTGB 3UTPE 1XCQB 4NKOA 2M8XA 1X5JA 2C1OB 1JGLH 1Y6KR 4FQ2L 3OKYA 3RA7L 1NFIA 5DJ2A 1EO8L 1SYVA 4X4XB 4F2MB 2XZCH 4FZ8H 5EO1A 1MNUL 1FLRH 1X9QA 2C7UB 4QTIH 5IWLC 3JTSB 4ODUB 3OXSB 1CLZL 1OAXL 3MBEB 4HKBB 2V2TB 2IFFH 4GMTL 4X5WB 1J11A 5L7XL 1KCLA 1K4DB 2DJ4A 1FPTH 4KTYA 1CYGA 1NBQA 4TYUA 5F1NA 5CD3A 2J5LC 4YDVA 1RAMA 1IGJB 4PLKC 5IROA 3OGCB 1KTRL 4NHCH 4BFIA 4L4VD 1FFRA 3FOMB 2CIKB 4YFLF 1EZVX 2DQJL 3PWJB 5LXGL 1ZT1A 4X8JB 32C2A 1I7UB 5JUEL 2WIIB 3QFDB 3G08B 3IXAA 3HC4L 4FFZH 3MREA 5D7JC 3U6RA 5H2BB 3INUL 3BIKA 3P40A 2FIKA 4CVZA 2NX5D 3IDJB 4UT6L 1YEKH 4G3YL 3C60D 3ET9F 4V1DE 3VFTA 1S7WA 4X6CA 4IRSC 4LGSB 1OL0A 4NQVB 2AJZA 5EO9A 1NCNA 1JWSA 4F3FB 3SDAB 3LDBC 2DF3A 3LQMA 2BVOB 1UT9A 4S2SB 3R8QA 4EUPA 4X4MA 4UINL 1P6FA 4I2XA 1E4WL 1Z2KA 2E6QA 1VDGA 2Q1EA 1A4JB 1CFNA 2FZ3A 5B21A 2DQUL 2Z31D 3FO1B 3AFLA 5CLTA 2W60B 2OLDA 1PX3A 4JANB 1A02N 1C16A 2ADJA 4OZIA 2NY1C 3AAZA 3O8XB 4G6FB 5H8DA 5C8JB 5KBNC 2CO6B 3N1PC 5C86A 2EC8A 3LS4H 3LSOB 3G5XB 2PKDA 1UZ8A 1CFVL 4L8SA 1OTUC 4JB9H 4X8XA 5KVMC 3RNKA 2BY3A 1NPUA 1F11B 2PO6C 1YEIL 2AK4E 4Q97A 1YMME 2C4XA 2H26A 2G9HB 4MXVF 4ORGA 1MCOL 2I9TA 3VXMB 4J2XA 3FMGH 4Y1AD 1OY3B 2VWEE 5A16A 4HH9B 4PR5B 4R26L 1HQRA 3MLZH 4PJ5D 3NIDE 3HNVH 3ULUL 3LKRB 4UQ3A 1CVSC 2PF6A 1DANU 3O2DH 3U4EA 3QWRA 2A6JB 1BQLH 1F4YL 4OLVL 1JF5A 1OM3L 3W9EA 1R3JB 1HYRC 3L95A 2YR3A 3BP4A 1MCIA 1RUAH 1XR8B 3MRCB 3KWWA 1OF2B 1JPST 3B5HA 3MJ8A 5K9JH 2EIEA 3AC0A 2XZQL 4MDJA 3F62A 1TDQA 5IMKA 1HHHB 4MNQB 1VFBB 4OI8A 2BSED 5B38B 4FFYL 3I02B 2OBGA 1NAKL 2D7MA 3FQWA 4NN7B 1SVZA 1X5ZA 3ZKMD 1XR9A 3HA0A 4GRWF 5GRXG 4FQPA 1NAML 5KSAA 4L1DA 3BI9X 1DN0B 4QWWD 4Z8FH 1VKXA 4F8QA 4PLNC 5L9DH 4M5YL 1IGFH 1M7XA 5MENE 4D9RD 1AO7D 3QAZC 4GG6B 3F65A 4LGRB 3MUGB 5F9OH 1E4XH 5JQ6H 2VLLB 5IVXA 2WAHA 5B8CC 2J88L 5IV2A 4ENED 2DQIL 4O2CB 5ERWA 1WBZA 4L4VB 5IK3B 4JDTH 1JZ2A 4POZD 2JIXA 5I75B 3PWPB 4AH2B 1I85C 4RMTA 4WFFD 3DV6A 3VFGL 1ZSDB 1S7RA 5EOCL 2HJLA 4JLRB 3RHWF 4HJ0D 4TNWK 2EECA 2NX5B 2IG2H 4RAUB 4XHQA 4YE4L 1CL7I 5GPRA 2X70A 3RGHA 1J86A 1NMAH 2X4QB 1MRFH 3UJJL 3L3JA 5D70L 1XZ0B 3E6FA 5DEFA 1KB5H 4OGZA 2AABH 3AB0B 1UKQA 5I6XB 1OHQA 4OIIH 5DEZA 5F7FA 3VJ6B 2PW1B 2F8OA 1JTTA 1I8MB 2V5TA 2Z31B 3B5TA 3MRPA 2C9AA 4ISVA 4X6FB 5D7SL 4HXAH 2B4CL 2CPCA 5E99H 2ZUQC 4LPWA 3SCMC 5MEPA 4FQCL 1S9WA 1NH6A 2CK0H 3K2UL 4OM0H 3W11C 3HMXL 1CGWA 1I7TB 3FQRA 2CR3A 3PHQB 2K3TA 5GSRB 5KSUB 4KKNA 3EYQC 5GZOD 3KYAA 3R0MA 4HLZH 3DMMC 15C8H 3GSQB 3B3IA 1T89A 3S4SG 4U0RB 2R0KL 2FX9H 4ZOCA 4PRBB 5DTFB 1U2HA 2ZJSH 3SGEH 1IGTB 4MHHG 4L5FL 4MCYA 3DGGA 3BEWB 3K7UA 3QUYC 5KJRL 3IFNH 3G5VA 3SDDB 2BSSB 4P2OD 5DJZA 2OCFD 5I30H 4YAQB 1RJYA 2H2PD 5FGCB 1PG7H 1JGEA 5JIPA 5HI3D 3RVTD 5FKAB 3SGKC 3HNSH 1F4WH 3D0VA 1ES0A 3HI6H 3VH8G 3VXRD 5ANMB 4EJ1C 5FYKH 3MJ9A 5C07A 1HWHB 5HHNA 5B3NA 3TIDA 3ISWA 4WTZA 3TIEA 1FZJA 4UTAL 1R3LB 2OSLA 4FQXC 3ZHLA 4UU9B 3O3AB 3RGVC 3OR6B 1QO3A 3BDYH 5F7DA 5DT1L 3H42L 5TJWK 2VZOA 3RTQA 3C2AH 1MUJA 1KPRA 2VLKA 3C8HA 2ICWJ 4GQ9H 4XAKE 2GK2A 1RK1B 2BY2A 2HTKD 4ZPTA 3X14B 5L2KD 3LQZA 4UUJA 3RVWD 5DFVC 1K2DA 2C3VB 2X40A 2LVEA 5ACZA 3BP6A 3QEQA 5DJ6B 2XXMB 4H8WH 2YN3A 1UB5A 3UZVB 5F6HJ 4KMTH 2H41A 3NFNB 5J1AB 4OQTA 3X12A 5E8EA 1KPUB 1HCFX 3QNYA 3VD5A 3VXUD 1LO2H 4X5XB 5KTEL 2P8LB 5IHUL 1FIGL 5J6GB 1CGXA 4PJFA 5BMFH 2R2BA 2ZUYA 4PJDA 4GRLD 4DK6A 4PJAE 4KY1H 3D18A 4Y8AA 1A6WL 5CEXA 4LBEA 5CZVL 1EX0A 4ZFOB 1LP9F 3I9GH 3MOAH 5GHWL 3V7AG 4JFHD 4UT9H 4N5EC 3SKMA 4GAGL 5DD0H 4LCWA 3ZTJH 4WI9A 2R2EA 2A1WL 3MLPA 4AIZA 4NQXA 3MRRB 3FQTA 3L6FB 3U9UA 3LN9A 5DJCB 2G5BB 5FHAL 2IH1B 5IP4A 4CUCA 3S7GA 1JI1A 1MCJA 1V8HA 2YD7A 3O6ML 3U82B 4YXKL 4P2QA 4NNPH 3VGFA 4ZNCD 1GOFA 5HDBF 5AAMA 4HEME 4I9WD 2IAND 2OX5A 1EPFA 1CICD 1A7QH 1FNEA 3QFJB 4YHKH 1LEKB 5E00A 1E4KA 3AY4A 4KJWC 4OFYA 3ORJA 1AXTL 4ZSOB 3WFBH 1I9JH 1QZ1A 1S7TA 2FYYB 2DN7A 4R4FH 3QUZB 4JHAL 1UEMA 3BXNA 5HGBA 3HR5A 1EHLH 1IGYB 4R97B 1J0JA 2E5EA 4MXQA 1XIWB 1FHGA 3FB8B 3KLHD 3IAGC 4V2BA 3DX8B 4MAYA 1RURH 1K5NA 3D87B 4YFEA 4NFCA 1RZJH 4KKCC 4QXWA 3EYVB 2A9ML 5ISZE 4RISL 3R06A 3BX7C 4QHUA 1GOGA 1BLNA 2BVEA 3EYUL 2R0ZL 3CMOH 4XP4L 2R1WA 3FL7A 3MRFA 3VXQB 4NJAH 4KVNH 4ZO6A 4F33A 3HPLA 3JWDL 4QRTB 1I3RA 1R24A 4XGZA 1TZGL 1S3KL 1NCDL 3IT8D 1S5HA 5BRZD 2WBJD 3MGOB 4MS8D 3VMOA 4R9HA 2FATH 4MA1C 3EOBA 3GK8H 5FA3A 5FECA 4N8VG 5HYJD 4YHIB 1HH6A 3ECBA 3G5ZA 2AI0L 1QSED 4TN9A 3DRTA 1RULH 1ZGLM 1AGDA 4LCCA 4IOIB 1ONQB 5AZ2H 4IRJB 1DANT 1FL3A 1U58A 3W0WD 4X7FC 1LGVA 3BUYB 4JG0H 4M6NL 4F7MA 2R69L 1KTDA 4JN1H 3GMLB 3ILPA 2JJTA 4PGBA 3QDGA 2CIIA 2X6MA 5FOJA 1YC7A 1FL6A 4WU5A 3VXUB 3HRZB 3WO4C 5DGQA 2CXGA 4OZFB 1D6EB 4XVTL 1PLGL 5KAQF 2AEPH 2Z91B 4DZBA 3TVMD 3KPRD 3MV11 5GIRB 2R1XB 5IJKA 4ZUVB 5SWZA 4MCZB 4KQ3L 4U33A 3UC0L 4QHLA 5TDOB 4CW1A 4YX2L 3CFKB 1FV1A 2Q20A 2RR3A 4HWNA 4DWHA 1FIEA 2OI9B 5ABDE 1N3NA 4JRYD 5IEHB 1X7QB 1HIML 3MMEB 1C08B 1DDHA 4LAQL 2FJGA 5E70A 5GS0H 3IDNA 2BVQB 4H1LH 3CX5K 1MIML 4JPVL 5JXAH 4FQQB 8CGTA 1NSNH 2GT9B 3ARBA 3RX7A 5KOVC 3JBG7 1FORL 4R96A 2IQAB 2EEAA 1JPSL 4QHMA 5FO8B 3ARED 1IGMH 1JJUA 2IANB 4D2NA 3QCVH 2DB8A 5EU3A 1R5IB 2FH6A 4ODSL 2AEQL 5FK9B 5DJYB 1A7OH 5D7IB 5KSBA 3NABH 1H8OA 2ZP0T 1OB1B 1CLCA 5CIPA 3CDFA 4NO2A 3MLRL 4PRPB 3U7YL 4G43A 4GS7B 3S37L 2GIYA 3AXLA 4KVCH 4GRMA 4LCIH 4YO0A 3O6FB 3WCYA 3SDYL 5K93A 4D0CB 3DTXB 4MHHI 2X4RA 1MRCH 2D7TH 3HE6D 5C0CA 1RIVL 4W6YB 1JF1B 4XC3L 2VO5A 2XTJD 3S9DB 1H3TA 2NY6C 3H3PL 5F72S 4W4OA 3ILQC 1NC4D 4WHTB 4CNIB 3CAFA 3QG6A 4JR9H 4P23A 3SGJC 4OCWH 2BVPA 1FG9C 3TBSA 4Q6IC 2FR4B 2COQA 3DUSB 3WS3B 4UV4H 3OQ3B 3QIBD 3MPCA 4C55A 3G04A 5DS8B 5T3ZH 4HJGB 1K4CB 2P5WE 2J7LA 4JO1H 5CEYA 1WIPA 3MRHB 4DGIL 3F7RA 2ESVA 2HAZA 4JDZA 2FJHB 3P0GB 3KPSA 4HWBH 3DETC 4NQED 5FV2A 5BRZB 4V3EB 4FTVE 1ITCA 3LEXA 3SQOH 1E6JL 4PJXE 3QPQD 1YQVL 4XCCL 5HYJB 3U48A 4NM4H 1ZHLB 3PNWA 3C5ZD 4ZD3H 4ETYA 3DXAA 4NZTL 5I8CB 3RDTD 1W0VA 5F1OB 5H35B 3UZEA 4HJJL 5D7LA 4JPIB 1X3DA 4U1IA 3W0WB 3GDBA 4YNYB 1OOAA 3OL2A 1TIUA 1T7YA 1G7IA 5ID1A 4XNZC 3EIFA 1AXSB 5ID0A 2R23B 2HT2C 2VXUL 5A2LH 2BSRA 4NWUH 1HYSC 2Q7NA 3CVHH 2E7LE 4NKMA 4KZDH 4XZUB 1P4IH 3MR9B 1KIQB 1X5LA 2MQCA 4U6HB 1CTNA 5BXFA 4C56D 1U8KB 4M61A 2WWMD 3X3FH 3KPRB 2D3VA 4PY8I 2FGWH 2G2RB 5JR1L 5FDWB 1H3XA 4HK3J 1IC5H 1QA9A 3QH3A 1T7VA 3OF6A 5FYLD 4ZNEE 2N56A 4DJMA 1XGUB 1MLCA 1G6RL 4JZJC 5TE4H 4JZNA 5GGTH 1NCAL 3I75B 4NWTL 3EAKA 4JY4A 1V3JA 1B0GA 1HHGB 4BKLA 4XPFH 5C0AA 4M1GH 1QNZL 2VLRB 1XF3B 1ZT4A 3QXDA 1ED3B 5IHZB 3ULUF 4QRPD 3TO4A 1FVDA 2O5YH 1WZMA 3W81A 3K0WA 2DQTL 4J8RB 3AREB 4Y8DC 4DOHB 5CWSA 1BEYL 1QSFD 3K4ZA 3G9VA 3GJFB 2HFFA 1A3QA 4U1JB 2F15A 3ZLQC 3S5LG 1UCBH 4OGAC 1DBJH 4OD3H 3K81A 3ZDYE 4U6YB 1IC7L 3V7MA 1G6VK 4CN1A 1PG7X 5I1KL 2X1WL 2BJMH 1KCVL 4PB0L 4QHKI 2F5BL 2AXFA 4DAGL 3DYPA 1GPOH 5I74B 4XXDA 5DDHB 2HKFH 1U3HD 1J1PH 3MCLH 4FQ1L 4HKJA 1I1AA 1ORSA 1HINL 5EA0H 5ALBH 4OCXL 1MFEL 1ZVSA 2DBLH 3DVFA 3QHFL 1E28A 1GC1C 2BRRH 4PJ8C 4G8GB 1RUQH 4Y4KD 3VXME 4PRID 5HJ3B 4JJHA 3RAJL 1GZQA 4LDLB 4YZFE 3RVUC 3MFGB 4I3GA 2N1KA 4OUUB 1ETZB 3QJFB 4Y88A 4LEXL 1T80A 3SGDH 3LH2L 2DMCA 1LO5A 4PJXF 4R3SA 2Y07L 1A1MB 4G9FA 2FL5A 1RPQA 3QIWC 5DGRA 5EBMB 3B8YA 3TBVB 4ZS7H 4NQEB 2APBA 1EERB 3LB6C 2NY0D 4HIJB 1LP9A 2NXYB 2VZTA 1F4XH 3RP1A 3OKDA 3C5ZB 4DW2H 1AD0A 1M71A 4OD2B 3QEGH 3RDTB 5IGXL 1XGTB 3HAEA 4MNQE 2CJUL 5HD8D 4G8IB 4YXHL 4UB0L 2DQEL 5J13C 1NQBA 3B43A 3WDHA 3B9KA 1KEGH 1NUFA 3P2TA 5D1XB 1G1CA 4MD4A 2G75A 4OLXH 2P24A 2VDLL 3EDDA 4TRPL 4NGHH 5DMIL 4H25A 2GJ6D 3GRWH 3O3DB 2VSCA 1IKNA 3VG9B 5BO1L 2N7AA 4L9LC 3ARWA 4OGXL 5CFHA 4Z76B 1UXSB 3L5WB 4RAHA 4GG6E 3FQUB 4NO0D 3T0AA 1NGQH 4BQ8A 2HJKA 2LFGA 3O3BA 1GHFL 3FO9B 1MCDA 3FN9A 1EGJH 1OAZL 5F96H 4KI5C 3QXVA 1Z9OA 3VWJC 3DVNB 4FZEH 2A74B 4S10A 1WBXA 5IB4A 5KVGH 4L4VE 1I9EA 3OAUL 4QF1A 3LPFA 3PWPE 4GMSH 1CLOL 1MCPL 4Y5VC 3CDGB 1TLKA 5E56A 2X4UB 3O41B 5JDSA 4P5KA 5KW9H 2NX5E 1QQDB 1TPXB 5DHYB 1IKFH 1F6AA 4NZUL 2F74A 3N1MC 4QRPB 3TPUB 4JN2B 2A6DB 5CJQH 4F9PA 4Q9QH 4XNMB 1Y18B 5DO2C 4GXUM 4PUBH 4NCC2 2BNQB 2CKBB 2DWDA 3F6LA 3VCLB 5C0GB 1SY6L 1U8LA 1YY8B 5DRNB 4ZYKB 4HH8A 2ZG2A 4TUJA 5FGBA 3UO1H 4G6JH 3TT3H 1P1ZB 3M17B 2VXTH 1T1XB 3KDMB 3MACH 4TSCH 2ZCHH 1KCUH 3D0LB 3VD9A 1NCWL 3MLVH 1S8DA 3GSNA 4Z7UF 1YEEL 4XX1E 3FT4A 5JIIA 2MCG1 3LQAH 1XEDA 3IAPA 3BT2L 4WU7B 3QZWG 2V7HA 5E8NA 4CRPA 2E27H 5MEOB 3CFDB 3W82A 2WUBL 1FRGH 3IGAB 4L8CB 5T1LD 4DCQA 3VFSB 3VXSA 5C0BD 4KAQL 5HHME 5F7UA 1CVRA 1DLHB 1KJVB 4PRIB 5LKNA 4WUKH 4JGMA 5ADOH 4Z77B 3SN6N 4KK6C 2DI8A 1B4RA 2AKRB 4BK4A 4O5LL 5I1CL 1IFHH 1HXMB 2ORBH 4YHYC 5IIEB 5D1ZB 1CU4H 3BQUC 2OTPA 3T65B 1H3VA 3DVGA 3DURB 5HHQB 4P5MA 1F90H 4HUNB 3IXTB 2ADFH 4MAUL 4ZTOH 2IGFH 4GW5B 3CGTA 5ANME 4PLKD 1XGYL 2NY0B 1KNOB 3IFOB 3MBXH 4XAWL 4GFTB 3C6LC 4I48B 3VDAA 4NNYA 3S34H 2ZSVB 3TN0C 7FABH 1X6LA 4OFVA 3WKML 3LEYH 4EUPH 3BGAA 1OAQH 5D7JD 1RZ8B 1TETL 4U6XA 3T77B 3BAEH 3CLEL 3GB7B 3JVGC 9CGTA 4LK4A 5CUSL 4XP6L 5IFAL 4U1GB 2XWBA 2GJ6B 4IRSD 5IUSA 3E3QE 1G7JA 3P9MA 2Q7YA 3Q1SL 1IEBB 4D9RE 2VQ1B 2CQVA 3ARFC 1S9XB 3ULSB 3Q6FB 3VFPA 1MWAL 4JHBA 4NO0B 1HI6B 2FSEB 2XY2A 1ZGLA 2PN5A 1YYLL 2BDNL 4A2LA 4EIGB 1NLDH 1JNJA 3QJHA 4EIZC 3NCYS 3HS0A 1KIRA 2FWOA 2NY3B 2VDQL 1EUUA 2NY1D 4KTEH 4HS8L 3ULVH 3KS0J 4YQXL 1MHCB 2XIDA 3LD8B 4JFQB 4HIHA 3TH2T 1GJIA 2EC9U 2P45B 1DVFB 1IQDA 3OG6B 1YEJH 1AI1H 2PO6D 1MSPA 3CIQA 3D85A 3H9SA 4EDXA 4PS4L 1FNFA 2HRPH 3F12A 4XVJH 2AXGB 1T1ZB 1H3UA 3MJ7A 2QQLL 4ZUSB 2XWTB 3C8KB 1J8HA 1H5BC 3CU7A 3C9NA 4NO3A 2ENYA 1FJ1B 4JPKL 1FVCB 2NLJB 1N5YH 3U0PA 2K7PA 4N68A 5TE6H 4LSQH 5FYLL 5SX4H 3MV9A 2FH8A 1EZVY 3SE8H 3RWGA 2HKHH 2DI7A 3X3GL 3MV7B 1RJLA 3W39A 4JO4H 5DFWH 1A9BB 1E27B 4MDIA 4U7SA 4DQOL 2G60H 4HLZG 4WEBH 1R0AL 4JKPL 1UACH 3CPLA 1DCLA 4H8WC 3WIIL 4W81A 1MJ7L 2LU7A 5T1LB 4QY8B 2BNRD 3QFJE 2P8MB 5C0BB 1MHHA 2BVTA 5C0JA 1MFAL 4FFWC 2KZWA 3DX9B 5I0ZA 4D94A 4ZSOE 5DK0B 4TSAL 4ZAKB 4CVUA 1JPGB 5T3XH 5T1DL 1RK0B 4JFZL 5I18H 5J9PB 3EFFA 1CFTA 3BKCL 3HLAA 2Q8BH 4GW1A 5FCUL 2ZUWA 3MLWH 3KLSA 5D1QC 3UPAA 4MA3A 1G9MH 1ZANL 3RWDB 1Q0YL 4S0UC 4Y16A 3RL1A 2VNCA 1P7KA 1WTGT 4ZG1A 5LGJA 2HJFB 4OCSH 2J5LB 3PDOA 1G0XA 1YECL 5C09A 5DJ8B 2UZXB 4C83B 2YUZA 1NGWA 5IKCA 4J3WA 2HG5A 5T1KB 3N85H 4HPYH 2FX8H 4FMKA 4YHMH 1A5FH 3U46B 3KAAA 5IMOA 1JGVH 3DIFA 3CCHA 4M4RA 1NCBH 3MLUL 2KZ1B 4P5TA 3PWLB 2FX7L 3I6GB 2MHAA 1AHWB 2E8YA 4CADB 4X7CC 5D6DC 1LD9A 2ED8A 4JO2H 4PLOB 3FN3A 3QEHA 5LAXA 5GXBB 1JK8B 1C5CH 4P4RA 1JNLL 2BVYA 1DQTA 5C6TL 1S7SB 1EJOL 4JAMA 5FGRA 3E6HB 4G80B 2R15A 4PV9B 5F88B 1LNUB 1D9KB 1WF5A 2QTEA 2ZKHL 4PB9H 2YWYA 3D6GA 1YN6A 3KYOB 1YZZA 1YNLH 4UNTA 5FYJH 3SCMD 5E9DA 3NPSC 2HFEA 1MIEL 3EOTH 1C5DA 5I16A 4OZGF 3RHWK 3VXUE 3W11D 3STBA 1G7QB 3QUXA 4PGEB 1CXLA 1RZJC 4PJ7A 1NAMA 3NH7H 1G7HB 2VR9A 3QEUA 4S1QH 3WEXB 4OD1H 3HCVB 4X6BA 3EYQD 4WDIB 3DMMD 1ZEAH 4P3CH 1Q8MA 2VWEC 4X7TB 4BZ1H 3ZTJG 1TCRA 1ROWA 2ZCKL 3MJ9H 3BKJL 2GTZA 1TJIL 2FLRT 3MV8A 5E8DH 2MWCA 3QUYD 3WSQH 3DVIA 4UV7H 4PJXA 1WIOA 4S0TD 1D5MA 2KH2B 4Y5YA 3EYSH 4QRRB 4AT6B 1A3LH 2D2OA 2VR4A 1AGFB 3NCMA 4KGLA 3H9HB 3PL6A 4R4BA 3FFDB 4J1UB 3RWIB 3OBAA 3MCKA 3DROA 4AEIH 3P4MA 4KROC 2XPGA 3G6JB 3V6OA 2IANE 3KPNB 4FQXD 2E7LA 2GFBB 5DHXB 3O9WC 4OZHF 3L5HA 3ZZ1A 2GITB 3UBXG 4NT6A 4E5XB 1I9RL 1EUTA 5D7IE 3RGVD 1MPAL 5KS9A 3WFHB 4UTBL 3GI9L 1I7ZB 3OPZH 5ETUA 4YGAB 1NDMA 4PGCA 3SKJL 4PPTA 2HVKA 3MTRA 5I1AB 5KVFH 4OQTH 4PRPE 2VC2L 4JFPA 1I8IA 3KPMA 4JFFB 3KYMB 4BH7B 3QNZB 3PUCA 5DK2B 5I76A 1A7BA 1BD2E 3MNVA 1DQJA 5DFVD 2WIIA 5B8CB 2F54D 4HQQH 5LJYH 3CFBA 3QULB 3HMXA 5EZIL 5C0NC 5AUMB 3S4SB 1A6TB 4ONGH 3F5WA 1LK2A 3QO1A 1TNNA 4WWKC 1KELL 1AE6H 4YXLL 1KENL 4N0CC 2M26A 1OAUL 4XCFH 4R7DA 5K9OA 1WBYB 4YJZL 1KCRH 3TZVA 1IM9A 1P69B 4HBQA 2NY5C 2VXQH 2I9LA 5LBSL 4LU5L 4MZ2A 2IJ0C 2V5YA 3LKQB 1T20A 4YHLL 4NO5B 2J8UF 1EHXA 5BRZE 1XCTB 3D39B 5IM7B 5F7EL 2NTFA 1XF5B 3CFJA 2JE8A 4GW4A 3VH8B 1P4LB 1BP3B 5HYJE 2A6KA 1N8ZA 2W60A 4QHNB 4XRCA 2QSVA 4PJ9C 2FECL 4N5ED 1QVOB 5LQBH 2AQ2A 1M05A 4LMQE 3BYYA 3Q5TA 3EYOB 4X6DF 5H94A 4LRNL 3UYRL 2X09A 1U8JA 5C0RH 1BJ8A 3GSOA 4Y4FB 3WE6A 3W0WE 1UJ3A 4GKZA 3ARSA 5IW3A 5MERB 1V05A 2ARWA 2ZUQB 3SCMB 1JTOA 5E08L 4UAOC 4Z7UA 3WHE1 3S3JA 1O5DT 5FOBB 2J6EL 1NBYB 1UWXK 4PLJC 1IRAY 5C08D 1CBVL 2A83B 5IJVA 4M48H 2NY4C 3BGFC 3DMMB 4NQDA 4R4ND 1L0XA 5HYIA 2W9EH 4HMDA 1QHPA 5JORA 4HIXL 2BHZA 4KJWD 3EO1B 5EZLA 3U36B 1I4FB 3N9GL 4DN4L 4L8DA 4ZUTA 4H1LG 1UJTA 4EN3A 3QUYB 4I18C 3V8CA 5CCKL 3UDWA 1OSZB 4PJGA 3EJJX 2A77L 4R90H 1QFPA 1BVLA 2Z8VC 1LE9A 1HHHA 4PRDA 2E7CA 4ZUWB 1VGKB 1A4KB 2NY2C 5B38A 1K6QH 4E0RB 4LLDA 3DGCR 2VLRE 4KKCD 3O6KH 1NDGA 3PABB 4IJ3C 1QPPA 1I1YA 5DRWB 5FDYA 2XWJB 1DEEA 5IHBA 4DOHE 3WIFB 4PRHD 4YDLC 1T2QL 4OLUL 4DEPC 4MA8H 5GJTH 3F58H 1O0VA 1SQ2N 3FQXB 1DBMH 1KXVC 4NKDB 1P6AB 2R56L 4XTRC 3MLSL 2UWEB 5HPMB 1M6OB 5CEZH 3EDFA 5IR1A 3FT3A 4TVPE 3REVA 1Q94A 2EC9T 3BSZL 4JVWA 4QXUH 2IBGA 1AGCB 1G1YA 2QSTA 1II4E 1UWEH 3CFCL 1BF2A 4OKVB 4MD0B 1XF1A 1IM3B 4L4VA 1OGAB 5FEBA 5HYSA 2Z93B 3UTZA 5EZOH 3P77B 4RRPG 1FDLH 4JPWH 1ODAA 2FDBP 4DVRL 2DAVA 3QQ3B 3L5XH 3RZCB 4LL9A 2JLLA 4LDEB 1EVTC 4WW2F 5A3IC 4KHTH 4TPRH 5IEKA 4G8GE 4E9LA 2IPUK 2X1PA 4RAUA 3C60A 2HFGL 3GMPB 4ZQKA 3GGWB 4JY6A 4OUOA 5C2BL 1FFOB 5IG7B 3ZKXC 4ODWB 3GHBL 3EFDH 1VSCA 2QSCH 5ICZB 4N0UB 2JB5L 2I5YH 1CG9A 2XNAA 1FSKC 3O4LD 4KHXH 2ICEB 2BOBA 2BZDA 1D5IL 4K71C 4NQEE 1XGPB 5J12C 4GBXC 1K9TA 1L4IA 3CZJA 5MEQA 4PJEF 4IM8A 5IFHL 3VFRA 4POYA 4RMVA 5GGVH 1TTGA 4U1KB 5C0EB 1VACB 1EFXA 4NQSB 4QCIB 3D2UD 4GRWH 4NZDA 4WV1C 5DWUL 5IBUG 3DBXB 3VGGA 1YEHH 5JDJA 5CIPH 1MFDH 1C12B 3LKNA 5IESL 5JOFB 3V52H 4XT1C 4DTGH 5KOMC 1AD9A 2Q6WA 4Y1AA 4NPYB 4MXWH 2GSGB 4JHWH 3EDKA 1NUDA 5FF6B 2VLJD 5IB2A 4PJ5A 1F3JB 4S11A 4OB5L 1KTLA 1RVFL