3VFPA

Crystal structure of hla b*3508 lpep158g, hla mutant gly158
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRGYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Energetic Basis Underpinning T-cell Receptor Recognition of a Super-bulged Peptide Bound to a Major Histocompatibility Complex Class I Molecule.
pubmed doi rcsb
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Homo sapiens
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vfpA01
3H0TB 4MJ5A 3WO4C 4ZFGL 2EDWA 3GUTA 2V9TA 1H3PL 1KB9J 3FQNB 4MQXC 5E8DL 1YQVL 5EUOA 4JFPA 4PJ5D 1WC7B 4YHMH 2VO5A 4GOSA 5F3HB 1JCKA 2Z4QB 3FFCB 4NZUL 1KNOB 2OJZL 3T2OA 2CLVB 5IQ7H 5C1MB 2ICWJ 3CLEH 4P23A 1JPTH 1L6XA 5GRWA 1A21A 3JWOL 1R3LA 3W0WB 1CL7L 4HWEL 5ICZA 3W39B 4HIXL 3A6BL 3BKYH 3RIFK 3S9DB 3MRQA 4LAJH 3MLVH 4YDJB 3MLTB 1KB5H 1GVIA 2BZDA 3HRZA 3OKNB 1JZ6A 4ODUB 3RWJB 1LP9A 1MRFH 2FD6L 4M6MH 4CAGA 4XMKL 2HLFD 2D7TH 2OBGA 5FA3A 2O93L 4NT6B 3OB8A 1CBVH 3RNKA 3SGKA 5EC1A 1QSFB 3VJ6A 1FIEA 3VFWA 5D96B 5H8DA 2FO4B 1HZHL 1FJ1A 4GS7C 3CFJB 4RMVA 3SE8H 3SEPA 3QDJD 4LPWA 5CMAA 1XF3A 5CIPB 5EUKA 3EW3B 2GAZA 3H3PH 1KGCD 4OLVH 1MIML 3SDDA 3OKKB 1MHEB 4WV1A 4P23B 1LO4L 1CGXA 4JRXB 1JHLL 3C09B 5KSAA 1QG3A 1HH6B 3ARPA 1R3LB 4XVTL 3OAYK 4NWUH 3C5JA 3WHE1 1JZ8A 3QBTB 3M8OH 4DW2L 2AABL 3R1GH 4ETYA 5CINL 1G84A 3MRQB 1FZMA 4NQCB 3C6SB 1XGQB 1Z9SA 3HRZB 3ARQA 4NRXA 1GOGA 3SCMA 4LF3B 1U58A 4RFOL 1UZ8A 2YPLE 4NQDD 1LP9B 5ERWA 2WP3O 5EUOF 5HDOA 4X9BA 3C6LC 5DC9B 3RNKB 3TLRA 3UYOD 4XNUL 5CJQL 5EC1B 4LLUA 3VJ6B 4LIQH 4XPBH 1FJ1B 4OZHB 3JTSA 5E94A 4EUPH 5C8JB 1O5DT 1WV7T 5BJTA 5HGBA 4CJ0A 1QR1A 5EIIB 5IEHA 1INDH 1EHAA 2GAZB 5B4MC 3IDNB 4WV1B 3ZKQD 3P9WB 1QRNB 4PP8C 4MNHA 3FB7A 4M00A 5HXMA 2YPLD 1JPSL 12E8H 2CO7B 3RNQA 3QUYA 3B2UC 4KGLA 1O7SA 1JTPA 3ARYA 5FYJU 4OGXL 4NRXB 2QADD 4YC2C 1U58B 3E2HC 5D1QA 4DKFL 2YC1A 1LK2A 4OV5A 2R8SL 4E41E 1IAIM 1G7HA 5KW9L 3IDXH 2XTJC 3WXVH 3K2UH 5FCUL 5IGXH 5ILTH 3W9DB 1B6UA 3FQUA 1KEML 1P6AB 2CRZA 1MFNA 1JHTB 3O0RL 5CZKA 3JTSB 5E94B 4WWKD 2ERJB 1F3RB 5HGBB 1QR1B 1G7QA 1V3MA 3SDAD 4MNQD 2AK4B 3H9SB 4DGIL 1FVCA 4MJ6A 3PF2A 2WQ8A 3B8SA 5ISZA 4MNHB 4KROD 1S9KC 4XHJD 5I1LA 5SX5H 3QUYB 5IK3B 1J0HA 3QUKA 4Y8AA 2APFA 4PIRF 3CVIH 1KB9K 3G5XA 5F70A 1JUFB 4H1LG 5GRUH 3QAZC 3QDME 4Y0GA 2YC1B 5DQJA 4ZFFB 1G7HB 4Y2OA 4K2UL 3MO1A 2VLRA 1CK0L 5J1AB 4PTTA 5KVGH 3TF7A 3S3SA 3RKPA 5A16A 5I73C 3J7HA 2R0KL 2DQCL 3JVGC 4P5KA 4WO4B 4HLZH 1KJ2H 1WJ3A 3P4OA 3LPWA 3L7FA 4KRPC 2DQDL 3R8QA 1BAFL 1I3RA 1WBZB 4TN9A 3TV3L 3MLUH 4APQA 5FM4A 3TJHC 3QR2A 2EDQA 5HHOA 2HVJA 4MJ6B 1EHLH 2Y7QA 3MV01 5IMLA 2XN9E 5C0CD 2MQ3A 4F9PA 1MWAB 4F58L 4U6XB 1INQA 2NW3B 4UINL 5L6YL 1PVHA 3QJHB 4EI5B 1T1WB 4AEIH 3FO1A 3GSUB 3G5XB 4KK6C 4X83A 4F7EA 3RHWK 3MLWH 3F12B 4GG6E 2ADFH 5C0IB 4EDWL 3PIQB 2A6IA 3S36L 5DQJB 3TWCH 3RGHA 2BVOA 1EK3A 3F6LA 4P4RA 3VFTA 2CD0A 4K8RL 3AUVA 5D2NE 5FYJH 2XN9D 5D7LE 2XI9A 4HFWB 3L7FB 1GHFL 4KKNA 1WZLA 2IGFH 3CMOH 3ULVC 2VDKL 3KPPA 5JO5B 2UVFA 5HHOB 2UWEE 3L95B 3T8XA 3L3KA 2Y7QB 4O2EB 1A6WL 2HP4A 2DL2A 2NY4D 3NFNB 3ME0A 4H0IA 3VMPA 3HPJA 1G7MA 4FFYH 2VXUH 3S37X 1P7KA 3JV4A 4RWHA 4M7KL 3QRFM 4R26L 3VMOA 2BRRH 1CE1H 4F7EB 1I8MA 5E5UB 3C5ZB 1OTSC 4S1QH 1IAII 3ZKMC 5D7LD 1G7IA 1EFXA 3WUWA 2A77H 4OZIE 1BOYA 4XB7A 2M1KA 1DQTA 1NUFA 4QOKE 4LMQI 1CLZH 3HG1A 4FTVA 4P4RB 4PRPE 5KSUA 5JHDA 3QQ9C 1UKTA 3OAUL 4O2FA 2OL3L 1Z9LA 4X5XB 1LO3L 1P84J 4TSBH 2HWZL 3KPPB 5CP3A 5DD3H 4IOIA 4XNYL 3SN6N 3MRFB 3VG9B 2IG2H 3BGAA 2VN4A 1NCBL 4NZRL 4Z9KB 4YWGH 4P49A 2D0HA 5EH1A 1KLUA 1G7MB 1HIMH 3HZMA 3Q48A 4YHLL 3VFNA 1UJTA 5ALCL 4WU7A 4EDXA 3ZL4L 4PLJD 2JB6A 3HMWL 1QLFA 1G7IB 2BP3A 1NEUA 1QLRA 3FRUB 3RVXD 3RX8A 4BUHA 1LGVA 4C58B 4FTVB 3UROR 4FQIH 3MV8D 5KSUB 5JHDB 4ZAKD 3IKKA 3TBSB 1UVQA 4PJHA 3IDMA 3MUHL 1N3NA 5DVKA 4NO5A 2GJZB 1EMTL 3F65A 3KAAA 3KXFA 3NACH 5ICYB 3CX5J 4IOIB 4WUUE 1JRHL 4JPVH 1EAPB 3IETA 3MOBH 2A6JA 1HEZA 4U33A 1L9MA 1KLUB 3HZMB 4UU9B 1GGCH 1F90L 1I9IH 4JVWA 2C3VA 2FB4L 3U9PL 2ZOKA 5CWSA 1CS6A 2CXKA 3TEUA 2JB6B 1XGYH 4S1RL 5C0AE 5BCAA 1PZUB 1BBDH 1GRWA 2X4OA 3GMLB 1C5BH 5IFJA 1Q0XH 3UPAA 3I50L 3V6BR 1CR9H 1GGIL 3KPLB 1EUTA 4YO0A 5LAXA 2CPCA 2DQTL 2IPUG 4GXVH 4HF5H 1RHHB 1EXUB 1NGPH 2LTQB 3KPOA 2FH8A 3S36X 4ELKA 4NO5B 1G9NC 4KMTH 2XZZA 3QHFH 3PHSA 4V2BA 5C0AD 4WW1A 1I1AD 3G08A 4FZEL 1FP5A 2Y5EA 3RDTB 1M7DB 1U41A 3UBXG 4XC3H 2QV2A 3WFBH 5EC2B 1HQ4B 2ZOKB 2B4CL 3T3PF 1WAAA 4R96B 3MYZA 4ONFH 3HNTH 3P4NA 3P0VL 2AJXL 3ULUL 4K94H 1P6FA 3VI4E 4PJHF 3O2WL 4IMLA 1LO0L 4KDTC 1PAMA 4Q9RL 5LCVH 3QFJB 4YZFF 4XH2B 4NBYB 5EU3A 4IRZL 3B9EA 1MQKL 1X44A 2Z0BA 5B8CB 1FBIL 3FO2A 3W9EA 4AJ0A 4MAYC 2EDKA 1I1FA 1PEWA 2ZPKH 4PJ7F 3V0AC 2R1WB 3C8DA 4MLSA 4FQJL 2CR6A 1MFCH 2HRPH 4WW1B 3G08B 2EDBA 3DROA 1WUNT 4MZ2A 3UDWA 2DQEH 3O8XD 4R7NA 5JUEH 2NY5L 3HHRB 3JZ7A 3TM6A 3O6KH 3H2WA 5IVXB 1HWHB 2J7LA 1U8KA 1V3KA 4P46B 5L8JB 2K1MA 3QIBD 2W60A 3P4NB 4IS6A 5LVEA 3LKNA 1C5CH 5LGHL 5HHMA 5BS0A 5FK9A 1MCDA 2B5IC 3HE7C 4YPGB 2MCPH 2ZUYA 5HYJB 3GBML 5EU3B 1CGYA 4OIIH 3S97C 1BLNA 4RMUA 3EJZC 1Q94B 1KELL 4UQ3A 3T2QA 3X13B 3LRSB 3P0GB 3QXUA 3I6GA 3DROB 3L9RA 4FHBD 4U1HA 5DJ6B 4NFDA 1JFQL 1CD1A 5EDXA 1NLDH 5TJWK 1TQBB 1NSNL 1H3WM 4QHUB 1GGBH 5F1NB 2B20A 4DGYH 2W60B 1LE9A 1I8KA 2HKFL 2YRPA 4NNYA 3CX5K 1H8OA 3AREA 3QDGA 4JJ5A 1JZ5A 2BSRA 1KCVL 2FL5A 2X4PB 3L3OB 4JN2B 5DFWH 5DURB 1IT9H 3BH9B 3DMMB 3QEGH 1BLNB 1NBVH 4HBCL 2YA2A 4KZEH 2E7BA 4UQ3B 3EJJX 3P4MB 4JM4L 3I6GB 4PDCE 4M1DL 2ICES 1SVCP 1WFTA 4U1HB 1A7NL 4BELD 1CD1B 5CAYB 1OCWL 3W0WE 5SWSA 2IPTH 3JV5A 3Q0HA 1HN1A 5GGVL 1RZFH 2YUWA 2A74B 1CU4H 4OCLC 1LE9B 4X6DA 3OV6A 1OAUL 3IDJA 5T5NF 4NNYB 1D3CA 1MJ8L 3ZKND 4JJ5B 1X7QB 3DHJA 2W9EL 2QQNL 3FFCD 4X6FA 2E27H 4OLEA 1JHKL 3GMMA 5BMFH 1MHHA 1QSFE 2HFGH 1LQVA 2XRAH 3VRJB 2FR4A 2JE8A 2QR0A 2HTLC 2VUOA 3N1PC 3VRLF 3CDFA 3FOMB 2CKBL 4U6VH 5TQ2H 3CFIC 4KC3B 4JFDA 4TQEH 3OSKA 5T33H 1JNNH 2DWDA 4GT7A 4JRXE 4L8SC 4R8WH 1A9EA 5JW3H 4XNQB 4IRJA 1IGYB 5SWSB 4PG9B 5HGHA 5F9JA 5KAQG 4CJ1A 3CH1A 2XICA 1OAZL 1DBMH 5ELIA 3K4ZA 4NQCE 2BRQA 3B5HA 1OSPL 3RX5A 1LP9E 4DOHB 4ORGA 1V7MH 2DLIA 3ARZA 3BAEH 5F88A 3VD5A 4DUWA 2CRMA 2DBJA 1J1PH 3BP7A 4LRIA 1UFUA 3QHZH 4P23D 4KI5C 4JRXD 2QR0B 4G80A 4JKKA 4OZHE 4HS6A 2DIAA 5EO9A 1ZHLA 2XA8L 3IXTA 1XAUA 1QFWM 4NQCD 4JFDB 2G5RA 4XAKE 2DWDB 4X6DF 1A9EB 3WEXA 1UCBH 1HYRC 1QRNE 5HGHB 2FHFA 2AEWA 2RFXB 2ZSWA 3P73A 2G9HA 2NY7L 4XWGL 4MWFB 1YEKH 3S34L 1VADA 4YXHL 4GBXB 4ORGB 1IEHA 3ZTNL 3OL2A 3ORJA 3TZVA 4XAKD 3KPNA 1BZ9A 5KSAD 4G80B 4OLWL 4Y5YB 3BKMH 1KPRB 5EO9B 1E27B 3D39E 3IXTB 4NQSB 1X5HA 2OTUA 3UTOA 4XZUA 2AK4E 4YQXL 3H9SE 2F8VA 3SE4C 4N8CL 3U82B 2JB5H 1OLLA 3G6DH 4DJMA 5AEAA 3FFDA 1MCPH 2BHYA 4WGVB 3LB6D 1R6VA 2X4UA 1YN7B 2BDNL 2ZSWB 2YMXH 3C9NB 2R0LH 3MFFA 5F8QC 3P9LB 3H7LA 4XTRC 2HRLA 3CFCH 2QKIB 2V2XB 3UPCA 1A1MB 1K4CB 2G9HB 5CJBA 5DSCB 3BEVB 3RJDA 4YHZL 4YK4B 2DI9A 1VFOA 2XFXA 2O5XH 1ES0A 3FB6A 5BW7C 2W9DL 1WFOA 1MNUH 2AK4D 3H9SD 1OGTA 4D3CL 4QKXB 1SBSL 1LNUB 1IARB 2OP4H 3D48R 3K8LA 4I0PB 4PJCE 5JXAL 2D0GA 4Q6IC 5ADPH 4N0CA 1NAML 1F4YL 1RZIA 2OTUB 3QUYD 2BERA 4EIGB 4G3YH 2WSKA 3OAZH 1J18A 2A0LC 2OTWA 5FDWA 2F58H 5DYOA 3MRDB 5DD0H 5D1QD 3ZDYF 5AAWA 4QRQB 5GSRB 4OJFL 1VFUA 5K9JH 4QHNB 4XVUD 4EOWH 1N8ZB 3GI9L 1LO2H 5IHZA 3GZKA 2DIBA 4HXBH 3V4PH 4W6WB 2BY1A 4L8CA 1ES0B 3FB6B 1FFOA 2CQVA 4XVJH 4S0SD 2BSSB 3CPLB 4M62L 4P57A 4TUOA 1OGTB 2WW8A 3BGFB 5JPMB 1UM5H 3WSQH 5ISZD 3BPLC 3QIWC 4JPKH 2HVKA 1QFWI 3WJJA 4FG6C 5IB4A 4R4FH 5DJAA 2GK2A 3VGAC 3RJQB 1EVTC 3LMJL 4EI5D 4Z7OE 2V5RA 2ADJA 4P3CL 5FDWB 4R0LB 4OLZH 3EBAA 1WZ1L 2LABA 1RIVL 4BM7A 1NCUA 4NDMA 3IJSA 4ERSL 1ETZA 3HS0A 1FE8L 1KTLB 3FQRB 4I3RL 5E9DB 5IHZB 1GC1H 3NN8A 4ODWA 1T5XA 4W81A 3T0VA 2MPAL 1FFOB 5HHOD 2OL3B 4TUOB 3TVMB 4ODHL 2BCKA 2GTZA 2ID5A 3C08L 4LPVA 1FGVH 2L0DA 5IB4B 4DQOL 1CI5A 3MV7E 2Q6WA 3RY4A 1CZ8L 1PJ9A 5DJAB 4NN5B 3B4NA 4XPTH 3V6FA 4FQXC 3PXHA 2C4XA 2ADJB 5DHYB 4DKEH 4U1LA 5GS2D 3BHBB 3C5ZD 4MB4A 3QUMH 4Z95L 3X3GL 3VWJA 1CXIA 5GRYA 1D9KC 5HVHB 5I71C 2NR6C 3UYPA 2ZNXA 4L4VA 5I9QB 5JNYA 3UTTA 4POZC 5IJVA 4NJAL 4NIKB 5DJYB 5DVOA 3NA9L 1MQ8A 1XF1A 2ZUVA 1J1XL 2B8OT 3CXDL 5DJCB 4KHXL 4KPHH 5ESQB 1KLGB 1CLCA 3NN8B 1PKQA 1AE6L 2EDOA 4PJ9A 4GMSH 3O45B 3GMRA 1AHWC 4HAGA 3D85B 4M03A 2NY3B 1B9ZA 5EZIH 2BCKB 2GTZB 4NO0A 1TMCA 3O3AA 3H8NA 3MRKB 4JQIL 2MNUA 4XGZA 2FGZA 4ZMAT 1YEHL 2F74A 3SBWA 3V6FB 2UY6A 4Y4HA 4PP2B 5A2LH 1CVSC 2VKXA 2OR9L 4JG0L 5CEZL 1NBQA 3VGBA 2HLAB 1NFDB 1EFXD 1DE4A 1A1NA 1JN6B 4I1NB 4L4VB 5JNYB 2ORBL 5IJVB 1MJJA 1A7BA 1P4IH 2FH6A 3EO9L 3HG1D 2X4TB 3L5JA 4KFZC 5DD6A 4FTVD 5IWLC 15C8L 4HH8A 4XP5H 5T1MA 4G8IB 5C0JB 1OWRM 3IRZA 2Y25A 5JHDD 4K71B 1PKQB 4GO6B 2ZUSA 1W0WB 1BJMA 1FSKB 4HWZA 4K07A 4NKIL 4PYGA 3JTTB 4Z0XA 4D0DB 3ZKXC 4PP1C 1ORSA 3SGDI 2HJLA 2P5WB 3IFNH 5JIIA 1RAMA 4R7DA 1TMCB 4NO0B 3RRQA 4MA1C 1NAKL 2VWEC 2WIMA 4TRPL 3PV6B 4Y4HB 1RZKL 2GUOA 5I8OL 1DEDA 1WZKA 4OI9A 3SHSA 2YEZA 1DE4B 1A1NB 3QG6A 3IKCB 1W0VA 3ECBA 1MJJB 3DVGA 5DD6B 2O5ZH 3KYNA 1OSZB 2E9BA 1MCSA 5ETUA 2AK1H 3ZE2F 5E6YA 5EWIL 3GJFA 4WW2F 1I9RH 4JVPA 3F7YA 4HWZB 4I2XE 2Q86B 4DZBA 3KXFD 1I3GL 4OSUL 1RZGB 4Z0XB 1OW0C 1OQXA 4GKNA 3QFJE 1ORSB 3O3BB 3S5LG 3WN5A 1N5YL 5T3XD 4R7DB 3RDTD 5K59E 4YBQC 5L9DH 2EC8A 3GK8L 5E8NB 2APTA 1TNNA 1YJDL 1Q72L 2EIDA 2AI0H 5HGGS 4GW1A 3IRPX 3IB4A 4RGNE 4NSKB 3WXWH 5I15H 3ULUF 4OGAD 4LSSH 5D8JL 3OGCA 2E8ZA 3DLQR 2YEZB 1MLCA 1R5VA 4LPCA 5K9QI 5IVXE 4KHTL 4M6AA 4ZOEA 3KYNB 1WAAE 4LCWB 5ETUB 3AB0B 3BPNB 4JY5L 5F7EH 1A02N 4GKNB 2I60L 4P9HC 3GMPA 5HYJE 1QFWH 3WN5B 4LSRH 1UH3A 1HK6A 3MBEA 2R4SL 2HH0L 3V2AR 4PR5A 1A47A 3DXAA 3VFPA 3WNPA 3DX8B 3FOLB 4BYHA 1C8PA 5AYUH 3VWKA 3SKUD 1F02I 2HT2D 4WI6A 3X14A 2PXYA 3ISWA 5TDNA 3FT2A 4N8VB 1A14H 3MC0A 1UWXK 4NBZB 4LVNC 5KVEL 4QF1B 2W0KA 3VG0H 4U4BA 5D6DA 5HDLA 1CDJA 4V1DB 3C8KA 4Z7VA 4X5WA 4XPGH 4LNRA 3D18B 3L5WB 5F3BB 3OJDA 1U8IB 3LAFA 5E03A 3BN9C 5GGTH 4HEME 4FQLL 3QPXL 3GMPB 5FV1L 2BNQB 1ZMYA 2ZKHL 4J12A 3NIDE 1EIBA 3P30L 5E8OA 1MCOH 4FQCL 2CKBA 5IW1A 5J13C 3K74B 4Y2DC 1H3XA 1FFQA 4KTDL 1N4XL 5JR1L 4I18A 2H45A 1YY8B 4NNPH 1BIHA 4O58L 5EOCL 3UXFA 2DTML 2PXYB 5TDNB 4Z78A 3TT3L 5HHMD 4WCYL 3TT1L 4NPYA 5DEGA 4DCQB 4HD9A 2R29H 4M3JA 4YNYB 3L7EA 5DURD 1MHPH 4Z7VB 5DD5H 2BVQA 2IAMC 3QPQC 2EIEA 3ARDC 1Q1JL 4HG4J 2EC9T 5FO7B 4XXDA 3MBXH 1DLFL 3K8KA 3OKEB 5GS0C 2CKNA 1MVFA 5B3NA 4UT9H 2P1YA 3SDYL 5E8OB 1DN0B 4X80H 2CKBB 5HD8C 3DV6A 3NIGE 2EECA 2NTFB 4FN0A 4Y5VB 1S3KL 1D5IL 3PDGA 1I9JL 4OZFG 1U92B 1DLHA 1KJMA 2BX5A 2FIKB 4JKMA 4O02H 3PE9A 2IFFL 4FQQB 2FX9L 3BJLA 3EAKA 3QDGD 1CTNA 4NPYB 5SWSE 1YYLH 4PV9B 2XKUA 3TN0C 1NDMA 1UB5B 3QWRA 1V5JA 3B43A 3L7EB 1FZKA 2AXHA 2EXYC 2EEDA 2DQIH 4WO4C 2D4DA 4KH2A 1RURH 5FB8B 3O6ML 1CFVH 3NFSL 3HI5L 5TPWL 1UM4L 2CLZA 4LVHB 4HS8H 3DV6B 3AFLA 1I1YA 4NP4H 5HHNB 3VDBA 5SWSD 3QFDB 4DFIA 1A7RH 1DFBL 3G5ZB 5GZOD 2DM4A 3HPLA 4JFDE 4XP1L 3G04A 5FKPA 5ADOL 3WD5H 1U8JA 4JG1L 1RUML 4X98A 2EDTA 3KJ6H 2OM5A 1AFVH 1FZKB 3DBXA 3MRJA 1W8OA 2F54A 4HXAL 4S2SA 1C1EH 4QRSB 2XIDA 3FQWB 4GSDL 4LSTH 1NAMA 3QZWA 1WCQA 2BY0A 5C71A 2C9AA 2CLZB 3WS6A 4QHMA 4JFDD 2IBGA 1K4DA 4PJDA 4TSCH 3LKOA 4R2GB 1A1OA 4IRJD 5CGYC 5F9WC 1X5LA 2FEEL 2YD7A 4O9HH 4DAGH 2XPGA 3ZHDA 2YZ1A 1BFOA 4JZNA 3BWAA 1WBYB 3HPLB 4L3CA 3MTRA 3G04B 4KQ3H 3A6OA 4KVNH 1LQSR 3DUUA 3U0WH 3EDFA 3MRIB 5DRNA 3MRNA 4HUKB 1PG7X 1FN4B 2V9RA 3MRJB 4L4JA 2D7PA 4ODTL 2X10A 2I27N 4S2SB 4GRMB 3GGWA 5I19H 3CFKA 3KNBA 3CD4A 2WIIA 3MCLL 1CLYH 4YUEL 1GIGH 2I9TA 1K6QL 5D7IB 5DO2C 4PJDB 3D69A 1ZE3C 1A1OB 3SQBA 3SJVA 4AIXA 4JZNB 5GGRB 4HG4K 1U2CA 4JDZB 2VE6B 2H2PD 2BNUA 2C1PA 2NNAA 3DUUB 4J4PA 3SO5A 1DQLL 4GAJL 5LBSL 2CGRL 3LH2L 3TZVD 3LKRA 1F4AA 3CFBA 2EYRA 3RZCB 2W92A 5GS2H 2MJWA 3V6ZA 1SJVA 5B3JE 4YDIL 4XPHH 3VXUE 1NBZB 4UT7L 2H9GB 5J6HA 8CGTA 1ZHNB 3D69B 3DX6A 3FJTA 3WYRA 3BXNB 3AXLA 4EXPX 5I1CL 1SM3H 3SJVB 4C83A 1IBGH 2XG4A 3MRBA 4NOBA 5GS1C 5DJZB 4HIIA 3D0VA 1QFOA 1VFAB 5DUPH 5IB2A 2DQHH 1WCBB 3HNVH 4K8RD 5C0FA 3QXTA 2G60H 4XP9L 3O4LE 3QIUA 3GHBL 4NM8L 3LKRB 2AJUL 3EHBD 1CL7I 4OFYA 5E9DE 5TQ0H 3WLWC 2BFVL 2MCG1 3FHAA 3GIVB 2V2TB 4O2CB 2VZ3A 1MFAH 4H1LA 2EYRB 4N0CD 3V5KB 2LTQC 4R3SB 4HV8B 2NY6B 4HIJB 2OXGA 4Z6AT 5GRVK 4JM2C 4DKDC 1BVLB 3VW3L 3TH4T 3GSNL 3E8UH 4TSAL 2XZAH 1RZJL 3DX6B 2VSDA 4F57H 4LHJB 3H7BA 3AXLB 2RR3A 4XNMA 2EH8L 2LVCA 2JF1A 4C83B 1CQKA 3GNMH 3V6OA 4HIIB 3D0VB 5E9DD 5EU7C 4LNVA 5CP3H 3NTCL 5I1HH 1YEEH 1FLTX 3BKJH 2AV7A 2VIRA 4G6KL 1EBAA 2X6MA 3QIUB 4LCUA 1QBML 4S0UC 3DGGA 1ULVA 5C7XH 4MA7H 1DVFC 1MUJA 4H1LB 3MRLA 4N68A 2LAGB 4WFHD 5EU6B 3HFMH 2E9IA 4MA8H 1M4KA 4RGNC 3HC3H 4N0UA 4CKVX 1BGXH 1XGUA 3IT8D 3EDJA 5D6CB 2ZNWA 3H7BB 4PBVC 4XNMB 3RA7H 2GTWA 5CD5C 5D9SA 1Z3GL 1WT5C 4QYOA 4QRPB 5J4MA 4P46C 4AENB 3FB8B 3C60C 4LSUL 1MI5B 1A64A 4Z5RA 4LEXH 1NFDE 1RHFA 1AO7A 4X8XA 4RQQA 2QHRL 5T3XH 2VIRB 3C5SA 1YDPB 4LCUB 4NM4L 2NY3D 1QLEL 1DZBA 4QHKI 4F15B 2F19H 4NKOA 1MAML 4PBWD 3BO8A 5DVLA 1MUJB 5JXEA 3MRLB 2JELH 3B9VA 1AGEB 1HINH 4Y16C 5HGDA 2JJUA 4G8FA 1MAJA 1XGPA 3U1SL 3K0WA 4N0UB 4F3FA 2P5WE 1XGUB 3VXMA 3X3FL 2P7TA 2HJFA 3LD8B 3VWJD 2O61A 3O11A 4L4VD 1V3JA 2AJVH 2GJ6B 3RVWC 4G6JL 3UTTD 3L3HB 1TQBC 3RL1A 1NCCL 1A6AA 1OVZA 3PWNA 3KHQA 2P43B 4TVSa 4X8JA 1X5FA 1IGFH 2Y9RT 4P5TA 1CXEA 4NN6C 3E0GA 2W07A 4PUBH 1PG7W 1B90A 5L2KB 5D2LE 4WUKH 5GGQL 4YXKH 3O2DH 2DL9A 5ACLA 4J6RH 3AY4A 5E08L 3SE9H 4NKOB 2LU3A 2GHWB 2P5WD 4HQQH 4NO0D 5ANMA 5DZOA 1S5IH 3DMMC 2DLHA 1X5AA 3X11A 5HGDB 5T1LB 3RWFB 1XGPB 4K55A 4Y4HD 4HKXA 4UDUA 5BVJA 1U8PB 3V0WL 2J5LC 1J8KA 1T21A 1KXQE 2UUDH 4RRPG 3IFPA 2HJFB 3O11B 3INUH 3ILPA 1GZPA 3RL1B 1OT1A 4F9LC 3MRRB 3ULUD 1OTTD 3K7UA 4JFQB 5E2WL 3BW9B 3WIIL 4JLRB 1FVDA 5IM7B 3MRHA 5C6WH 5HI5D 5FEBA 4JPWH 1IQWH 3GIZL 2IQ9L 2JJTC 2SEBA 5EPMA 4JFEB 4LCWE 5EORH 4HWBH 3LCYA 5ANMB 4QRUB 4OUOA 4O00A 1FL5A 1KJ3H 3OKLA 3RBGA 2ADGB 3X11B 5E6IA 1KCSH 5E7FA 3N1GC 5BVJB 1X3DA 2CDFA 1T21B 1TZHB 4ZFGH 3QUXA 4KU1A 2JIXA 1H3PH 4FFVD 4HUXB 5E8DH 1YQVH 4L3AA 5I8EA 1GZPB 2AJSL 3QULA 3T2NL 5HI4C 1FYTA 1G9MC 1U8QB 3LKSB 4NZUH 3IJYB 5C08A 2OJZH 2BVYA 4OB5L 3OB0H 3P2TA 4MD4B 2JJWA 1FVDB 3JWOH 1CL7H 4HWEH 4HIXH 1C7TA 3A6BH 4UB0L 5EPMB 1CXFA 5AD0A 1L6ZA 4RNRA 2P8LB 4V1DE 4FXGB 3TC9A 1FL5B 5E2TL 3OKLB 5KOVC 2FD6H 4XMKH 1G7PA 4UIMA 4Y7MA 2FJFA 2BNQE 2CDFB 1NBYA 1ZSDA 2GIYA 4UV7L 5KS9A 2X7LB 4RAHA 5FYKE 1HZHH 4MD5A 2OQJB 4KDWA 1FYTB 3MOAL 4ZG1A 4GH7B 1MIMH 1ZT4A 4G7YL 3SKOA 1LO4H 3OKDB 5D7JB 1JHLH 1KYOJ 4PJIA 4XVTH 3BMVA 3UBXB 3MNVB 4KK5D 1AGDA 4MD0B 4DVBB 2VDOL 4GBXC 4DW2H 1T89A 1DBBL 1AH1A 1SYSB 3B9KC 2AABH 3MR9A 4N5EC 5FGCB 5CINH 5B38A 1YNKL 5AD0B 4RNRB 1DBJL 3T0EA 2Z31B 4Z7VE 2FJGA 1BWWA 3O41A 4RFOH 3MBED 4E0RB 1IJ9A 4RA0C 4WFFE 5E56A 4CVXA 1RZ7L 4K3JL 3BQUA 3GJEA 4UUJA 5IHUL 2EYSB 3DXAD 1J8HB 4Q9QL 1G7PB 3PL6C 5D1ZB 3BD4A 5HVWA 2GFBA 5FUOL 5T5FL 3IU3A 1I8LC 4XNUH 5CJQH 1ZSDB 2PXYD 4P3DA 1E4KC 3SPVA 1QTYT 3S35L 3ZT6A 4BK4A 5FYLL 1ZT4B 4P4KC 3SKOB 1J10A 4PJGF 5KG9A 5DMJB 1J0KA 4LOUD 3BRGC 4MNGB 1JRHI 3QO1A 1JPSH 1AGDB 3ZHKA 5J3HD 1AXSA 1LEGA 2GITA 3MR9B 1G0DA 1KN4L 3MRGA 1MY7A 1BFTA 3VD9A 1T20B 2FJGB 2J2ZA 4OGXH 3UC0L 2FRGP 4XNZB 4DKFH 5KS9F 2WBJC 1WFUA 4I0PC 1ACZA 2V2WB 4PY8J 3GJEB 2UZIL 2R8SH 1ONQA 5KW9H 4W4OA 2VLKE 3F5WA 3BZ4B 5FCUH 3IU3B 1R5WB 5FA4A 1KEMH 4JDTL 1IEBB 5T1KB 3EJYD 3O0RH 2IQAA 4G9FA 4AT6A 1BD2E 4B41A 1G7JA 4D9RD 4PJIF 2N7BA 3PWVA 3L3IA 4WHYG 3HZVA 1UH4A 1QVOA 1D6VL 1T80A 1JMXA 1YYML 2CIKA 5IB5A 3ULVL 4LRNL 5IB1A 4DGIH 1YC8A 5BQ7A 3PNWB 3WMSA 4NNXA 1VPOL 5I76B 5D93B 1M7IA 5I1EL 1HILA 1JPST 1IMHC 1AXSB 4HW6A 1LEGB 3G6AB 4A6YL 2GITB 2LQRA 4BQBA 3MRGB 4NO3B 1A7PL 4J8RB 5JPNA 3BJ91 4PY8I 5I1KL 1TETL 1FV1A 3BGFC 3IDYC 4P5MB 4FA8A 2FSEA 4ZTPL 2EO9A 3SDCA 3CK0L 5L8LB 4K2UH 4WU5A 1CK0H 5JDSB 1H8NA 3K8MA 5C07A 2R0KH 2DQCH 3WIFB 4FOMA 3ARBA 1KV3A 4S11A 2IQAB 3PDOB 4Z76B 2DQDH 3NZHL 5HJ3A 1G7JB 1BAFH 5IQ9A 3TV3H 3HZVB 5DJDA 5TDPA 3ARFA 1QVOB 2D4FA 8FABA 4LLDB 3QWRD 4RFEB 4X6BA 5IB1B 2K7PA 2YXMA 4NNXB 4U49A 2Q87A 5T3ZL 3LHPL 4W6XB 4I8DA 1E28A 4F58H 2A9NL 1CIDA 4UINH 5L6YH 2X4SA 3DSFL 3VRIA 1SY6L 5DI8B 3X12A 4NKDB 4YFLI 5I18L 1FV1B 3TVMC 5IESL 3CJJA 4EDWH 3WV0A 2X4NB 3S36H 3OR6A 4R2GD 3D3VA 3UTSE 2YR3A 1UQSB 2D0FA 3AS2A 4NC1C 1UCTA 1KYOK 4NN5C 4K8RH 5K33A 3ARBB 5D7IE 4XPFL 1F45A 2PO6B 5IFAL 2DM2A 1NPUA 1GHFH 5IBLC 3TA3A 4EBQL 2J1KA 5HJ3B 1UA6L 5EN2B 2NW2B 2VDKH 3MRPA 1MCJA 5TDPB 3ARFB 3ZSSA 1NL0L 5I9QC 1CXKA 5LKNA 3ZKSD 2NY4C 1A6WH 3ULSA 1MSPA 3ERYA 4X4MA 2F54D 4CNIA 2VABA 3PWUA 1I1CA 1AC0A 4M7KH 4R26H 4Y88A 3VRIB 3T77B 5DJXA 1FZOA 4A2MA 4J3XA 3EYSL 1KPUA 3N1MC 3HMXA 3GSNA 4YHOL 4G6AD 4AZ8A 3QRGL 4GQPH 1EEYA 1BQHB 2CK2A 2DQFA 2O5YL 3ARUA 2WLYA 3BP4A 4NOFA 2X70A 3TA3B 3OAUH 2OL3H 1LO3H 3IFLL 2XKNA 5BV7L 2HWZH 1WWWX 4XNYH 1P4LB 1RUAL 1CICA 1G9NL 4HJ0D 3MMEB 2CDEA 4OKDA 3ULSB 5JOEA 1NCBH 3REWA 4NZRH 4CNIB 2DYPB 4K71C 1QYGL 1VSCA 3PWUB 1S9XA 4Y1AA 4KKLD 5E8PA 3WUZA 3NBNA 4URTB 3MGOB 4YHLH 5EBLB 4ELMB 4BA8A 5ALCH 3ZL4H 3HMWH 3V0VA 5K9KB 5DJXB 2YA0A 4O4YL 5C6TL 1SJHA 3RGVC 2H6PA 4FQPA 4HSQA 2VB5A 2E6PA 3UZVB 1DQML 1EEYB 3SJVD 2DKSA 4ZAKC 2DQFB 2IH1B 3BP4B 3LDBC 3K1KC 4EQ3A 2X70B 2JJVA 1G6VK 2IMNA 5DDHA 1JNJA 4J4PD 4LCCA 1EMTH 3OKOB 1FHGA 1OP5H 1XIWA 1JRHH 1P2CA 5A3IC 3QSKB 4OF3A 1IKFL 2ZWLT 1A7OL 1UJ3A 4LKCA 3REWB 4AEFA 4PLKD 3DURB 2J8UB 4Y1AB 1F90H 4Y8DC 4WEMB 5E8PB 2FB4H 2NY6D 3U9PH 2BMKB 3E6HA 4G8GA 1PZ5B 4S1RH 4NQXB 4P2OA 5IR1B 2XQBL 3WLBA 1IVLA 4HKJA 3I50H 4H0GA 4JCLA 1A9BA 1GGIH 5TH2A 5I1AB 5EU6E 2DQTH 4HUWB 1ND0A 1LK3L 1A4KA 1CT8B 3N85L 3HCVB 4ZUWB 2AKRB 3R06A 4EZMA 2E7LE 5F44A 3CUPA 3SGJC 4AIOA 1DUZA 2A1WL 5EA0L 1P2CB 4YX2L 3QIUD 4FZEH 3LQAC 1UJ3B 4QRPE 2ATKB 4OFYD 4LKCB 1MI5E 1Q0YL 4DN3L 5TDOB 1U3HB 5DFVD 5F6HJ 5EU6D 3AB0C 4LVOB 2B4CH 2V5YA 1CF8L 1AGFB 5TE7L 3TFKC 3P0VH 2AJXH 4HKJB 3ULUH 1JNLL 4KY1L 4K9EC 4G42B 4NZTL 5CEZD 3O2WH 1LO0H 4WDIB 3VD3A 4Q9RH 1ND0B 2X5PA 3FMGL 1T04B 1A4KB 1TITA 5C0BE 3WO4B 4IRZH 4QRPD 4N0UE 4RIRB 2LV4A 2ICEA 3VCLB 1MQKH 1FBIH 5D7KD 3UMTA 1UZ6F 2KUTA 4UBDD 2ZOLB 2VLLB 3TNNA 5MEQA 1UXSA 5CZXD 5A43C 2GJ6E 1DUZB 4FQJH 5GISL 1S8DB 1QBLL 5F6HI 1TNMA 4WI3A 3G6JA 4KMLB 4BQCA 5I8CA 2NY5H 4YEEA 2NXYC 1TTUA 3RVUD 5L2KE 2X40A 5L2JA 2HAZA 1KT2B 4DWHA 3D25B 3V9FA 4NKQB 1PW3A 1ZLVH 5LGHH 4XX1G 3NCMA 1DP0A 4RMQA 1ZA6A 2HT4D 3GJFH 3GBMH 4M4RA 2DMKA 43CAB 4RZCB 1ZTXL 3FAXA 2W65A 2ICEB 3MLXL 4TTDD 5E0QA 2CDGA 3BDYL 4OD1L 5CSGA 4ALAL 4DKAA 4GS7B 3TNNB 4DK3A 1KELH 5LGJA 4YDLC 2MFNA 3CIQA 1CE6B 1Y0LB 4MXWL 1OP3H 2GSGB 2XACC 1JFQH 5I8CB 5JXED 5H2BB 1JIBA 4YH6A 3CZFA 4TVPL 1NSNH 7CGTA 3DV4B 1P69B 1KJ2A 1NUGA 2X05A 4OF7A 2EXWC 4JFEE 1N0LA 1XCQB 1LDPL 5TE4L 2BXZA 3BH8A 3FONA 4N9GA 2HKFH 3ZTJG 5ANME 1JGVL 3G5VB 1DQJB 1VGKB 3STZB 3PGFL 3C6LB 1KCVH 1ZA6B 2OS7A 4OZ4A 1K8DA 4POYA 1AGCA 1EERB 4GW5B 2PTTA 2DIJA 2Q76A 2W65B 3ARTA 2CDGB 3HA0A 1KTRL 4P5TD 3AC0A 4IOFC 3G6JF 6FABL 3H3KA 4HBCH 1U2HA 3GMQA 2CH8A 1MOEA 5LGJB 2YOCA 3OHXA 5C0NC 4HFUL 4GAGL 4JM4H 1FYHB 5E24E 4ZUVB 2B1AL 4PJ7E 3MJ8A 1A7NH 2DTSA 1OQOA 2XWBA 1KENL 2YRLA 3R0NA 4XP6L 3P3YA 1OCWH 4JHWL 2Y6SC 1AKJB 3ILQC 5INCA 4LEOA 5GGVH 5D1XC 1IL1A 3L6FA 1EJOH 1Z6JT 3RZWA 1GZQA 4UTAL 4YC2B 1OAUH 3E2HB 1KCRL 2YSSB 1MJ8H 5E70A 4R4ND 1X4ZA 2W9EH 2QQNH 3TBWA 3D2UA 1AGCB 1OT2A 1JHKH 2Q76B 3JVGA 3MLSL 32C2A 4XAWL 3LQZA 3NA4A 2BNRB 5B39A 1BP3B 1Y18B 3OHXB 3OPZL 2CKBH 4ENEC 4Q7DA 4K3EL 3RPIB 1LO5A 3ES6A 3QCUL 4M1CC 3RTQB 4NQEA 1IEAA 2KPNA 1J05A 2ICWA 2R2EB 3CNKA 5E6ID 1IL1B 1OAZH 5FGCE 1I4FA 5IMKB 4RFNC 5FV2A 4JEGB 3VA2C 4X7EC 4F7MA 4C59B 3QUXD 1F4XL 2ZG2A 2OI9B 1OSPH 3BOVA 2F5BL 3BP6B 2EDRA 4NRZA 1J8HE 1J1OL 1FYTD 3D2UB 4GAYA 3NH7L 5I73B 5C08D 4U3HA 2VLJA 3LQZB 1IGJA 4YR6A 3S5LB 1B0RA 4KRPB 4MQ7A 4L5FL 1E6OL 3AAZA 2HG5A 2XA8H 4CN4A 1YECL 1CFTA 2DAVA 1LO5B 3MLYL 4WEUD 3KVQA 3ES6B 4NFBA 1IEAB 3SDXA 2P8MA 2Z8SA 3QEQB 1FC2D 4MNGE 4EXKA 1NCNA 1YMHB 3QUZA 2XTLA 2QBWA 1F42A 1I4FB 2X1WL 3CSBA 1F13A 4RGOL 4HPOL 3WS3A 4F7MB 3TBYA 3PWPA 2NY7H 4XWGH 3S34H 1DUYA 5IMMA 4YXHH 5IKCA 3ZTNH 3SDDC 4GAYB 1V05A 2VLJB 3GMNA 4PJAF 5I66B 4LGRB 1CFSA 3T08A 1IGJB 4YR6B 5KSAC 3W5NA 4OLWH 1A3QA 1JV5A 4D0CA 2ZUQB 5F9AC 1CFTB 3QYCA 3Q2CA 4TUJA 4YQXH 4IDJL 1K85A 1WGOA 4A6YB 3SCMC 4N8CH 4EN3C 3SDXB 2P8MB 4ZFOB 1R3KB 3RZCC 2BDNH 5IOPA 2D7QA 3WS3B 4KRNA 1B4RA 4ZO6A 4X4YB 4YHZH 1ITBB 4OF6A 5IKCB 2W9DH 3GMNB 4O5LL 1ZEAL 4Z7WF 3BKCL 1FL3A 1CFSB 4MDJA 4LHQB 4D3CH 4OAWA 2XZQL 1SBSH 4CN1A 2P8PA 4PV8B 5JXAH 1S5HA 4NGHL 2Q7YB 5TGBA 1NAMH 1F4YH 1N59A 5KSVA 4JRYA 3EOAA 1IFHL 4N8PA 4RDQF 1F6LL 1IC5L 4TUJB 2F53E 2NYYC 4MX7B 4OZFA 2XOTA 3GSWB 4C56A 3JV0A 3WFEL 4OJFH 3TO4A 2Z93B 4DVRL 3IFOA 5IOPB 3JWDC 4CU7A 4BSWB 3O6FA 4YHYC 2DI7A 3VFUA 4M8QB 3GI9H 2VR5A 4TPRL 4PBXA 3AU1A 1Z5LA 3BX7C 4BJLA 2WWMD 3T1WA 5GS3A 2VZ1A 4OF8A 3I02B 1XR8A 1JPFB 5KVDL 4JZOB 4YHNA 3OJMB 4M62H 1IILE 1I3UA 3B6SA 3QNXB 2MQ0A 4BQ6A 2HT3D 5C09A 3ZE0F 4HGWB 5KSVB 1N59B 3V5HB 4JRYB 1RIHL 1F4HA 2LFGA 2FDBP 4OFDA 2R4RL 5IJKC 3LMJH 1T1YA 4OZFB 4P3CH 4QCIA 4C56B 4HK0A 1MPAL 1QSZA 4H0HB 1AGBB 1WZ1H 1RIVH 2IADA 1K8IA 3SDCD 2DB8A 3IFOB 1IGCL 4ERSH 3KYOB 3N9GL 3FCTA 1FE8H 5C07D 3CFEB 4I3RH 5EOCJ 3OR7B 4QXGL 3ARBD 2YBRA 2PO6D 2YK1L 3HB3D 5FM8A 1WBXB 1A0QL 1RY7B 2FEDC 2ZUTA 5C86A 4APQC 2MPAH 4KDTA 1DSFL 3ARFD 1XR8B 4WJ5A 4YHNB 3RIAF 4L4TE 1MIEL 4XBGA 1RQ5A 1S7UA 3PP3H 4ODHH 5EU4B 4DEPC 3D87B 5C09B 1J7VR 3C08H 3TH3T 5EBMA 4DQOH 1CZ8H 4CU8A 2Z8VC 1T1YB 5F96L 2W0FA 1BVKA 1IAKB 4P0DA 3KG5A 3FN3A 4HK0B 4X9GA 1I8IB 4F15C 4Z95H 3X3GH 2IADB 1HQRB 3TPKA 5MP6L 1K8IB 3D3VD 1ZV5A 4OCXL 4NJAH 3UZEA 4ELME 3FCTB 3R8BB 3NA9H 1SEQL 1YMMB 1J1XH 3CXDH 4KHXH 1I3VA 3TA3D 3GI8L 1NDGA 1AE6H 3HE7A 1U6AL 1VESA 3UBXI 4WJ5B 3VXRB 4H1LH 5HTSA 3BPCB 4LCIL 4XBGB 3QNYA 3R4DA 3OXRA 3VFRA 2GK0B 5I0DA 1D5MB 3O2VL 4JQIH 4MAYB 1ED3A 2DYPD 2XQYK 5EBMB 4K7PL 4PJ8C 2HA1A 4WENB 4I9WE 1JWSA 2OR9H 4JG0H 4XNXL 5CEZH 3H9HA 3K46A 1DQDL 4D94A 2VL4A 4RAUB 3KLHC 3V8CA 2R0ZL 2Q3ZA 2J8UE 3QQ4A 2ORBH 1VEOA 3EO9H 4AL8L 4FQHA 15C8H 2AJYL 5DRZA 3WNMA 1JNHA 4BH8B 1AQKL 1NDGB 2B5IB 3HE7B 4DTGL 4NKIH 1INEL 4KWUA 2YD6A 5IG7A 1F2XK 3PJSA 4I9WD 1JGEA 4BH7A 5C70A 4ZS6D 4F2MA 1A4JB 4P9HL 1ED3B 1AIFA 1H8SA 4LLMA 4Y1AD 1NAKH 4WWKA 4JAMA 3LKQA 4TRPH 4BFEA 2EDXA 1RZKH 3WE6B 1FO0L 4GW4B 5I8OH 3H9HB 2D31A 5F9OL 4LGSB 4LPUA 5BZWA 1EO7A 3MYJB 4Y4FB 2WK2A 3QQ4B 4OLYL 4YHIA 4E41A 4QXTB 4FQHB 4AM0B 5DR5L 4RA3A 5IT2L 3CFDA 3MGTA 5DRZB 5EWIH 5F89B 2GYSA 5JORA 1EV2E 4CW1A 2OZ4L 1I3GH 4OSUH 1J0IA 1A6ZB 1XIWD 4Z7UB 1GAFL 4BH7B 4BUGA 2QSTA 4B5EA 1N5YH 1FNEB 3JV6A 1U3HD 4F37K 3GK8H 1YJDH 1Q72H 2A6DA 5MERA 4G8GD 1OAKL 2HKHL 1CWVA 2VLMD 1RK1A 1KN2L 5D8JH 2FEEI 4L8SA 3QDMA 4WHDA 4HZLB 3EYQC 1SMOA 3VGGA 4YHIB 4JKWA 4KHTH 2GI7A 1LDSA 3PWJA 1R3JA 5F7KC 5EB9A 1JF1A 1F6AB 2YPKA 4JY5H 4PJEF 3IU4L 4MQXD 3VXOB 1RFDL 2ZP0T 5JORB 2UUDK 1QP1A 1YNLL 2VQ1B 4OFIA 2I60H 2DMBA 4OZGF 4JY6A 5HSFA 4JDVB 3IYLW 5GS0L 2ADIA 1D6EB 4YIQA 3JV6B 3WFCL 2Y36L 2R4SH 3P9MB 2HH0H 5D7JC 1BJ8A 1BF8A 2A6DB 1S9VB 3KDMA 2NLJB 4UDTB 3QEUA 1I7RB 5I6XB 5J57B 1P5UA 3DI2B 4L8SB 1A8JH 2Z31C 1U8MA 3EYFB 2VRAA 4GXUM 3UJJL 5E95B 5KVEH 1QEWA 4G7VL 4MHHG 2FO1A 3PWJB 4PGDA 4AH2A 5D1ZC 4NUGL 2VL5B 1J9CT 4OUUA 4ODBD 5D7LA 3GSQA 1FNFA 4GFTB 3RWHA 5CJOL 5I2IA 1S7XA 4FQLH 5GSVA 5MEPA 1CLOL 3QPXH 4M6OL 1N26A 4KXZI 5CLTA 3VU2A 2ZKHH 4PGEB 2ADIB 1R5IA 3P30H 3LEXA 1M6OA 3BUYA 4FQCH 3U0PB 3Q6FA 4XWOD 3LSOB 4CADA 5KANI 3V4VL 4KTDH 3CSPA 1N4XH 1FFNB 2KZ1B 1AQDA 4KKBC 5JR1H 5CBEB 3Q6GL 3BZEA 4QRRB 1N7ML 4O58H 5EOCH 3QEUB 2DTMH 3ZMRA 1MWAL 1E4XL 3EDDA 3PHOB 3K80A 3TT3H 3QT2A 1QD0A 4G8EA 3LEVL 4MCZA 4WCYH 3TT1H 1H9VA 2NTSP 5BVPL 1C12B 4QOKA 3C6LD 4AH2B 1I7ZA 4PRPA 1U0QA 1KIQB 2PR4L 4IRSC 3QCTL 1Q1JH 3KWWB 3MRMB 4OD3L 4PB0L 4L29A 5I2IB 5EZLA 1DLFH 2X4RA 2JCCF 5GSVB 5MEPB 5BW7A 1YEGL 3CDGA 1FORL 4ZXBB 4PRAA 3SDYH 4YDKL 4LHUG 1M6OB 1UB6A 4Q6IA 5DQ9A 4H5SA 4XRCB 2BNRE 4GG6F 1EFQA 3GSVA 4KRMB 4RRPA 1S3KH 1AKJD 1AQDB 1D5IH 1HYSC 1I9JH 3B2UD 3UYRL 1VGEL 2WUBL 3WO3B 3WIHL 4LCYA 2IFFH 2FX9H 5KSBB 3AREC 1MVUA 4IIQB 3OJ2C 3MJ7A 1N0XL 3GKWL 3NCBB 1VKXA 4QOKB 5DT1L 2XTJD 1RUPL 2VC2L 1FNSL 1IGTA 1I7ZB 4JPIA 2UWEF 4NCC1 5D5MB 4HPYL 3U46B 4AQOA 3CSYB 3O6MH 4WI8A 3ROLB 3NFSH 4HUVA 3HI5H 4WUUA 1G6RB 4PRAB 5TPWH 1UM4H 5IBUG 4MA3A 4H5SB 3MUGA 1EA9C 3GSVB 3AROA 4FABL 4OZIF 2JJSC 3IS0X 4WEBL 5KZCB 4OM0L 1P1ZB 1DFBH 1WICA 4XP1H 1ZT1A 2ATPA 2H26B 4G43A 4PRNA 5ADOH 3MJ7B 3QEQE 4JG1H 1RUMH 3UTQB 2KQMA 1IGTB 3D2UD 1MFEL 2IWGA 2H3NA 3IDGA 1ZLUK 1BM3L 1BBJB 4YAQA 4HXAH 4P99A 4KRPD 3ALPA 5FYLD 5A2KH 3MV9E 1ZGLA 4XMPL 2VDNL 4L9LB 4HUVB 3TJHD 5JA8B 4GSDH 4WUUB 4ZNEE 4JB9L 3B2VL 3BMWA 2VLJE 4NO2A 4MA3B 4NQVA 1MRDL 2VITB 3BPLB 3QIWB 4NQED 1DBAL 2ARJB 4F8QA 3QEQD 2BSTA 3ULVE 1Q9WB 3VGAB 4KK6D 4C54A 2YN3A 4LPTA 3S96A 1ZT1B 4I5BB 1AD0A 4G43B 1JWMA 2OJEB 3SDXE 1K2DB 2H8PA 1JYXA 3O8XA 5CJ8A 5ENWA 3WNKA 3VE0A 4XI5C 2OR7A 5F6IC 3U83A 2WWKT 3V5DA 1E0OB 1VENA 1PDKA 2VLJD 5C92A 3RWIA 5H37H 4ODTH 5ESVB 4QTIL 3ULVD 4Z18A 1AHWA 2Y06L 2APXA 3GRWL 3ET9F 3MCLH 4YUEH 3RWGA 1K6QH 4PJBB 5EOTB 5HPOA 2BSTB 4OBSA 4GG8A 4PRHB 4YHKL 2EH7L 4KTEL 3RI5K 3QUZD 4FQXB 2H2PC 5CCKL 5T3ZE 1OTSD 3ZKMD 3S96B 5L7XL 3TYGL 1MHCA 1JZ4A 1D9KB 1JWMB 5CD3A 5I71B 1BEYL 1DQLH 1I85C 2C5DC 4J2XA 4BSJA 4GAJH 5LBSH 2CGRH 3LH2H 5IWLA 3V5DB 3W11C 3WL9A 1RUKL 3RWIB 3CCHA 3QNZB 1KPVA 4P2RB 1K5NA 3N1FC 3QQ9D 5GRVL 1UXWA 4DUXA 1AHWB 1IAOA 1LEKA 2GCYA 4YDIH 5T3ZD 4M5YL 3ZDZE 4I3SL 1X5JA 1X6NA 4UT7H 1MAKA 4GG8B 2R2HB 5I1CH 3VI4F 1HHJB 4JRYE 5HPMA 1WF5A 3PQYA 2BVUA 3G9VA 4PGBB 1MHCB 5CD3B 1ZHKA 3VFVA 1WVZA 1NCDL 4AMKL 2A2QT 2QEJA 1XCTA 3KPSA 4XP9H 3PGCB 4NM8H 3GHBH 4WGWB 4N0FA 2AJUH 1QUNA 2BFVH 1PSKL 3EUUA 4Q58C 5DVMA 3H0TA 3HAEG 1S7TB 1YNTA 2I24N 4NN7C 4GJTB 1UXWB 3FQNA 2VDQL 2AXGB 4JRYD 3ZKXB 5J56B 1OW0A 4Q97A 1IAOB 1LEKB 1XGRA 1KNOA 3VW3H 1OTUC 3BGMB 2CLVA 3GSNH 4TSAH 4C56D 1RZJH 3QI9C 4PFEA 2FGWL 4MA1B 1MRCL 5FKAB 5A2IH 2E6QA 3W0WA 2EH8H 3W39A 3NZ8B 4LVOC 3BRFA 4E5XB 1JE6A 3PQYB 4CVUA 1PBYA 4MDIB 1TCRB 3TO2B 3NTCH 3MLTA 1ZHKB 3NGBC 3LS4L 2DICA 3OKNA 3HI6L 2E9JA 4G6KH 3KPSB 1G0YR 4U1MB 1CTOA 1U91B 3A6CL 1QBMH 2VXQL 4NT6A 5KVFL 1YMME 1UWEL 4X99B 1YNTB 5C09D 1QSFA 4U2YA 4TNWF 4MQTB 2FO4A 1YQ2A 3CFJA 2HFEB 3U2SB 1XGRB 2DD8L 5CIPA 3VXRE 5FO8B 1XEDA 3OKKA 1MHEA 4ZOBA 3FT3B 4JRXA 4JO4L 1HH6A 3I6KA 1NFIB 4EEEA 4KK9C 1Z3GH 3O3EA 3S3PA 4PJFA 4ZQKB 3BWUC 4ZPVA 4NQCA 3C6SA 3HNSL 4LSUH 1XGQA 4LLQB 3OWEA 4LF3A 2D9QB 2QHRH 4OTXL 4NM4H 1N5AB 1QLEH 4V3EB 1MAMH 1OF2A 4N9OB 3HE6C 1OD9A 2DJSA 1T2JA 4ZPTA 4MAYD 4JO1L 2NX5E 4OZHA 5JIHA 2ICWI 5C8JA 1KLFA 1T0MB 5EIIA 2X1XR 1VERA 1F8TL 3U1SH 1WQVT 3IDNA 1UADC 3X3FH 1L0XA 1S78C 1FO0B 3I6KB 1QRNA 1UG9A 4G6JH 3AS1A 1NCCH 2C1OA 3O3EB 4PJFB 4ZPVB 4OGYL 1G9ML 5DK3A 4NHCL 4ORZC 4PJ9C 4U1GC 2D03L 3HE7D 4LVNB 5HYSG 3CZJA 1PLGL 5GGQH 3EFFB 2VH5L 3U4AA 2OX5A 5E08H 4XHQA 4U0RB 4JHBA 4WW2C 5GIRA 4HAFA 1OF2B 3ARDA 3W9DA 2FWOB 4X6CB 4ZPTB 2OSLB 5ID0A 3T09A 1JHTA 1U3JA 5E8EB 3S3JA 3D39A 4XPAL 1MREL 4Z7UE 1AR1C 3V0WH 1I1RA 2AK4A 3H9SA 1KIRB 2VZOA 5J13B 1IAIL 4Y2DB 2KQNA 1B3JA 2R56L 1LP9F 4HIEB 2C1OB 4ONGL 4YDVA 5IK3A 4HUNB 5E2WH 4GRWB 4PJXB 1JUFA 1AY1L 1CIUA 3U4EB 3WIIH 2X09A 3GIZH 2IQ9H 4OZHF 2VDLL 4ZFFA 3DNKA 3DYMA 4U1IB 5J1AA 5GIRB 1T7XA 3VGHA 2IAMB 3GJFK 3ARDB 1TZIA 4WO4A 2DQUL 4PJCA 5ID0B 1M71B 3D39B 1KJVA 1WBZA 2NY5C 3M45A 2ITDA 2C3XA 4MAUL 2RJMA 3QXVA 4OCYH 1TJIL 5DZNA 3WJLC 4GXUN 4HDIB 1UEMA 4LLYA 5LXGL 1QSEB 3RTQC 1T0NA 2AJSH 1MWAA 4YLQT 3T2NH 4E41D 5INDB 1OAXL 4U6XA 4YDVB 4E42B 2NW3A 3OAYH 4HMCA 1QA9B 3QJHA 1T1WA 2Z35B 4TVPE 4EI5A 4OB5H 3GSUA 2CRYA 5HY9B 4Y4KC 3F12A 4MJ2A 5C0IA 3PIQA 5DGRA 3FTGB 3JTCA 1ORQB 3QA3A 2OI9C 3KPRB 4PLOB 3TN0B 1A7QL 3NVQA 4UB0H 1HXMB 1DQQA 1CD0A 1B4JL 4GQ9L 4OKVB 3KR3L 2VAAB 1TZIB 4X7SL 1OGAB 3MPCA 4PJCB 5HDBE 1A5FL 2HTLD 5E2TH 4HFWA 3GSOB 3FN0L 5HYQB 1CFQB 1KJVB 5K9OA 2ITDB 5JO5A 5AAMA 1BZQK 3L95A 4TVPD 1MEXL 1V7NL 4KI5E 4O2EA 3QDMD 4LLYB 4UV7H 4WHTB 3NFNA 4MGXA 2DQJL 1T0NB 4N0YL 1I7TB 2DLTA 3LZFL 3MOAH 3OKMB 1PY9A 4QRRE 2DLFL 4JR9L 5AWNL 4G7YH 1WISA 3C5ZA 4N90E 1HHHB 3QA3B 3EKCA 2VDOH 4P2QB 1DBBH 1DQQB 1OLZA 4EUPB 1YNKH 4M48L 4ZUSB 2Z91B 1DBJH 4X7TB 3REVB 4JFOB 3WKNA 5JOFB 5DMGC 4KI5D 3UJIL 3VFSA 4MQSB 1RZ7H 3U7YL 4K3JH 3E3QE 5IHUH 4Q9QH 4X5XA 3KPMA 3MV7A 3N1QC 1J86A 2ZUQC 5K9OB 4U31A 3VWKC 2L7UA 5FUOH 2MTPA 5T5FH 4QRRD 3WDJA 3MRFA 1F4WL 3QG7L 2IANA 1NGQL 4N90D 2KBGA 5F9WB 1IRAY 3S35H 1HNGA 5D6DC 3RWCA 5FYLH 1N6VA 3A0OA 2Z8RA 1JK8B 1B0GA 4LFHG 5HYEA 5E5RB 3WFHB 1T2QL 4X5LA 5KSBE 4LU5L 5GXBB 4HJJL 4HUMB 3FRUA 1Z9MA 2XG5A 1KN4H 2BOCA 2P44B 5CHNB 3L5HA 5F21B 2MMXA 4OLXL 4Z7OF 2XQYG 3UC0H 5D5ME 3TBSA 3VFSB 3TYFB 1IM3B 2UZIH 5F7MC 4I18C 3KPMB 2GJZA 3MV7B 2P5EE 5ICYA 2HN7A 1Z0MA 1EAPA 2WUCL 4FFWC 2IANB 1ZHBA 4OD2B 4Q9BA 4B7IA 4JDTH 1A6TB 2MWCA 1QQDB 1J0ZA 1GSMA 4IJ3C 3ROOA 4UU9A 4QOKD 1D6VH 3RWCB 5GS1A 4MVBC 1YYMH 1B0GB 2EKSB 3CVHL 3ULVH 4LRNH 4PRPD 4XTRD 5JZ7C 3ARVA 3PHQA 1RULL 1VPOH 3GMLA 4KQ4L 4UNTA 3UAJC 5I1EH 3KPLA 3LEYL 4A6YH 2WP3T 2BOCB 2EDHA 2P45B 1A7PH 1JZ7A 1Q9LB 2BVPB 1OHQA 2R2CA 3BIKA 4GUPB 2NY1C 5I1KH 1TETH 5FCSH 1RHHA 1NC2B 3GRWA 1EXUA 3CC5B 3THML 4ZTPH 3TCXA 1EJ6A 4CDHA 5FOBB 3CK0H 1XR9A 3O3DB 5GJTL 4ZUUA 1EVUA 4M9PA 4JM2A 2HN7B 2FHBA 2A0LD 1W2KT 1ZHBB 5A2JH 1BMGA 2DDQL 4OF0A 5AZEL 3RDTA 5J6GB 1M7DA 5CBAB 2IC2A 3NZHH 5ID1A 3ROOB 5EC2A 1CGVA 5DRWA 1HQ4A 4EI6B 5GS1B 2M26A 1L7TL 4R96A 3PHQB 4HUUB 1EO8L 3NFPA 3H3BC 5T3ZH 3LHPH 1D7FA 5MENE 4I2XA 1RJLB 1OWWA 2A9NH 2JKXA 4KAQL 5C2BL 3DSFH 3MUZ1 3QFJA 4WUUD 3BIKB 1SY6H 4XH2A 3GDBA 5GHWL 5I18H 1GOFA 1DVFA 4HIHB 5IESH 1JWUA 4O51A 5B8CA 5MEOA 2B2XL 1XR9B 4AEEA 3MUY1 5AG9A 4FG6D 2R1WA 4ZUUB 1FG9C 5C9JB 1JGLL 4JM2B 2W38A 4R97C 3EGSB 4RGMC 4XPFH 4PJBE 5IFAH 5ACMA 3O2DA 4EBQH 5FECB 5ID1B 1UA6H 5DRWB 4PRHE 5IVXA 1NL0H 2CLRB 3VXQB 1WT5A 4OV6F 2EIBA 3ZSTA 5F7FA 4P46A 1AD9B 3C60A 1NC4A 3NFPB 3BN3B 3H42L 5IROC 1KFAL 3V8OA 4OZFH 2VR4A 4I2XB 4JO3L 4J23A 1VEPA 1HI6B 4U1JA 2NCMA 2H41A 4YPGA 3U9UA 1S7VB 2PCPA 5HYJA 5F1OB 3G5YB 3KYAA 3KJ4C 1DVFB 1JWUB 4P2RE 5E00A 4O51B 5MEOB 1TDQA 3EYSH 1T1XB 4Y16A 2X41A 1ZVSB 4PRHD 4YHOH 1Q94A 3QRGH 3HUJA 3Q3GB 1X6LA 4RGNB 5F9DC 5FO9A 3X13A 2WINB 3LRSA 2O5YH 4M61A 1MH5B 4MSWB 5J0BA 5CEXB 5DJ6A 2DMCA 2NR6D 2ZUUA 4RCAA 5L88L 3KPTA 3IFLH 5BV7H 4KKCC 4POZD 4QHUA 1L9NA 2EDNA 1WTLA 4HWBA 5JHLL 2NZ9C 4JKLA 1RUAH 1G9NH 5F1NA 2ENSA 3GO1L 3C60B 1HHKB 1NC4B 1T6VN 1GH7A 3LQAL 4M9OA 1QYGH 5K59F 4U1JB 5T5NG 3U30B 3U9UB 1UWGL 2X4PA 3L3OA 4LPYA 2PCPB 4QXWA 3RL2B 2EDEA 4JN2A 3BH9A 4O4YH 4M6NL 5C6TH 4TULL 5E00B 3MA7A 3I85A 3DMMA 4BQ9A 3ZYOA 1WWAX 4Y16B 3IDIB 4OM1L 1DQMH 3HUJB 5FO9B 4K9EL 2I5YL 5IVXF 3DVNA 1P53A 2BJML 3P4MA 1WAAF 4M61B 3I6LE 1TVBB 3H9YA 4J4PC 4GRLC 4G9DA 1YEIL 4MLIA 2VWEE 3O9WC 3C2AL 5AUMA 43C9A 4F9LA 4Y4FC 1ZWIB 2EZ0C 3DYOA 1IKFH 5CEYB 3PQYE 1A7OH 1ZGLM 3PG2A 1DEEB 2A74A 4YBLC 4NN6B 2VZVA 4OGZA 1ZT7B 2JJTA 1X7QA 3KPSE 4PP1D 4QHLA 2G5BB 4WI4A 3UJTL 4K3GA 5HHPB 4X4ZA 2XQBH 3MA7B 3P77B 5JW4Q 3I3DA 3VRJA 5D4QA 1DCLA 5CFHA 5DA0B 5JDJA 4ZNCD 3DVNB 1LK3H 3FOMA 4U6YB 5DJ8B 1XF2A 1YPZB 5CJXC 5FYKL 2J5LB 3N85H 1HHGA 3PQYD 2EIZA 2EE2A 5DQDL 4H8WC 3MROA 5EOQL 4U3CA 4G9DB 4QNPE 5C9KA 4X9HA 4XNQA 1N2RB 5AUMB 43C9B 1IGYA 1BZ7B 2A1WH 5EA0H 4PG9A 2VJXA 3KPSD 4YX2H 2NXZC 3P40A 4XCFL 1Q0YH 1U8LB 2ESVB 4DN3H 3NIDF 5JW4R 1UM6L 1OAYL 4JRWA 1JPGA 4QHLB 1CF8H 1VEMA 1MCCA 4LP5A 5TE7H 1JNLH 4KY1H 4YBQD 4ISVB 4PRDB 4NZTH 3HLAA 3W0WD 2E3VA 3FMGH 1XF2B 3RU8L 1HHGB 2EIZB 3IF1B 1YEDB 3MROB 3T2PA 5I6XC 3IAPA 3MXWL 4WWID 1UC6A 1R3HB 1QFPA 5BRZB 5AG8A 5GISH 1QBLH 2RFXA 3MNZB 5E99L 4PJFE 3MA9L 2P24A 2YUXA 1BFVL 1QSFD 3LIZL 1N64L 4JZJB 4MWFA 3LRHA 3L3JB 1AXIB 3NIGF 1CGUA 3UO1L 4GBXA 1MLBA 1BQHG 1JPGB 2J4WL 2ZSVA 3MJGX 5F1SA 5DK0B 5GGSA 4P48A 3I2CL 2AJZA 3K4AA 3OZ9L 4X6CE 3HLAB 2FX7L 2QSCL 3LPFA 4Y5YA 2UV3A 5EU5A 3PL6A 1KPRA 4JQVC 1E27A 1EBPA 4NQSA 1CCZA 1BPVA 1A6PA 1EUUA 2D9CA 1I8LA 1ZTXH 4M93B 3MLXH 4UQ2A 3BDYH 4OD1H 4ALAH 2DWEA 1T0PB 3MSPA 2FYYA 1E4KA 3QDJB 3KLDA 5FHBL 1MFDL 4Z7QE 2WBKA 1YN7A 4WNQB 4MXWH 3E6FA 3C9NA 4XBPB 4P4KA 3BI9X 3P9LA 3KPQB 2P24B 1A6UL 3RP1A 2QKIA 1JTOA 2V2XA 4GRWE 4PJXE 1A1MA 1K4CA 1CD8A 1A6VL 4TVPH 3BN9D 4FNLL 5DSCA 1EEZA 1MLBB 3BEVA 25C8L 3B9KB 3E3QC 5TE4H 1LDPH 2ZSVB 4QXUL 5J9PB 5GGSB 4ZXBC 5JW4N 4DK6A 2AJZB 4NQDB 1LNUA 4PPTA 1JGVH 4I0PA 2Q1EA 1QRND 3PGFH 5EU5B 3PL6B 5F7YC 4LKXB 3ZDXE 2P46B 3DTXB 1LVEA 3UTZA 4UQ2B 2DWEB 4KJQC 2FYYB 3OJVC 6FABH 2PETA 3VXNB 5IMOB 3MRDA 1QSEE 4Y5XC 4QRQA 4IIQC 5GSRA 2E9WA 4Z7NE 1IE5A 4HFUH 2L7JA 3NIFE 3L3GB 4QHNA 5SX4I 3E6FB 4GAGH 2OTPA 4P4KB 4HC1L 4ZD3L 1N8ZA 2B1AH 2IAMD 3QPQD 3ARDD 1KIUA 5HHXL 1CDUA 1KENH 3BZFB 4XP6H 4F33B 2UYLB 4JHWH 1EEZB 2XZCL 4MS8C 2PN5A 5GS0D 3KPRE 3BT2L 3IVKB 4LBEB 3D39D 4Q74A 2IBZY 4U7KA 2WQRA 3BFOA 3BUTA 4UTAH 3O3UN 2BSSA 3CPLA 4S1DC 3VXUA 5HD8D 1KCRH 2WBJB 1OGAE 5JPMA 3CU7A 1QSED 4LSPL 1AJ7L 2PW1B 4YHPA 3RY6C 1WEJL 3FO9A 3UTZB 3MLSH 3SE3C 2K3TA 4XAWH 4U05A 4R0LA 1CDGA 2AS5M 5EFIB 3OPZH 3SDAB 2FIRT 3MZGB 3KPRD 1YEJL 4JKPL 3RVVD 4KUZL 2X4QA 1A3LL 1S9YB 3O4LA 4K3EH 4KV5E 5HI3C 5ITFB 1JYNA 1KTLA 3FQRA 4L8DB 5E9DA 2EXYD 4KROB 3MXVL 2A9ML 2QQKL 3QCUH 4WO4D 1WTGT 2WWKO 4RSVA 4P2QE 3IJHB 5DRXB 3J8F7 4L9LC 1T7VA 3QUXC 2OL3A 3VXUB 3WFDL 3IDYB 1F4XH 3TVMA 4BKLB 1SHMA 3QH3A 2F5BH 2YRZA 2YWZA 4YHPB 1J1OH 2R0WL 3NH7H 3FO9B 1F3JB 5F1KC 2DM3A 3TBVB 1KCKA 5DHYA 3MNWB 3BHBA 4ZOCA 4L5FH 3CVHA 4W6YB 1CDHA 1E6OH 4ZTOL 5BO1L 1I7UB 2V9QA 4P2QD 1YECH 2X4QB 1TVHB 5DJYA 3O4LB 2LVEA 1QFUL 5J11C 3MLYH 5C0CB 3LS5L 5B3JF 3T0AA 5DJCA 4Z0BL 5ESQA 1KLGA 5FGBC 4PB9L 3RKDC 2C3HA 3O45A 5IIEA 2FJHB 2OMNA 3D85A 4RGOH 4WFGE 4HPOH 3JWDL 1NCWL 3I84A 1FC1A 3QH3B 5CUSL 5CGYD 1FDLL 3MRKA 5B22A 5EIQA 2VSCA 4XX1E 1EGJL 2Q8BL 4Q0XL 2OXHA 4PP2A 3IAGC 1Z0NA 2IANE 1TTFA 2Z9TA 2LU7A 4WHCA 2HLAA 4M7ZC 3CVHB 4D9QE 2GQHA 1NFDA 5EZJA 1JN6A 5GGUA 5IVZB 5CILL 3DYPA 2HMIC 2ARJQ 4HJGB 1QZ1A 2NY4B 2X4TA 3T0EC 1E6JL 4IDJH 4WFGD 2AW2A 4G8IA 5C0JA 1T5WA 3EOBA 2R9HC 3CDCA 3BQUC 5FM5M 1RUQL 3KHOA 5FUCC 1W0WA 1P9MA 3T3ME 5IIEB 3MV7D 1T03L 1CDYA 3JTTA 4D0DA 2D7NA 2C26A 3FO0L 3MJ9L 2HJKB 3RGVA 5DO2D 2P5WA 2IAND 4FQ2L 2HTKC 4D9QD 2OMBA 5SWZB 4S1SL 5MHSE 4O5LH 3PV6A 1ZEAH 4ODXA 3BKCH 7FABL 2XZQH 4JANB 4QWWC 4ONHA 1H3VA 4PLNC 1XMWA 4NGHH 1MY5A 1NLBL 4LHUA 5EZJB 1QNZL 1S9WA 3IKCA 5GGUB 3T0WA 1G0XA 5D2LA 1IFHH 1PYWA 1IC5H 3RUGA 1OSZA 4KK8C 4KJYA 2CUIA 5HYFA 4OF5A 1T5WB 3GMOB 3EOBB 1NC2D 4KDVA 4LSVL 3WFEH 5EIVA 5FYJE 1SBBA 3HZYB 4YEFA 1BX2B 2Q86A 4DVRH 3IXAB 4IMKC 4NHUB 5CSZB 4JCMA 1X5GA 1RZGA 1HE7A 5MHSD 2YKLL 4OFKA 4M43L 3VDAA 3O3BA 4PRBB 5C0GA 3RGVB 4TPRH 4TUKL 3MRCB 1OAQL 4P2YA 1NFDF 1K3IA 4HH9B 5E8NA 5I1DB 3MV8B 1F58L 1VACA 1JFMA 3VMNA 4BZ1L 4ZAKB 5KVDH 4NSKA 4ODXB 3LDBB 5IFHL 2VXVL 4ONHB 5SX4H 2EYTA 4LHUB 2EC9U 1A22B 1S9WB 4JFYB 2Y1VA 3SGJA 1ZA3B 1RIHH 5D2LB 4JFZL 1PYWB 2EE3A 4ZSOB 2R4RH 3U0TB 3RUGB 4KJYB 4LCWA 5EU7E 1OD7A 1B0WA 1MPAH 3RVTC 1PKOA 2R1XA 4RWYL 2G75B 1DDHB 5FGRA 1IGCH 1FPTL 3N9GH 2E8YA 4JM2D 3M17B 4QT5B 5C0GB 3TFKA 3NCYP 4QXGH 1QHOA 5GRXG 2RIKA 3GBNL 2YK1H 3PABB 2R69L 1A0QH 2AQ3A 3QUMB 1VACB 1DSFH 4HHAA 1SEBB 3DX8A 3FOLA 5IF0A 3MACL 5JQ6L 1MIEH 5IBUB 2EYTB 1A3RL 4N8VA 2W1NA 4XBEL 3GB7A 3P11L 4Z7WE 4TNVF 4PTUA 5H35B 2ICCA 4QF1A 5F96H 4KUCF 3QFJD 1KG0A 4QO1A 3ARXA 4V1DA 3TIDB 4UI2A 1DVFD 4N1EA 4FP8L 4F7PB 2R1XB 3D18A 3L5WA 4WHYH 5F3BA 1U8IA 5MP6H 4OCXH 1E4XI 4RGND 1UGNA 4PS4L 3GBLA 1SEQH 2BNQA 1GPOL 3DPBA 1RJYB 3GKZA 3I75A 4YFLF 3GI8H 3DRQA 4HGMA 1U6AH 2J8HA 2DI8A 4NJ9L 4PD4J 4HHAB 5DEZA 5CD5D 2OK0L 3HUJE 4DN4L 5IF0B 4LCIH 1YY8A 3UCRA 4P46D 4P59L 4CRPA 3C60D 2WAHA 2IH3B 3VGEA 1NC4D 1PGRB 3O2VH 3BSZL 3GB7B 4K7PH 4F7TB 4PTUB 2KDGA 4DCQA 1KG0B 1GL4B 2J6EL 4XNXH 2AERT 5HYJD 4QY8B 1DQDH 3LN5B 4YNYA 3T0BA 3SO3C 3R0MA 4U0RC 1HKLL 2AEPL 1Y6NR 2R0ZH 2NXYB 3QQ3B 3RWEB 5FO7A 4Y16D 3PP4L 1ADQL 3OKEA 4J3VA 4AL8H 2XWTA 5E4IA 4LLWB 5J12B 3FQXB 2AJYH 4QRTB 3I75B 1DN0A 3DRQB 1AQKH 4DTGH 2CXGA 3G9AB 3RVWD 1INEH 2NTFA 4XVSL 4Y5VA 1CICC 4U7SA 5BZDB 2V17L 3EIFA 2PTVA 1U92A 1YPZE 4ESKA 2FIKA 2DLGA 3HZKB 4FQQA 4P9HH 1FNGA 4X0KA 5CIPH 5KN5B 4YDLB 5SWQB 5I1JL 1T22A 5DEFA 4M5ZL 3B5TA 4PV9A 2CSPA 2WZPD 1FO0H 2ITCA 1UB5A 2R2BB 5I74B 5F9OH 2CK0L 4NQUA 5DWUL 2ESVE 2AVGA 3DMMD 4MXQC 3OG4B 5FB8A 4OLYH 2BHUA 3F58L 4C55A 5F7WC 1CDIA 2XWTB 2VLKA 5DR5H 3SOBL 3MFGB 5EBWB 3VI3E 5F8RC 5IT2H 2C4FT 4LCCC 2Q3AA 4ODSL 3HAEA 1BD2A 2OZ4H 5HHNA 4BQ8A 2N4IA 3QFDA 3ALWA 4X4XB 1GAFH 2WLZA 5EZOL 3IGAB 3NABL 3G5ZA 5ALBL 1HKFA 1NGYA 1FNGB 4K3HA 4X0KB 4Z7VF 2NY2C 4PJ5E 2MKWA 5LQBL 1T22B 1NEZB 5DEFB 5EO1B 5BRZE 2X1QA 2ED8A 2G2RA 4P2OC 1OAKH 2HKHH 1UWXH 2ITCB 4HCRL 4M1GL 4EVNB 1KN2H 5LGKA 1C08B 2MHAB 4F7CB 4JFFA 1J11A 4QRSA 5D1XB 4U6HB 3FQWA 4M7LT 2VLKB 1KCGC 1CVRA 3L5IA 3V79C 5L8KB 3IU4H 1RFDH 3HAEB 2PYEB 1BD2B 1YNLH 1DL7L 5HI4D 5BRZD 5F72S 1WK0A 5HGAB 5AZ2L 5GS0H 3K1DA 1WBYA 3WFCH 1NGYB 2Y36H 1KEGL 3QDJE 4LMQE 1T66C 4HC1A 4WIQA 1KGCE 2G2RB 3MRIA 3DX7B 1FN4A 1CFBA 4PD4K 4DZ8B 3U4BL 4EIZC 4JHZA 5DF0A 5L0QC 3W5MA 3QZWG 4GRMA 4JFFB 1BJ1J 5CGTA 3UJJH 3UTSA 4G7VH 1I9EA 1L8JA 3EYVA 4FQ1L 4MJ5B 4RFNB 2X9YA 3GUTB 3FN9A 4XT1C 4NUGH 1V3LA 2VXSL 5D7IA 4NQDE 5EUOB 4JFPB 5CJOH 4H88L 1CLOH 3QO0A 3DETC 4YE4L 4M6OH 3QWQB 5GGRA 5SX5K 4JDZA 2VE6A 4XWOC 2Y72A 5ICZB 5DC0A 1Z9OA 3IAQA 3V4VH 4GBXD 3OXSA 2XXMB 3B9KD 3Q6GH 4N5ED 1N7MH 1WIPA 3M1BA 1MWAH 1E4XH 4EN3A 1ITCA 5KBNC 4UNVA 1OB1A 2KH2B 3LEVH 4Q6YA 3UTSB 3RZCA 1J5OL 5FA3B 5BVPH 2PNDA 3PL6D 4CDGC 3EYVB 2JTDA 5HYSA 3LVEA 2UZXB 1KF9B 3VFWB 5EBGA 2PR4H 3QCTH 4KJPC 1NBZA 3S37L 2H9GA 1ZHNA 4OD3H 4PB0H 5CMAB 1XF3B 5EUKB 1T83C 3BXNA 3SDDB 1JVKA 3QO0B 1KIPA 1YEGH 1L4IA 1FORH 4PJEE 4P4KD 4YDKH 5KSAB 3MX0A 5DJZA 4BSVA 3C5JB 1VFAA 4OT1L 1EPFA 4OZGE 1WCBA 4UTBL 3OXSB 4MNQE 1FZMB 4NBXB 3UYRH 3GM0A 1VGEH 2WUBH 3WIHH 3M1BB 3SCMB 4JHAL 4EN3B 1UZ8B 4ZFZA 4KKAC 1OB1B 2WBJD 5D7IF 5ERWB 3GIVA 4N0RA 4I0PD 1N0XH 3EDEA 3GKWH 4O2CA 2V2TA 4PJDF 3V5KA 1KTKE 3NCJL 4R3SA 1NMBL 3QDHA 2IBZX 4HV8A 5DT1H 4HIJA 5E2UL 4B50A 1RUPH 2VC2H 1FNSH 5HYSB 4LLUB 1DANT 3ARGC 1BVLA 5D71L 4HPYH 4G5ZL 1EGJA 5BJTB 5IEHB 3ZE1E 4OFVA 3DSNA 1TPXC 1KIPB 2OR8A 2VXTL 1MFBL 1H3TA 3FB7B 4BSVB 4EQ2A 3RNQB 4FABH 3PV7A 5IJKA 4WEBH 1BQLL 4OM0H 5C0CE 5D1QB 3VXUD 4ZFZB 1LK2B 4OV5B 3KLSA 3VFGL 4H20L 3MJ9A 5EU6A 4JN1L 4YHYB 5DHVA 3FQUB 3ZYIA 3N50A 1MFEH 2J88L 1BM3H 4FMKA 4RISL 4Z8FL 1G7QB 2E7LA 5D6CA 3QJFA 4PG2C 4XMPH 4S10A 1NCAL 2VDNH 4NC1E 4G6FB 1FVCB 4JB9H 3B2VH 3O4LD 3ZTJH 2APVA 5ISZB 4QRPA 1MRDH 2JCCE 4AENA 3FB8A 1MI5A 5I1LB 1DBAH 2CIIA 2BHZA 3QUKB 2Z8WC 3OTTA 1YDPA 2XYCA 2NY0C 4OQTL 4MXVF 3TVMD 5E2VL 3MO1B 3TGXA 2VLRB 4L8BA 4PTTB 1TJGL 5DHVB 5A16B 1WSST 1AGEA 4P5KB 4KJWC 1FRGL 2D2OA 1BQUA 3P4OB 5C0BA 2IEPA 5MI0B 5JIPA 1JBJA 5IBLD 1I3RB 3SY0A 4QTIH 3ARSA 4RAVA 3QJFB 4APQB 1J87A 2Y06H 2GJ6A 5SWZE 3TIEA 3GRWH 2HVJB 3L3HA 5IMLB 4DEPB 1FFPA 4M7JL 2CIIB 1INQB 4PJ8A 3QUZC 4YHKH 4ZYKA 2EH7H 4KTEH 2DJ4A 5L2KA 1KCUL 3FO1B 3U30C 1KTDA 3D85D 3JSSA 5CCKH 1NGXA 4FFZL 5J8OA 4OCWL 2ZJSL 2A6IB 4R90L 3TYGH 5L7XH 1U8OA 1X4XA 1BEYH 4L8BB 2BVOB 2YPVL 3VFTB 4WTWA 4NHUE 5SWZD 4LSQL 5T1LA 1RUKH 3RWFA 2YUZA 5C0BB 4FZ8L 3OF6A 1U8PA 1R3IL 5D70L 1ZANL 3SY0B 4RAVB 4XP4L 2QQLL 1MJUL 3T8XB 3TIEB 3MV8E 2MQCA 3L3KB 1U93A 3MRRA 1IM9A 1JYWA 4M5YH 1MCKA 4I3SH 1FFPB 3HPJB 2PW2A 4JFQA 1P7KB 3Q1SL 3JV4B 3BW9A 4PJ8B 4JLRA 1BJ1H 4ZYKB 3RIAK 1NKOA 5IM7A 1FIGL 1I8MB 3FZUC 4ZODA 1KTDB 4ZSOE 1UKSA 1NGXB 3RUGE 2IMMA 4JFEA 3AM8A 5FUZL 1EFXB 4CMMA 3WUWB 3RGVD 1U8OB 3GFUA 3GSRA 5IW3A 4PRIA 4QRUA 1NCDH 3HG1B 4AMKH 5TFSL 3HC4L 2ADGA 2YUVA 5IB3A 5E4EC 1Z2KA 3DIFA 1PSKH 4O2FB 1TZHA 1OY3B 3D0LA 4LHUD 1MCBA 4HUXA 2VDQH 4NC0B 1U93B 4XCCL 4K94C 6CGTA 3LKSA 1U8QA 1IM9B 1HSAA 2KKQA 3IJYA 5A3ID 5M7QA 3PWLA 2BY3A 4Q9CA 2GY5A 2PW2B 4PJ7A 4PREA 2FGWH 3TO4C 4MD4A 1MRCH 3VFNB 2J6EA 3W2DL 1J12A 2DQGL 4WU7B 4EDXB 3O6FC 1QLFB 4DGVL 4KUCD 3EYOA 1YY9C 4BFBD 5GJSL 4CMMB 3QQNA 4MMZC 3UP1A 2P8LA 3KS0J 1QLRB 1B6DA 1ADQA 3GSRB 5GZNC 4FXGA 4UOW1 1FGNL 5I1IL 3JXAA 4PRIB 4PGCA 3LS4H 5JLZA 4JFXA 3HI6H 2X89A 3TPUE 2VTFA 3ARRA 3A6CH 2VXQH 5IB3B 1UVQB 5BV7C 3DIFB 4PJHB 3IDMB 5KVFH 1N3NB 1UWEH 1TZGL 3D0LB 3KXFB 3B5GA 2X7LA 3NPSC 1R0AL 1NJ9A 3IDUA 5J89A 2OQJA 3IETB 2DD8H 4I48A 2A6JB 1HSAB 1N6QL 1BWMA 1HEZB 1M7XA 3PWLB 3BISA 4LCWD 4PJ7B 4L1HA 3K81A 1CXHA 4PREB 1VFBA 2C3VB 3OKDA 5CKGA 5D7JA 4JO4H 1D5XA 5CWSB 5FXCH 5EO0A 4JZJC 3UBXA 3MNVA 2IJ0C 4MD0A 4DVBA 1NCTA 2X4OB 3ALXA 3EYOB 1SYSA 5IFJB 4IHOA 2FX8L 3TFKD 4L1DA 3HNSH 4U1SA 4YO0B 4ZDHA 1JI2A 2Z31A 5LAXB 5JQHC 4PGCB 2VISA 4E0RA 5JLZB 3HR6A 4JFXB 4OTXH 1Y6MR 3TCLA 1T3FA 2HLFC 2EYSA 1J8HA 4X7CC 2AEQL 5D1ZA 4KI1A 2V7HA 2OLDA 3KPOB 4B7LA 4M93C 4ELKB 4JO1H 5I75C 1NJ9B 3BE1L 3DARA 4BFGA 4I48B 5F7LB 1F8TH 3D1MC 4V1DD 5T1DL 1VFBB 5B38G 1D5XB 1IC7L 4MNGA 2NXYD 5EO0B 4HCRA 3WCYA 3NCEB 4LP4A 3T04D 1XF4A 1P84K 4IHOB 4OGYH 4B53A