3VJ6A

Structure of the mhc class ib molecule qa-1b
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
277
structure length
277
Chain Sequence
SPHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRARWIEQEGPEYWERETWKARDMGRNFRVNLRTLLGYYNQSNDESHTLQWMYGCDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTANDIASQISKHKSEAVDEAHQQRAYLQGPCVEWLHRYLRLGNETLQRSDPPKAHVTHHPRSEDEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQYYTCHVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for antigen presentation by the MHC class Ib molecule, Qa-1b
pubmed doi rcsb
molecule keywords H-2 class I histocompatibility antigen, D-37 alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 80
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vj6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vj6A01
5J1AB 3HAEG 4BSVA 4QTIL 3LD8B 3QA3A 1AXIB 2OTPA 4TPRL 1QLRA 1RURH 2APTA 2KZWA 4FQXD 5T1KB 1S9YB 5DRXA 5FHBH 32C2B 3KPNA 1SJEB 5ALBH 5LGHH 3ULVE 3GMMB 4FXGB 2HN7B 2ZUSA 3Q5YA 4OF5A 1J18A 1KBGL 2Z93B 4XXCA 1J05A 3PF2A 4YDVA 3SDXA 2HH0L 5IBUG 4FFWD 3QSKB 1N0LA 1BX2B 4N90E 5I1HH 1FNGA 1DDHA 4OGAC 3TT3H 3DMMB 3S9DB 4XBPA 3SO5A 5C0BD 1A5FL 5HDBF 4L8DA 1KC5H 5CKAA 3WFBL 5JA9A 3W0WE 2F8OA 1JHLL 5D1XC 1N5AA 1PEWA 4N0UA 2PYEE 3MROB 3LEXA 3L5XL 5DJ8B 4F15B 3TF7A 1W0YT 3D3VE 4KTEH 3N1QC 5DVKA 5F3HA 1HIMH 5F96H 4Q6YA 4LCCA 2NY1B 2OLDA 4HDIA 2R1XA 1BJ8A 2PTTA 4L3AA 4P2OB 4XZUB 4OJFL 2OQJA 4JDTH 3UJJH 5CBAA 1M71B 3QDMB 4NQDD 1OP3H 1PX4A 2VLJD 1GZQB 2B4CL 2XFXB 3FOLA 1Z9SA 3NCCB 2BSSA 3N1PC 4TUJA 5LG1A 4XVTL 1LEKA 3VGEA 1KYOJ 2FJHB 1CL7H 4M02A 1KB5L 4CDHA 25C8H 2D7PA 1KB5A 4QHUB 2ZG3A 5IMOB 3PL6D 4WFGD 5TDNB 3OWEA 3VXMD 5ELIA 4NWUH 4AQOA 1IGJB 4CVZB 2V5TA 2BOCB 3LQMA 4MJIB 3EYSL 3WE6B 5KVFL 1ZHLA 4G8IB 4FQXA 5EZIH 3BT2H 3E6FB 4HS3B 4GG8A 5K9OA 2WP3O 1XGYL 3LH2H 15C8L 2EKSB 4ZNEA 3B83A 4H1LA 4KTDH 4X8JB 1PKOA 4ZFZA 4JQVC 4WUKL 3HR5A 3MR9B 3ZTJG 2FCBA 2UWEB 3MV01 4L9DA 3CLFL 1VGKB 5I1CH 1DBBL 5GIRA 2XZAL 4WHTA 5T33L 1BFVH 3PHSA 3MRCA 4CVXB 2R8SL 4ODXA 5C0BA 4PRID 2J7LA 5C9KA 4U6VL 3I6GB 5EBWB 5INCB 3RWDB 1WC7B 2VDRH 4YBQC 2CDGA 4F57H 3ULVD 3EYQD 2HFFB 4XMPH 4HH8A 4LVHC 3LIZH 4ODHL 1MHEA 3IYLW 3LKPA 2BY1A 3VXUB 4O9HL 3GMNA 1EJOH 2UZYB 3FO9B 3CMOH 1BAFH 1FYTE 1Q0YL 3CK0L 5MI0B 3SGJC 1K2DB 3CH1B 4N90D 3WXVH 1OTUC 2G9HA 5F7UA 4QRTA 3MOQA 1OGAB 1NCAH 3REVB 3KS0J 5SWSB 1KCLA 4X6FB 1RURL 4X4ME 1MLBA 2VLJA 1E4WL 4JLRA 2PYED 5EBLA 4HAFA 1OM3L 3BE1H 5FHBL 3KPOA 5J6HA 1S7SB 3LMJH 3D3VD 3KHQA 3R4DA 5ALBL 4L8CB 5LAXA 2E7LE 5F7HA 3EKCA 4ZFFB 1I1FB 2BVQA 4N9GB 3MUHL 5DHXB 1T7YA 1BLNA 4ODUB 3VGGA 5JORB 4PJGF 3MLYL 1INQB 1W8OA 3PL6A 3NH7H 5K9KB 2FH8A 5BZDB 1A02N 1A7NH 2G75B 1K4DA 5I0DA 1DL7H 4U6XB 1FO0B 4KHXL 4FNLH 1IEAB 3I84A 1J5OH 2F53D 4M1GH 3F6LA 4KTEL 2IPUG 3MLSL 3QIBD 4L4JA 4GXUN 3MLTA 2NY4D 4PJBE 5L0QC 2BMKA 2OTWA 1QKZL 2IMMA 4PY8J 5F9DC 3C5ZB 4KDTA 1EUTA 3UTZB 1KNOB 4RGND 2VSDA 4NGHH 2J6EH 3RAJH 4JDTL 4RDQF 5BV7B 4KC3B 4MQ7A 4K23L 1PZ5A 3HUJA 3H9SB 2ARJA 2X1QA 5C09D 1CLYH 3ULVL 5FB8A 4PRIA 1FHGA 5D5ME 4D9QE 1JF5A 3DX7A 1XGUB 1IGCH 1R6VA 1CL7L 3D2UD 3V0VB 4XPGL 4GKNA 5B4MC 3IKKA 5IG7B 4TTDD 2PYFB 1JRHI 3DOSA 4L1DA 1LVEA 2PW1B 4PV8B 3IDXL 5IK3B 5KTEH 2IH1A 3KPMB 1CQYA 1D9KC 4G42B 4OLEA 2VAAA 3V4UH 3NN8B 2GSIB 43C9A 2GK0B 3BPOC 1YEDA 3P2TA 1YMHB 4D3CH 2E7HA 5IVXE 4QHLA 2Y25A 5CFHA 2YC1B 1NUNB 2RCSL 4HT1L 1P7QB 3PXHA 3U9UB 1F3RB 1GGBL 5A43C 2ESVE 3TIDB 5B22A 1IAOB 5SWZB 3RUGA 1NGXB 4IS6A 2HT2C 4NFDA 3MLVH 3UJIL 1TFHA 4JFPB 4FG6C 4ZUSB 4MNQE 4ZTOH 1OW0C 4M7ZB 5FUOH 5DO2D 1NC4D 2YPLE 2R0KH 4Q6IA 4QXTB 3UO1H 3WBDA 3WN5A 2IMNA 3VXTB 4X6CB 2XWBB 4UZGA 5IT2H 2YD9A 3QH3B 1JZ2A 5K9JH 2NCMA 1KPRB 4FQLH 2WQRA 1OCWH 3SDDC 4S1QH 4EEEA 4YC2B 1UM4H 1U8OA 5DURD 4F57L 4PJ9D 5DS8B 3WFHA 1NFDB 3X11A 3OAUH 2LQRA 4H26A 1LO5A 3THMH 1E6JH 2F53A 5IM7A 3ZTNL 4U1IA 1RJZA 4GAJL 2E7CA 1JYNA 4WWID 5EU5A 4R4BA 4NWTL 4GOSA 3BDBA 4NZTL 3OR7A 3CX2A 1MRFL 3RHWF 3VFNA 3RWFB 4KVNH 1CE1H 4G80B 2IGFL 1Y0LB 1RVFL 1BIIB 4M43H 2Q6WB 3RY5A 3LMJL 5C09A 3N1FC 3RTQA 2FSEB 3S7GA 5DEGA 4GUPA 2OM5A 4NZUH 5I6XC 1QTYT 2CUHA 3BEWB 4NKOA 4HJJH 2V5SA 4HJ0D 3D2UA 4GKSA 5CEXB 4YE4L 2IADB 2Y5EA 4N9OB 3ZL4L 2EYRB 1DSFH 3DROA 3O6KH 5D6CA 4N5UA 5F1KC 3SKMA 1F4XL 3MV7B 5ESVB 5BJTA 1A7NL 4OZ4B 4JPWH 3FT3B 2ZG2A 3PV7A 5EC2A 5L8JB 1H8SA 1OVZA 2Y7QB 3C60C 4L4VA 4L8BA 1MQ8A 3HG1E 3N0PB 4M1GL 4OT1H 3V6OE 4XNZC 1FL3B 3V4PH 1CXEA 2H26B 1AR2A 2FX8H 2JE8A 4IOIB 1YEIH 1XIWB 1D5XA 3C87A 3RWGB 4PJFB 5KSVB 4P9HH 2FHCA 4NGHL 3IVKA 3MGAA 1LDPL 3IDIB 4JO2H 2DQCL 2J6EA 3LDBB 4IOFC 4DZBB 3HC3H 4JN1L 5EIIB 4RQQB 3T65A 3QG6B 4XP4L 2XY1A 1BWWA 2X6MA 1TPXB 2ESVD 1OAZH 4RGMB 2XN9E 1FVCB 3I3DA 2WBKA 2XTJD 2EEDA 3EOBA 5HGGS 5TPWH 2GY7B 4YGVB 1C5DA 1WIUA 2A9ML 3DVNB 4PJ8C 4HZLA 4EI5D 4G8EB 4XRCA 5DRWA 2YPLD 4NN6B 3NCYS 3RVWD 4Y5VB 3V4UL 5DD6A 3S3PA 1U8LB 5DK3A 5FAAA 2DDQH 2FB4L 2YD1A 5CUSL 2H2SC 2BXYA 5C0JB 3O6LL 3F7YA 3G5XB 3MRMA 5DJ0A 3RVUD 2HT3C 1Q9WA 5IWLC 3MRFA 3TF7C 3UC0L 3GJFB 4QRQA 2GFBA 3BJLA 5HDQH 3AAZA 2DQFB 5ICXB 1FC2D 2X5PA 4UIMA 1XFPA 5D7IA 1CXFA 4P57B 4ZTOL 5FUOL 3L3HA 1IARB 4LCCC 3TA3C 1FL5A 5C0FB 3ZYJA 2EDHA 1K8DB 5GGVY 1TJHH 4O58L 1T4KB 5KSBE 1JVKA 5JOEA 4G6ML 1OCWL 4S1QL 3LAFA 4QRSB 2VXSL 3LKNB 5MERB 1H0DB 3MUZ1 1PSKL 1OP5H 5GGVH 1UKSA 4F7EB 2R23A 5K9QI 3U0TB 5TE6H 5SWQB 2B4CC 5DEFA 4X5LA 3NFSL 4FABH 4X4YB 1KPVB 4XP6H 4IHOA 2L0DA 3T0VA 2Y9RT 1TIUA 5JW4M 2YKLH 2I07A 3WSQL 1F90L 3RHWK 5JLZB 4UBDD 4KVNL 4MSWA 4N1CA 1CE1L 2ERJC 5HYSG 2FJGB 3BFOA 3WFDL 2BFVL 2B1HL 4FQXC 3IJYB 4YPJA 3T4AA 3KPSE 4XAKE 4HJJL 1ND0B 1JWSB 1MI5B 3RPKA 1E28B 1EFXD 3T0ED 3AREA 4R6UA 5DMIH 3BI9X 5EUOE 5IHLB 3FKUS 3EYFB 1IM3B 3ZE0E 4R90L 3GK8H 3NIDF 3ALPA 3BSZL 4FFWC 1JGVH 4LOUD 4HKXA 4JFQA 2XWTA 4GMTL 5D1XB 3CXDH 1DQJA 3TFKD 1G9EA 2DIJA 3NCBB 4IDJH 4LHUA 4Z0BL 1NEZB 1S5IH 3UTPE 2X9WA 5CMAB 1FSKC 3E2HB 3LHPL 4UQ3B 1NGPH 4FQQA 3OKMA 3WEXA 1IM9D 1BBDL 4HIXH 1W72H 2VDLH 4DN3H 1MH5B 2BP3A 1NMBL 4KHTH 1L0QA 4HWBL 1JWUA 2CRMA 3HHRB 1AFVH 4NO5B 4GQ9H 1ZT7B 4D94A 4PJCE 1QZ1A 3P73A 1CICA 4JO2L 4DUXA 3BGMB 4PTUA 5HHQA 3TH4T 3KXFB 2ICES 4IMLA 3SKNB 3HI5L 5IUSA 1F3DH 2FATH 4LLUB 1VDGA 2W9LA 5E8PB 4KTYA 3KPRE 3LQAH 3NTCH 1I75A 1P9MA 4N5ED 1SHMA 3QULA 5IB4A 1MJ8H 4FTVD 6CGTA 2NY7L 3QIWA 1PG7X 1BQHB 2D7QA 3DX9B 1CCZA 3L5WA 3G5VB 3QCVL 3NPZB 3O2WH 4KXZI 5EFIA 3PL6C 3NFNB 3P11L 3PUCA 2YD6A 5I17B 1TITA 5HGAB 3RWJB 3AS0A 1KIPA 5FM5M 5IHUH 1U6AL 1FN4A 3OGOE 1JRHL 3QNZB 4WDIB 1EHLH 3OJDB 5HYIA 3T0EA 3O3DA 1WBXB 5BS0E 5KZCD 1MCWM 4KDTC 4ZOCA 1BD2A 5E2WL 3VFUA 5DJYB 4B53A 4CN4A 5DR5L 1U58B 5MEPB 1EZVY 2MCG1 4TVSa 1JK8A 2XPGB 4QRPE 4X6BA 1FRGH 2XKNB 2A6KB 3ERYA 5EOCL 2CJUH 2BHYA 4UV4H 4X98A 5FKPA 3TFKA 3KPSD 1PGRB 5HYJE 5TE6L 3CVHL 1AGCA 4LVHB 2C9AA 4D8PB 3WHXA 3INUH 5GJTH 3ULVC 3EYQC 5E6ZA 4RZCA 4FABL 3BUYA 4YZFE 4XP6L 1IM9A 4TRPH 5E9DE 1PG7L 3MA7A 4OAWB 3MRQA 2HKFL 2V2WB 4FQHA 3OKEA 3MC0A 3D6GA 4XPHL 5GS0D 3EW3B 4YHZL 1F11A 3VH8G 5FUCE 2CIKA 1R3JA 2V7HB 2AJ3A 3D9AH 3QUZD 4XP9L 1ZWIA 3T2NH 4AK1A 3DJ9A 3T77B 1X7QB 3PDOA 5EO9A 4RFEA 4U1LB 2EDBA 4HF5H 4YPGB 3U0PB 3EYUH 4N5EA 3NA4A 4E41E 4FTVA 3IRPX 1IAII 1J0KA 1NCDH 2HJLA 2PXYD 4P2CG 5E5MA 2CLZB 3GK8L 3IGAA 4PBVC 5AZEH 2XOTA 1JGVL 4JVWA 4QO1A 1QVOA 1ZHKA 3H6JA 5D72H 1NGZA 3CXDL 4DKEL 3TO4A 3WHE1 1IZJA 3WIHL 3NFPA 3N85H 1VEMA 1LD9B 5H2BB 4F3FB 4I3RH 3WIHA 1MCEA 4KPHL 3DV4A 1PX3A 5D7LB 5DQDL 3OV6A 1W72L 1UKQA 1I7TB 4WHYH 4X80H 3TPUA 1W72A 2NY4C 4LCYB 3O6FD 4AM0B 3BZEB 4GQ9L 1VFUA 3D25B 4J3XA 4RGNC 1RHHA 4PREA 1RUAH 1U91A 5FA3B 5D70L 4WU5B 4JJ5B 3VFTB 1IAMA 2VLMD 4PV9B 3FO1B 2VWEC 5ILTL 5JW4Q 1YEEH 3RNQA 2A2QT 4BKLA 3DYOA 3LQAL 3NTCL 1T80A 5IR1A 1XZ0A 5BXFA 1BP3B 1MJUL 5DJXA 3G6JF 1D9KB 4CW1A 4TTDC 4PBXA 1HHJA 5E94A 5ERWA 1IVLA 2KDGA 3BPOB 3DARA 3H3PL 4QRRB 2GI7A 4PJXF 3FZUD 2AABH 4QCIB 5L9DL 4DJMA 5GS0L 3OKLB 3TBTB 4Y19B 1MIEL 2W38A 4ISVA 1BMGA 3VA6A 3NMEA 2R4RH 4PJ7A 1S3KH 2LU7A 4B0MM 5HYJD 4BZ1H 5BOZG 4MJ2A 4MAUH 5IHUL 3NCYP 1QACA 1XF2A 3IS0X 3MXWH 1ZEAH 4DW2H 4RAVB 3L3IB 4LEXL 1EHLL 3PDDA 4A6YL 3CLEH 4OI9A 5H37G 2EDFA 3TVMD 1G7IA 4Y4HD 3TC9A 5HGHA 2MHAB 4KXZH 4YO0A 5CLWA 5IFAL 1FLRL 4H5SB 1S7VB 2A83A 3L3OA 2R0ZL 2W59A 3F5WA 4HEME 5DO2C 4H25B 4BELD 1FE8L 1V7MH 3QEHA 3SDDB 2Z92B 1FRGL 4KI5F 3TIEB 3GI9H 2Z4QA 1S7WA 1A6PA 2CJUL 4AYFA 4KWUA 3GIVA 4MQTB 2OXHA 4HBCL 4K3DH 4LSVH 3SJVB 1G7PB 5CJQH 1R0AL 3MTRA 3INUL 3LEVH 5IV2B 2WV3A 4PJ9C 1G6RH 1YQVL 4WRLA 4MD0B 4M6NL 1J1XL 4E41D 5B38A 1CGUA 2D7TL 4X5XA 3D85B 4XP1L 4AH2B 5E8EB 3HPJA 3AVEA 4NRZB 4WJ5A 3SPVA 3DX6B 4NHUE 4MCZA 2P46B 3O6FA 1WTGT 1QFWI 3V0WL 5ADPH 3HE7D 2AGJL 3CFEA 1MRDL 3VFOA 3MV9D 4I48B 3GSWB 5JOFA 5MEOA 3TJEH 2FO4A 3RWIA 1I7ZA 2FX9L 3IAPA 3BRDA 1P84J 5CSZA 1G7HA 5I6XB 5H94A 4DZ8A 1NJ9A 9CGTA 3BUTA 4XNYL 3SGEI 3RRQA 3EYUL 4LPXA 4OZGF 3I75B 4HJ0C 4X9BA 3MRLB 3FQNA 1JGUH 4ERSL 4I77H 2VR4A 2BSRA 2NW2A 1ZVYA 4Y4KD 1IEBA 1FP5A 2G5BA 2WANA 2VLLB 5GJSH 3SEPA 1JNLL 3C60B 3FO2A 1EXUA 4YHLH 3BZDA 3CPLB 4UT6L 1U8IB 1X5GA 4J7RA 4XNZB 4AZ8A 3BZ4A 4UQ2A 4P2RD 2IBGA 5EUOF 3CSYA 1IAIH 4KROD 1WEJL 4G59A 1Y6KR 2X05A 4KV5F 4X7SH 4MXQA 5IB2B 1M7DA 2C3WA 3MQIA 5HHPA 1IE5A 1RUAL 1V7NL 1HHKB 1HSBA 4BSVB 4OCXH 4W70A 1FFOA 3Q1SH 1FGNH 2IF7A 1D5IL 3JTSA 3QISA 2PTUA 4MJ6A 3VXOA 3ZSSA 3KPNB 2AERT 3QHZH 2DWEA 5AWNH 3CDGB 4LAQH 5JHDD 4NFCA 4HPYH 4PJ8B 1G0XA 1G7JA 1KCKA 2XTJC 3I6KA 5C0AE 4U1NB 3Q48A 1J05B 5I66A 5BQ7A 5F97E 1A3LL 2FO1A 4F9PA 12E8L 3UAJD 1O7SA 5F88B 3RVWC 5E2VL 5KG9A 3HE7A 5DI8B 1S3KL 2DQTH 4L8DB 2XWJB 3MV9A 5IEKB 3WFEH 5DVLA 4MAUL 2GJ6E 3V9FA 5ITBL 1J0JA 3MXWL 1ZEAL 3MBED 3LEXB 1F97A 3O8XA 4DKFH 3H7LA 5DD0H 2XY2A 5D2LA 3CLEL 3LS4L 3RVUC 3P30H 2EO1A 3D39A 5F3HB 2AS5M 3MO1A 4HCRH 2XZCH 1GGCL 4BJLA 4XPFH 5BRZD 4LCCB 3TA3B 5DD3L 5C70A 4HDIB 3WYRA 4KUZL 2PTTB 4OLYH 3QNYB 1GAFH 2OQJB 4TSAH 1I3GH 3TZVA 5CP7A 2LTQB 4L9LB 1F4HA 3TESA 3FOLB 1U3HD 2BSSB 3NA9H 5J12C 1NBYA 2WWKO 1C8PA 2HLFD 4EDWH 4TUJB 1LQSR 2CUMA 1UCBL 1SM3H 2CSPA 4P2RA 1EEZB 1QSZA 3SCMA 5F1NA 1G6RA 1P9MC 1T66D 5JOPE 2HTLC 4K55A 1NL0H 5DLML 3WKML 1KB5B 3DSFL 1B6DA 1WK0A 3L3KA 4HX1B 2UVFA 1XR8A 3JXAA 2UZIH 3VW3H 3E8UH 2DM4A 1KN4H 2ERJB 3VCLA 4BK5A 4UBDC 2F58H 2MWCA 4OV6F 4FQXB 2HRPH 3GMPB 4FOMA 5K9OB 3MOAL 4NKDA 5IKCB 5IW1A 4L5FH 1RI8A 3SQOH 3GBMH 5B39A 1YYMH 4UV7L 4NO3A 4CMMB 2OZ4L 5JHDA 1QFWH 4Y4FD 3ZE2E 5E1AA 5B21A 3T0EC 4ZXBD 5JDSB 4HG4K 5I16B 3QJHA 3S3SA 3UZQA 1KXTB 4WHTB 4JE4B 1YJDL 4K9EL 4M1DL 1A6TA 4RFOH 4ODXB 4NM8L 5C0BB 1LMKA 1YY8B 3QDJB 4LOUC 1Z6JT 4YHLL 1OWWA 1MHPH 1NBVH 3MACH 4LPCA 1FSKB 5GGRA 2Y07H 3MLWH 1I7RA 2CDGB 4Y8DC 5ETUA 3SGEH 1G9NL 3TFKC 1MCBA 5C0IA 4YHNB 5F1OB 1A7QH 1OHQA 3LKPB 5C07E 2OBGA 2YWZA 1DP0A 4FQCL 2FYYA 5A2IH 3MOBH 4UU9A 5BRZA 1OAYL 1QYGH 4RA0C 1YN7A 5EULV 3L6FB 2G9HB 3DBXA 4I3SH 3GSVB 5FYJU 3EYVA 5EOQH 1ACYH 1ZMYA 3E1F1 4HPOL 4OZHB 3ILQD 3Q1SL 4NQDB 1MLBB 1FGNL 4X6DB 5FYKU 3V5DA 2VLJB 4F9LC 5EBLB 5DD5L 4LEOB 1N6UA 3KPOB 3OZ9L 3D48R 1U3HA 5C0DA 4ONGL 3WD5H 1PAMA 4EQ2A 2VZUA 1YMMA 2BVQB 3EDDA 5GRYA 4Z7UE 5I71C 3BAEH 2X10A 5HVGB 2EKJA 4N5EC 1P4BH 5GQBA 2A74A 4JGUA 5E7BA 3PL6B 3HZVA 3VXMB 2F5AL 3MRIB 5HHXH 2DQTL 4Q0XH 1K4DB 5SV4A 1UWXH 2J88L 4ZMAT 2R1YB 2Y72A 3E3QE 4CAGA 2D03H 5DD0L 3FQXA 4JFDB 3Q6GH 4L3EE 5JOPD 1N4XH 4BH7A 4YFLI 2X42A 1URLA 1DBJH 4HCRA 1YPZF 5FO8A 1GAFL 2EE9A 3ARUA 3L1OL 4ZXBA 5IBTH 2QQQA 3QWOB 4TSAL 3MRNA 4JR9H 2O5YL 1INEH 3QHFL 5AYUH 5ISZE 4MQ7B 1PZ5B 4UB0H 3HUJB 1KIUA 4U3CA 2DIAA 4GMSH 5FB8B 3LY6A 4PRIB 2H32B 4CN6A 4XBEH 2BY3A 4Z7VE 3DX7B 3BD3A 2J8OA 4S1RH 1T5WA 3M1BB 3VFWA 1JYWA 3DX8A 3QR2A 4NZRH 5GSRA 2VMFA 1NL0L 4PJGA 3U36A 4YHPA 4XC3H 2VDKH 3LQAC 3PGDA 1JPST 3VW3L 3L9RA 2QQNL 4B50A 3KYKH 2ZUQC 3CDFA 1Q72H 2F58L 3ARVA 2VIRA 4TSCH 5IF0A 4I4WA 3QG7H 1UVQA 5GS0C 2YK1L 1EFQA 2PYEB 4DAGL 1R3KB 3QUZC 3RGVD 2HVJA 3D3VB 4ZOBA 5J3HD 3X13B 2CLVA 4IS6B 4ZPVA 4DVRH 2W07A 3FQTB 2ORBH 3ARRA 4E42A 5KAQG 3U4EB 3LKOA 5KW9H 4KU1A 2PXYC 3RL2A 4M03A 3BKML 3OQ3B 1J8HE 1CFQB 5HVHC 2EYSA 2ZCLH 1U8OB 3WO4C 2Y07L 5LBSH 3WFHB 3X11B 3KLDA 1TCMA 5HGBA 3ROLB 1A7QL 5IM7B 4U1IB 1W0VB 2NY5L 1RJZB 1MFNA 2QHRH 1ZANL 5F7DA 3QIBB 5KN5A 3ARFA 3T0BA 2NY4B 5EU5B 4R4BB 5HGDA 3MOBL 3VMOA 1QYGL 4C4KT 2DYPD 3OR7B 1AD9B 4RGNB 3D1MC 4HMCA 3OGCA 4K07A 1A7RL 3O6FC 3VFNB 1FQ9C 4QHKJ 3MLZH 5J9PA 5I1IH 1S9WA 4GXVH 3VXSD 4NNYA 5T5FH 1ACYL 5F3BB 2MTPA 5EUKA 3P9LA 3UYRL 2Y23A 3V52L 3TBYB 2C3VA 5C09B 4UAOC 1F4WH 1IKNA 3WD5L 1GIGL 5DEGB 4WV1C 1JFMA 3EBAA 5DUPH 4HXAH 2Y06H 2MKWA 5JW3H 5KS9E 4Q9RL 1FFNA 1NUFA 3MA9L 2ICWI 3BAEL 3MLUL 4GKSB 3ORJA 2IWGA 3QBTB 2X4OA 2BERA 1JNNH 3BPCA 3OX8A 3SKMB 4ODSL 4O2FA 3QAZC 4D0CA 4F7MB 4ELME 3N9GH 3QFDA 3L3JA 5BJTB 2ZOLB 3ARGD 2WINA 3FZUC 4IBLT 2CGRH 2D3VA 2A1WH 4PRHE 3RVVD 4L8BB 3ARTA 3O2DL 4NC1E 1YYLH 4P3WA 1KYOK 1IGFH 1AH1A 2NY0D 3O2DA 4HS8H 1EBPA 1FYTB 4PRAB 3TLRA 3FN0H 3IT8D 4WFED 4GBXA 3TVMC 3OR6A 4NUGL 5EA0L 5F6HJ 3O4LA 4Y4HC 5DJ6A 3BZFB 3IJHB 1DANU 1BEYH 1OB1A 4JR9L 2R2HB 1INEL 1NC4B 1BOYA 2W60A 4I18A 4JB9L 3BKJH 3F12A 1GPOL 3FQWA 4DGYH 4LMQE 1K4CB 4PYHA 4OLXL 3UJTL 4LLYA 4XBEL 3V6ZB 1MVUB 5DURB 4PJ9B 4S1RL 2B7DT 4TNWF 5HYEA 5DJAA 2A6IA 3G5ZA 1C5DB 2ZKHH 1I4FA 5DRWB 4DWHA 5DD6B 4F9PC 2DYPA 4OIIH 4LKCB 1Q72L 1OF2A 2V5YA 5D1QA 2EC8A 3T8XA 3Q3GB 4QXWA 3HE7C 4TSCL 4U6TA 2Z8SA 4NNPL 4UOJA 5E6ID 3VXSA 3V5HA 3GSQA 3MREA 5I19H 4YFEA 1I8KA 3F7YB 1S9XA 3UXFA 2F19H 1DZBA 5DJ0B 1XF5B 2DQJH 1OP9A 4JM2F 1Q9WB 3OBAA 2KPNA 2YA2A 3MRFB 4K3EL 2NLJA 4PJBB 4QRQB 1DUYA 3AAZB 4MS8D 4DVRL 3TBWA 5AZ2L 1I3UA 5EU3B 4WCYH 1FL5B 1UYWH 3O45A 3CFKA 4G7VH 3T3MF 5KW9L 3IF1B 4GW1B 3DPBA 4PD4K 1NSNH 4N8VA 2DF3A 4UINH 2AXHA 1FCCA 4BQ6A 3EZJB 4Y4KC 3AY4C 2ZCLL 1UKTA 4APQA 4TNVF 5LBSL 4WTWA 4JCLA 3VI4E 3V8OA 5C6TL 3TJHD 3ZE2F 5D7JD 5DEFB 3R8QA 3DRTA 3TWCH 3FRPA 1MHCA 1TVHA 3QCTH 4RFNC 3R1GL 4KKAD 5TH2A 4IHOB 5HHVH 5CZKA 4KROC 3BD4A 2F54E 2VNCA 1WV7T 5ID0A 1CDUA 4JHZA 1J0HA 1G1YA 3IFNL 4FZEL 2I07B 4BFIA 1NGQL 4OLUH 4NCDA 1A9BA 3GHEH 3MLZL 4OLWL 3RWCB 4KZDL 5I1IL 5T5FL 1JP5A 2ZNWA 1P7KA 2OJEB 4M48H 1MCOH 4KQ4L 2VLKE 3IXTB 5JQHC 2X70A 1T3FA 2QQLH 2XIDA 3T4AB 3TN0A 2IJ0C 2WW8A 2Y06L 2ESVB 3DUSA 4M7KL 2V17H 3PP3H 5CBEB 4ODVH 2XTJB 1A9EB 5GSVA 2JCCE 1KEGL 5C08E 2R69H 1IFHH 3K80A 4EI5B 4TVPH 1OAUL 2YPLB 2ZOKA 4G9FE 3N9GL 4PJHE 3GBLA 1ZT1A 5DMGD 4U1GC 3UAJC 5FYLE 1WLHA 2CGRL 3H0TB 4HKXB 4JFQB 2I9TB 4JFHD 2OMBA 4HAGA 5E6IA 1YJDC 5FO7A 4LQ1A 4RMTA 5CGTA 2RJMA 4FQQB 2W0PA 3MBEC 3PHQB 5CJOH 3MGOA 1ZTXH 2WIIB 1LWRA 1QPPA 1BZ7B 4WO4D 1G9NC 3VWJA 5HHNB 2UYLB 1JWUB 3WFCH 3FFDA 4DOHE 3I02B 1BEYL 2RAMA 2V9RA 3X3GH 1CI5A 2VZTA 4XVJL 2W0KA 2P44B 4P2QE 1XGTA 2YPVH 4DGYL 1FNHA 1SBBA 2KQNA 2EDDA 4IMLB 3MUGA 3U83A 5J12B 3S37X 4TQEH 2W91A 1U3HC 5B3JF 3TJHA 4TNWK 2AKRB 4N1EA 2HLFC 5D7JA 1FIEA 2ED8A 3ZDXF 3QULB 5IB4B 5J13B 2ZKHL 2IPKA 1WAAE 4WW2F 4B7LA 3PQYA 2XA3A 1T66C 3KYAA 3G6AA 1BGXH 2YD3A 3L5WB 4TVPD 4XNMB 4ZQKA 2EYTA 5EFIB 1UB6B 1ZSDA 2YXFA 4K7FA 4Z7VF 1F58L 4U7MA 3TBSA 4JKWA 2GITA 5DYOA 1FH5L 1X6NA 5EO0A 4M61A 2PN5A 4QEGA 1AGEA 4YXLH 4XB7A 1EFXB 3DNKA 4AEHL 4L29B 1S7RB 4IRSA 1UYWL 43CAB 4PS4L 4WY7H 3VFUB 4Y4FC 3VXRE 1DBKL 4WNQB 4ZXBC 2LU4A 5A2KH 4Z7NF 4LQFH 1JK8B 1B3JA 3K2UL 1WQVT 3STZB 2VLKD 1NAKH 3OL2A 3C8KA 5F8QC 4N8CL 4TNVK 1D5BA 2H3NA 4XVSL 3PGFL 4Q74A 2GTZA 4WI6A 5I1LB 3RWEA 5I8KH 4O02H 3MLRL 1BFSA 1HDMA 1GOHA 1U8PA 3H3KA 4MXWL 4RZCB 3CVHB 5F7KC 1IM9B 4KZEH 2A73A 4Z7QE 3GGWA 5E56A 5FDWA 3LKQA 4WO4A 3KAAA 1R3LB 4JFFD 3PJSB 4OD3H 5CZVH 4G9FD 3SE3A 1DQLH 4NRYA 1I3VA 2X4QA 4FQHB 4HV8A 1RAMA 1WISA 2ADJA 2X40A 2Z31D 3FB5A 1F11B 2J3SA 2YBRA 1X5FA 1MREH 1R3JB 1PQZA 3AS1A 1T7WA 3WIFA 4M8QA 1BM3L 2ENYA 3ILQC 2P5WA 3P77B 4WFFE 1HSAB 5I8CA 4QYOA 5CP3H 4KUCF 5IJKC 1VCAA 2CDFB 4EOWL 5I71B 4HFWA 4NT6B 3DXAA 5DJDB 1BOGA 1CFSB 2I60H 2R69L 4FTVB 1H3UA 4LSRL 3HC0A 3QO1A 2HJLB 4ONFH 4TVPL 4IRJD 1MCFA 2CLRA 1CE6B 4HMEA 4WEBH 3IGAB 3SKUD 8FABB 2O5XL 5KSBB 3QIUD 2RQ8A 4P49A 1EIBA 1NGZB 2Q8BH 3IU4H 1TMCB 4BFBD 1A7PH 2DLFH 2WP3T 4OM1H 1ADQH 1I9IH 2HWZL 2CK0H 1HYRC 5IMLA 3O3EA 3DV4B 3MYJB 1NLDH 2IFFL 4H0GA 4GXUM 4Y16A 3OKOA 2ICWA 3TP4A 4F2MA 4OV5A 4NO0D 4ODWA 3CDYA 3HC4L 3TNNA 1W72B 2R29H 2NNAA 5KZCB 4FN0A 1F4YL 1G7MA 4OCSL 1MFCL 4KFZC 4PREB 2YPVL 4MAYD 1I9JH 3ARQA 1X5HA 4U1JA 3TGXA 2PW2A 4OUUA 2XA8H 2WY3A 5DZLA 4MQSB 4DTGL 3KPSB 3U9PH 1QHPA 3RX5A 2IBZX 4BKLB 2XG5A 3MV8D 3A6BL 1LE5A 3GO1L 5DJXB 4U1HA 4HLJA 3VXRD 4CW1B 1HHJB 4JFFA 5E94B 5ERWB 3GSUB 1S5HB 2ZUQB 3QDGE 4FMKA 3WUWA 1C5BL 4KI5D 3CD4A 2GHWB 5CILH 4GRWF 4OF6A 1FZMB 5DUBA 2Z31A 3TNMB 4W4OA 3ABZA 1RUPL 3QUZB 1ZA3B 5T5NG 2I24N 2IFGA 3KYMB 2O26U 3QXDB 2OR9L 3RGVC 1CU4L 2DQUH 4ONHB 3IDJB 4H20H 5J3HC 4A6YB 5HGHB 2ADFL 5I0ZA 4YO0B 2V2TA 2V2XA 2H41A 3L3DA 1QSED 2HVKA 4EKXA 2PXYB 4M6ML 4PJCB 3T1WA 2XQBL 3FFCE 3SBWA 3RWHB 1XF4A 5E8DH 4I18C 2I26N 2YUZA 4GQPH 4QOKD 1MNUL 4EQ3A 3O0RL 4ZUWA 5FM8A 5HVHB 3QIUA 2Z4QB 1S7WB 2YPKB 3WO4B 4WI8A 3F58L 3S34L 4OKVB 3RY6C 2XQYG 1BQLH 3P9WB 5I15H 3ROOA 2HKHL 1KJ3L 1OARL 3BKCH 4NO0A 5E5RB 4CU6A 3G6JA 5EC1A 4PJAE 3HPJB 4WJ5B 3JTTA 4K7PX 3SPVB 1PY9A 2ZCKL 3O6FB 4CBPA 2EH8H 4PJXA 2ZUYA 5DXWA 3CFEB 3VFOB 4NO2A 1WZLA 2Q1EA 4X0KA 4GG6F 4E0RB 4A2LA 5JOFB 4ZD3L 2CRZA 4UAOB 5KANG 2FO4B 1L6ZA 3RWIB 1I7ZB 3OG6B 4WV1B 2J8UA 3E3QC 4DZ8B 4HUXB 1NJ9B 1CZ8L 2W0LA 2NX5A 2XZQH 2QKIA 4P59H 2I60L 3MV8A 1REIA 2BX5A 1MQKH 3HMXH 4ONFL 1NUGA 4AIZA 1NBZA 1RZ7H 3QAZB 4WEBL 2UWEE 5K59F 4HUKB 2BSRB 2NW2B 1IEBB 3GIZH 3S36X 4WTZA 5C3TA 4QRPB 1RIHL 4U1SB 2DLFL 1JPGB 3ARGC 4NKIH 5IB1B 3FO2B 4DQOL 1EXUB 1ADQL 4QHKI 4YUEL 5HYJB 5JPNB 4JZJA 2CK0L 4LIQE 4IMKA 3BZ4B 5F7EH 3RVVC 1ADQA 4MNGA 4OD1L 3VXUE 1LP9E 3TVMB 2ZUVA 4Y4HB 2NY0C 1TQBC 3H8NA 3QDGD 4K7PL 4C56D 2XZZA 1QSEA 4YIQA 1UM6H 3EO9H 1T1XA 1HSBB 4JFED 1I9JL 2AJYL 5SWSE 3LEYH 3REWA 4QOKA 3T4YA 4J8RA 5I8EB 2CRIA 2R4SL 4LRNL 2EIDA 3VXOB 3ARBD 2HFEA 1T04A 3FQUA 4X9HA 5EWIH 1A7BA 3NABH 4OZGA 1IC4H 4E41B 1G7JB 3I6KB 3PP4H 1FIGL 1KV3A 5BQ7B 3FFCD 1NFIA 3DO3A 5GGSY 3LV3A 4Z76B 3NOIA 3GSNL 1A0QL 5IFJB 3HE7B 3QB7C 1CLOH 1GH7A 5F6HI 3S36L 4M9OA 3MV9B 1JZ7A 1KPUA 2HJFB 2VLRE 5DZNA 1DVFD 5E6IC 3OAYK 5C0EA 4JG0H 5HYQB 1D6EA 1R5IB 1WAAF 1LO3H 4WI5A 2DQUL 4LSPH 4JY5L 5CCKL 1FLTX 4X7TA 4MS8C 1ZVSB 2D7OA 2DI7A 2VDOL 4G3YH 5FUZH 3I3EA 1JE6A 3CX5J 3HZYA 2BDNL 3RNKA 3SY0A 2B0SH 4Y4KB 2A38A 5CP7B 1FZKB 2VXQL 1JGDB 3H9SE 3WNOA 4MB5A 4CADB 4OQTL 1BQLL 4FP8H 4RFNB 1MAML 4LPVA 3SOBL 3KYNA 3TJHC 5CD3B 5I15L 4P2RB 5D7JC 4OB5H 4KROB 3K74B 2ZP0T 2V5RA 3H9HA 4KKAC 3NZ8A 3L3KB 1XR8B 3HAEH 3BRGC 3SDAD 4OCRH 2P8PA 4C56A 1FZJA 2VN4A 2YRLA 3VCLB 4RISL 3IFLH 4QNPE 4JFEA 3IKCB 1MCKA 5GGUA 1QRKA 2AV1A 1N5YH 4H1LG 5MP6H 1A7OH 4PGDA 3UTTE 4NKDB 4XPAL 5IW1B 3MODH 4Z7QF 3NIFF 1AGFA 2ICCA 3BP5A 3HN3A 5D8JH 4OQ1A 5B39B 1DBAH 4NO3B 5SWZE 4LBEA 4YAQA 4MLSA 4N8PA 4NJAH 5JHDB 3V79C 2VC2L 5IMKA 4U1MA 4PB0L 1FFPA 1MPAL 1RZ7L 4YWGH 4P4RB 2BVTA 4Y7MA 1HINH 3HMXA 3GSOB 1IGIH 4X4XA 1DLHA 3AXLA 1WT5A 4XCFL 1DQQA 5DMGC 4YNYA 4NKIL 1JUFB 1UQSA 2P7TA 3O6MH 2JK5A 1J1OH 2G2RA 5GGRB 3NIGE 4HQQH 5F7EL 1K85A 5C0IB 3MBEB 3H42H 1B2WH 4K3JH 4MD4A 1HQ4B 1K8IB 3B5GA 4Z77B 3BQUA 2B1AL 4JPVH 4LKXB 3TT1H 4PTTB 5C9JA 4NRXA 1I1AA 4NHUB 1CR9L 5L88H 4WO4C 4Y5XA 5BRZB 3VMPA 1ZS8A 1UM6L 3SE3C 3ZKMD 5ESAA 3O4OC 3WDHA 3EO9L 5CJ8A 1KXVC 2NYYD 3EYVB 3LEYL 3AROA 3V5DB 1K5NB 3KLAB 4FFYH 3C6LA 5CHNA 3AFLA 5E2TH 1U3HB 5C0DB 4OCWH 4AIXA 3V2AR 4LPTA 4RAHA 5EWIL 5D1ZD 3VWKD 3GHBH 5DC9B 5DQ9B 2VXVL 1E6OL 1RUMH 3H3BC 1QRNA 2MMXA 1IC5L 1KENH 2A74B 4LU5H 5E8NB 2Y36L 3FAXA 3P0YL 1KFAH 5C86A 1X6LA 1SVCP 4LGSB 3SDAA 4M00A 3RGHA 5IEHA 1YUHB 4PFEA 5EZLA 1CLOL 5CEZE 3VRIA 4LIQL 2P8MB 4WFHD 2YUWA 4XVUD 1MWAH 2O61A 2LVEA 1T1WA 1CYGA 2VR5A 4JG0L 2BNRE 5J06A 5E7FA 2OR8A 1IGYA 3CFCH 4LSPL 1T5XB 3UTQA 2HAZA 4JQIH 4JY6A 5CGMA 5J4MA 2BSTA 1Q0XH 1U2HA 1WFUA 5CSGA 3IXAA 4Y4FB 4NCC2 3FN9A 4G3YL 4RGOH 4DVBA 5FO8B 4ZXBB 4PRPE 1HK6A 3RY4A 3MRNB 4NQTA 4OF0A 2I5YL 1MEXL 4YHOH 1C5CH 5TFSH 2B8OT 1T1ZA 2F74B 3RVXD 1EEQA 1A22B 2ENSA 3UTTD 3U4BH 5IFHH 3T2QA 2R2CA 1P84K 2DAVA 5E6YA 3ZT6A 2ITCA 1T5WB 3FB7A 3VFWB 1RULL 3Q0HA 2Z35B 1A1NB 3WCYA 4PY7A 4PJGB 4RSVA 4YHPB 4H88H 4OCRL 4YQXH 3AMKA 4W6WB 3L9RB 2H1PH 2DI9A 1IT9L 1LQVA 1DEEB 3IFLL 4PBWD 4JPKL 2VIRB 4BQCA 1G7QA 5CKGA 2HFGH 3B9KD 4I4WB 5DTFB 5IF0B 2F8XC 1UVQB 2Z31C 3BDYH 5C0ND 1J12A 4W4OC 4I0PA 1LO4L 1A7OL 3U6RA 3LZFH 3MODL 1JI1A 3U30C 5E2JA 2DQHL 2HVJB 3T0AA 3KR3H 4QTHA 4D9RE 2CLVB 5FV1L 2A9NL 1ZLSL 3VWKA 3ZKND 3F7VA 3VRJA 4F8TA 3OB8A 3PE9A 1YPZA 4X5WB 4YWGL 1HHGA 3BGFC 3LKOB 4IRJC 4N0FA 2DJ4A 1OTTD 1C1EH 3UDWA 1CF8H 3QIUC 2EYSB 1J1OL 5DHYB 4QHNA 2C3XA 1L0YA 1J0ZA 3IB4A 5I1JH 2DLGA 1OSPL 4PLOB 5HGBB 4K3JL 2D7NA 3C2AL 5CJXC 1QFUH 1V05A 5F7DB 2VXTL 2X4UB 4JDZA 2VQ1A 2GW5A 5HGDB 1KT2A 2FZ3A 2XRAH 5IB5A 2DKUA 3B8YA 4LNRB 5GS1A 3OGCB 1SYSB 3QZWA 1DUZA 5D2NA 1S9WB 3BHBA 1S9KC 4F58H 4NNYB 1MF2L 2P8LA 4MHHG 5EUKB 4LGRB 1AJ7H 4MAYC 1N7MH 2H6PA 1KCSH 5L6YH 2VDQL 4OCWL 3UEZA 4LVEA 4P99A 3QI9D 4EVNA 3OJVC 1BBJA 4MVBA 1Y18A 1FFNB 1H3PH 3VDAA 1MI5E 3WLBA 3C5JB 3X12B 3D0LA 2J5LC 5JQ6H 4BUHA 1UB5B 2X4OB 4JG1L 4L8SA 1S8DA 2OK0H 4NCC1 2E6PA 3GJEA 3OX8B 4O2FB 2R0LL 4AEIL 1UFUA 3NGBC 5L2KA 5E2UH 4MZ2A 1CFTB 3J8F7 4ZOEA 5DHVB 1ORSA 2WINB 5BVJA 1AKJB 3RKDD 4KI5C 5IMMB 4Y1AD 5SX5K 1QOKA 3B8SA 4HLZH 3B9KA 4LAJH 4KGLA 5I1GL 1MIML 1MWAA 4EI6A 5EZOL 3M17A 1WBZA 2EDTA 3AM8A 2PO6B 4JZJC 4UI2A 5GRJH 4D2NA 4JQIL 3RGVB 5C07B 1HKLL 2R2EA 5HTSA 1Q0XL 4PJDE 4TN9A 2DWDB 4CNIB 4PP1D 1N59A 1X4ZA 4JRYE 3VI3F 4K8RH 4TOYH 1JPSH 4RWHA 1NCBH 3L3GA 1P1ZB 4I18B 1JHKH 3F12B 4OGXL 3WV0A 1Z2KA 2IG2H 3FQWB 4PRDB 4EDXB 1OY3B 1VHPA 4NHCH 1HKFA 4JM2D 4DGVL 4HIIB 1E4XL 4PR5A 3RQ3A 4D9RD 1MFEL 1D5ZA 2AK4E 3D0VA 3EFDL 1N8ZA 3O9WD 4N68A 4L4TE 2DL9A 3G5ZB 5DSCA 1I4FB 2IQ9L 4XH2A 4BQBA 4H88L 1KCUH 5F1IB 1M7IA 1OLLA 4R26H 7FABL 3RI5F 2X4SA 3ELAT 1FPTH 2DYPB 5IVNA 2QQKH 4HIJB 3QXVA 2EDYA 1OF2B 5GRVL 4K71C 3T8XB 1EHXA 2HFGL 3VXSB 2JJUA 3C5SA 5DRZA 3V5HB 3GSQB 4MJ4A 2AJVL 5JPMA 1F8TL 3O3AB 3OKKA 1LEGA 3WNPA 5EDXA 4NQSB 4HSQA 1F3JA 1I9RH 3PIQA 1HXMA 4ZSOA 1SBSL 1DUYB 2CO6B 3OKNB 5BW7C 1FV1B 1Q9KA 1TENA 4HZAA 3HMWH 5GISH 4BSJA 5DQJA 5F72S 3WNLA 2R0WH 4K8RD 3RIFF 3HPLA 4P4KD 3CFKB 4NM4L 1M6OA 2UY6A 3BDXA 4UDUB 3GMLB 1KGCE 2AXGB 4RBPH 4N8VB 4D0DA 4M62L 4AG4H 1HE7A 1RFDL 3HI1B 3ARGB 4JCMA 3WXWL 1F00I 1HI6A 1L9NA 2AEQH 4LCIH 4TUKH 1BJ1H 2R2BA 1FG2A 1VESA 4Y1AA 2VDMH 4ZDHA 5JIPA 3DRTB 4NN7C 3Q5TA 1AP2A 2IBBA 5TH2B 2IQAA 2NY0B 2XRAL 1TQBB 5JHLL 4X6CF 2X4RB 4I5BA 2AEPH 2FWOB 2OR7A 1U8HB 4HKJA 1UZ6E 3CZFB 5T3ZE 5BCAA 5JXAH 3C2SA 2R9HD 1NFDF 3MRBA 3DRQB 5DA0B 1TZHB 1N7ML 1KCSL 4L3CA 2X70B 1T3FB 3VG0L 4JM2A 1PKQA 3CCHA 4R3SA 4GRLD 4R8WL 1CDBA 3ARBC 5JQ6L 3O9WA 2LE9A 4JRYD 2E5EA 1CXIA 4ETYA 5GXBB 4Q7DA 1FNSH 3LB6D 2ZOKB 1R3HB 3O3BA 4ACPA 1BHGA 1ZT1B 2FIKA 1FG9C 3A6CH 4LHUG 1YEGH 1ES0A 2GJZB 3HFMH 5EZJB 3ZE1E 5I8OL 5IIEA 3C9NA 5E6IB 4HUUB 3VXNB 2W9EL 1B0GB 1IQWH 2FD6H 1DVFC 5GRJL 2AK4D 2EH7H 4JVPA 3EHBD 2GAZA 2DQEH 1ZOXA 5D7LE 3RBGA 3MGOB 4GKZA 5I2IA 4K8RL 4XI5D 3WJLC 4TOYL 1JPSL 1EO8H 3SN6N 3U46A 1N3NA 1NCBL 2MSPA 4P4KA 1P2CA 1ZA6A 4O2EA 2QHLA 1KULA 1A1OA 2ITDA 1XGTB 1E4KC 1MFDH 2Q20A 4NHCL 3W81A 1EO7A 3MUGB 3QCUL 5E00A 4UNTA 3D87B 3C6LC 5HYSB 5I30L 3STLA 4QWWD 1DLFL 5KOVC 4WWKD 3RL1B 5T1LD 2PR4H 5D7JB 4PJFF 5C0RL 1V3MA 4OZFH 2IPKB 3G08A 1HQRB 5DK2A 4X6EB 4FFZH 2ARJQ 3RI5K 4R96B 4HJGA 3G6AB 3GNMH 4ELMB 2XG4A 5FYKE 1AGDB 4QRRE 4XHJD 5IHZB 5DMKA 3SDAC 4KY1L 2DQDH 3OPZH 4R7NA 1LO2L 2VABB 4JDVB 1JZ3A 1RV6X 1SEBA 4OTXH 3WIIL 1AY1L 1NC2D 5E95B 3QEGH 1X44A 4PPTA 3FT4A 4FMFA 4P5KA 1D6VL 4M61B 4GRLA 2HG5A 3T1FA 3ARZA 3LQZA 3MGTB 5LCVL 3NAAH 3VGFA 2ZPKL 3CU1A 4H0IA 5DFWH 4C58B 5HI5D 4GLRI 3TYGH 3UROR 3RIFK 4PGCA 3ARDD 4RCAA 1K6QH 3U1SH 3S5LA 5CIPH 2NTFB 4PUBH 1QLFA 4EN3D 5DMJB 1QSFD 3JWDH 3JWOH 4U6YA 3C8KB 1BREA 2AP2A 3V5KB 1D5BB 2OSLA 4UT9H 5CD5D 2VDML 4KUCD 2GTZB 1I85C 2EECA 1WICA 3RWEB 3SJVE 4PRBB 1HDMB 1U8PB 2OL3L 4LLDA 2A73B 3QO0B 2GKIA 4WW2A 5H35B 1CLZH 4WO4B 1VKXB 1JF1A 4LCUB 5HHOE 3ULUF 2AEPL 3ZDYE 5DRNA 1M05B 3O4OB 4NRYB 1HHHB 2DLHA 3ARYA 4GRWH 4MX7A 5T3XE 4NP4H 2X4QB 2VAJA 3ZKMC 1U8KB 4Z7VA 3F7QA 2ADJB 3MJ9H 2FECI 5C92A 3OAYH 1LK2A 1F6FB 1OD7A 3I2CH 3IETA 1UJ3A 2NYYC 2DRUA 2WWKT 5I18H 3WIFB 4M8QB 1IGMH 1FVEA 1IQDA 4UOW0 4WU7A 3WJJA 4QYOB 35C8L 2YMXL 4ELKA 1KLUA 4JFYB 2HJKA 2K1MA 3B6SA 1B0RB 1X5ZA 3DTXA 3G5YA 5D1ZC 3VWKC 3QO1B 3SE8H 5ACZA 4XGZA 3STBA 4PJ5D 5D6DA 1TTGA 2CMRL 1C7SA 3ZSTA 3QEQA 5LXGL 4QY8B 3TYFA 2AQ3A 3HS0A 3UDWC 4NQVA 4XVUC 5TE7L 1T2XA 2FD6L 4AT6A 3P4LA 4R0LB 1NC2A 1MCHA 5IMLB 2N56A 4Z95H 5D71H 3OKOB 4F2MB 4OV5B 2BY2A 4ODWB 3TNNB 3BD5A 3ZT5A 4X99B 2F54B 2NNAB 2ZWLT 1I1CA 1WSST 1MCRA 3VD4A 1MCPL 3ARDA 4U6HB 5GS1C 5TF0A 3Q6FA 4KAQH 5F7WC 5D2NC 1GGIH 1MFDL 4YBHA 4EN3A 1QSFA 1RSFA 3IDMA 2VLKB 3CSBA 3O11B 4LF3A 4D9LH 3RVXC 3X14A 1OL0A 5EBMA 3VH8B 1WCQA 4XWGH 2PR4L 3ZDZE 1AIFB 1YECH 4XAWH 2ZSWA 5JMRA 3QQ3A 1JGEB 1Z9MA 3CAFA 3QXUA 1LE5B 4HW6A 4U1HB 4HC1H 1QA9B 4OZFA 3QPXL 4JFFB 1S7UA 3GNML 4G6KL 3SDXE 3WHE0 3OF6D 4L8SC 3WS3A 1RK1A 4G9FB 2QADD 1RZFH 4LSDA 3DECA 2Q8AL 3WUWB 5MEND 2DQDL 3BN3B 2FGWH 2ICEA 2M2DA 4F7CA 3IJSB 3RX7A 3U30B 4N0UE 4YK4C 3B9KC 3P9MB 5C0NC 2YN5A 2I9LA 1I1YB 3AM8C 3RA7L 3MRHA 2XNAA 1DQDL 4MA8L 5FYLH 1FNEA 3QXAB 3MCKA 3U2SB 4DKAA 1CK0H 1KJ2H 2NZ9D 3O2VL 5HHOD 4YXKH 1MCWW 5GGQH 3TYGL 2V2XB 3DYPA 3BGFB 3ULSA 2BNQD 5DK0A 4L1HA 3ZKNC 2HVKB 3WLWD 1H5BA 5KJRH 4IRJB 4WUUD 1H3TA 2UV3A 4PUBL 4PJ5A 3JWDL 3JWOL 1KUMA 4P2QB 4ZUWB 5CIPA 3QIUB 2N7BA 3S6CA 1F3DJ 4UT9L 1KN2L 4X7EC 1OTTC 3GJFK 2IAND 5HI4D 5B38G 4KMTH 4J6RH 4EUPH 4BZ2L 3AGVA 4B41A 4G5ZH 2C4XA 4ZUTA 4GLRH 4UT7L 1BWMA 4KJYA 4HXBH 1TETH 5KVDH 1A6WH 3HZKB 5EC1B 4S2SA 4YHMH 1HZHL 1MY7A 1CDYA 2CKBL 4ZYKA 4XCCH 2YOCA 5DDHB 5K9QG 1QLEL 3I2CL 4MAYB 4X0KB 1N0XH 3WS6C 5I1AB 3MJ9A 3SE9L 3UPRB 4QXUH 2J8UB 1OPGH 3QEUA 4ODTH 3BH8A 2RFXA 2UUDK 4JFOB 1KCRL 4ZNEE 1FORL 1B4RA 2J5LB 1RK0B 3QI9C 4I9WD 4LLVA 4AIZB 3VXRB 1T2QL 2YUXA 5IP4A 1RUQH 3NGBB 1KEMH 1W0WA 5ALCH 1HEZB 5IOPA 3T0DA 4DK3A 5MENA 1VFOA 2MPAL 1ERNA 5BOPA 5L7XH 5C0BE 3RKDC 4JZJB 2BOBA 3EAKA 2HTKD 1A6AA 1RZGB 4MNGB 4Z95L 5F93C 4NYLB 4WHYG 3DURA 3QUMH 1SEQL 2QTEA 5AEAA 5GRUL 3R06A 3A6OA 3O41B 3OXSB 3SKOB 2X4PA 4PP1C 1NGYA 1QSEB 2BNQA 4NPYB 4YIQB 4I3GA 1T1XB 2ZUXA 3LN5A 4U33A 4WUUA 2R1WB 3MXVH 4LLWB 5GRWA 4GG6A 3REWB 4QOKB 4GW5B 2E9IA 4WW1B 4J8RB 1C12B 5EU6D 2NW3A 2VLJE 4EBQH 4KRPD 2V9TA 2F8VA 2IANA 3UYOD 4JM2C 1UWEH 1MHHA 1CGYA 1NDGA 4W4NA 3O9WC 2VQTA 3QUKB 4HC1L 2BCKA 3QQNA 3MMEA 1BJMA 2JELH 3P4MB 4TSBL 5JW4R 2H9GA 1UACL 1RZFL 2CXKA 1SY6H 4HC1A 1VGEH 1L6XA 4K71B 1U8NA 4WFGE 1KCGC 1ZGLP 4HGMA 3MNZB 3GSNB 1YEHH 1JPFA 4AEFA 4F33B 3QJFB 2ZJSH 1QR1B 1XGRB 1XH3A 1CFNA 2EZ0D 5K93A 1E27B 3C09C 4QXGH 3FONA 4U2YA 1ZVHA 4WI3A 1KIRA 3MNWA 2FR4A 1CK0L 1KJ2L 5I1DB 4P3DA 1F2QA 1KJ2A 5FHAL 5FXCH 1NDMB 3HZYB 4K8RC 2A77L 4JHWH 4NOFA 3RNKB 4P4KC 3SY0B 3VG9C 1RZJH 2BJML 4M7LH 4AMKH 4WI9A 2WUBH 3HUJE 4JY4A 4PRIE 3P40A 3B3IA 5T5NF 2EXWD 4NN7B 2AQ2A 1YDPA 3JV6A 4EUPA 2V7NA 3OKDA 3HA0A 1TETL 2W0FA 3BP4A 1PFCA 3NZHL 4M7JL 1Z3GL 2VITA 5T1DH 5TQ0H 4EIGB 1X5YA 3W9EA 1AQKH 3CUPB 2DD8L 3KWWB 4A2MA 4Z5RA 1KCVL 3QDGB 1CGVA 4C56B 3MJ6A 4OI8A 4N0YH 4PGEB 5DFVD 3UTSA 4LLAA 3BYYA 1MFAH 1I8IA 4KJWD 1KOAA 3BVNA 2R9HC 5B39G 2D0HA 5EU6A 4PGDB 4MXVF 2DOCA 5DWUL 4ODTL 1AGFB 5TF1H 4XPTH 3IAQA 5E4EC 3ARBB 2Z91B 4UIKH 4GRLC 4O4YL 5T1MA 5MEQB 3RUGE 3FCTA 3PWJA 2DN7A 5CJBA 4LLQB 3MCG1 1XR9A 4MMXC 1RJLA 4F7TA 2NY3D 2ZSVB 1Q9LA 2FECL 3KNBA 3LB6C 4NUJB 3FFCB 2IAMB 2QSCH 4MA7L 3K7UA 5KVEH 1UWGH 4X4XB 1DLHB 1QQDA 1YNLH 3MX0A 1BFOB 3C08H 3LRSA 3JV5A 4YNYB 3FRUB 2P7TB 2JK5B 1RZKH 3S4SA 5FK9A 5EU7E 1DVFB 4HWEL 4YHKH 3KJ6H 4MNHB 2AK1L 4FQIH 3HRZB 3GRWL 1R5VA 2GQHA 4I13B 3PABB 1CT8A 4MD4B 2F53E 2FL5A 5BO1H 3S88H 1GL4B 3GRWA 4K2UH 3EHBC 3WNMA 1N64L 4FFVD 4PJIF 5C9JB 4NRXB 1Q9OB 1XCTA 4PJAB 4WW2C 3OHXB 3QUMA 3BP6A 3BXNA 4W6YB 4XI5C 4RGNE 1DFBH 1FAIL 3JUYA 3FB8B 1UJ3C 4R4FL 2J2ZA 1IAKB 5C09E 2VWEE 5TDPA 3IFPA 1UWEL 1V3KA 4NDMA 1FGVH 1JZ6A 3DIFA 4QWWC 1J1PH 4FQ2L 4WTXA 4WWKC 5IB3A 3FOMA 2BK8A 1QNZH 1WZ1H 5D9SB 3PWLA 2MCPH 3BW9A 4PLKD 1DQMH 2J12B 4XCYA 3BRFA 4HGWA 2N4IA 2Q7NA 1F6AA 3SDAB 2Q86A 5I1EH 3D18A 3UPAA 1SY6A 2P43B 4ZODA 2P1YA 5D6DC 5EZLB 3UP1A 4XHJC 1FBIH 1XGQA 4P5MA 4ZS7H 5IQ9A 3KG5A 1T1WB 1L7TH 4XNXL 3UTOA 5J57B 4CVWA 4L4VE 4OD2A 1JJUA 4JO4L 1BVLA 3LCYA 4PB9L 3B9VA 3W5NA 1GJIA 5DT1H 1T6WA 1NGWB 3EO0A 1LP9B 1T21B 3IXAB 1NCNA 4F37F 5L8KB 2PTVA 5D7SL 4DVBB 1RJYB 5HI5C 3WL9A 5HSFA 3EOTL 3ARDC 4I2XA 1GGTA 3I6LD 3PV6B 1Q38A 1T1ZB 3VFPA 1CXLA 4HS6A 1RD6A 3LVEA 2JJSC 3ZKXC 1D5MA 4EN3C 5HYFA 4PRNA 3RPIA 2JJWA 4P46A 4YDKH 4ETQA 5CD5C 5LGHL 2ITCB 2EDEA 2WK2A 5T1DL 4TYUA 5HVWA 5C7XH 4PY7B 1EMTH 1IAIM 3MRPA 2VE6A 3KPTA 3MLXH 2OI9C 1QSVA 1CGSH 1IBGH 3VXQA 5T1KA 2M26A 1S9YA 5I1HL 3TT3L 4V2CB 1ZLVK 1KC5L 1RU9H 1SJEA 2VLRB 4X4ZA 3W2DH 3EDJA 3GMMA 4FXGA 2ADGA 3U6RB 2DLIA 1G0DA 5TF1L 1CD0A 1FDLH 5DVOA 1OQXA 2Z93A 4QTHB 1YEJH 3BIKB 2Q87A 2QSTA 1BX2A 5DFTA 1HIML 5D1ZB 3VWKB 5F96L 4RDQG 5D7IE 1A3QA 4WEMB 2YZ1A 4M5YH 2VISB 3VFMA 3X3FH 5KVEL 1FO0H 3AU1A 4BYHA 1H5BC 2EDLA 3UJJL 1B88A 4D0BA 3MROA 2LAGB 2FJFB 5DJ8A 1OAQH 1RZKL 1BECA 3JSSA 3RTQD 3JWOC 3JWDC 4V3EB 3NBNA 1RZ8B 3KPQB 4AENB 4BQ8A 3M8OH 4BM7A 4MDIB 4K2UL 1WWAX 2VTFA 5KVGH 5BV7H 4JDZB 4XCNB 3FN3A 3VXPB 1PD6A 1KT2B 4XZUA 25C8L 5IB5B 1M71A 1MAJA 2E27H 3QDMA 5GS1B 1KB9J 1GZQA 3QZWB 1MLCA 4NWUL 2ZG1A 1P5VA 1DUZB 2XFXA 5D2NB 2AQ1A 5J1SC 4HFUH 3JV4A 3SKJH 2P8LB 4DGIH 1S7XB 2X9YA 3B2VH 4L4VD 1GSMA 1MUJB 2FJHA 5EZIL 3QXTA 3BT2L 1JV5B 3UTTB 3VU2A 3LH2L 4KTDL 1CIUA 3FB6B 3HTLX 4LVOC 4QHUA 5TDNA 4HUNB 2J4WH 3D0LB 4ORGA 4J1UB 1BVKB 2XTJE 1IGJA 4CVZA 2O5ZH 4L8SB 1S9VA 1LEIB 1AXTH 3GJEB 4RRPA 1X5AA 4MJIA 5IGXH 1BPVA 5I1CL 4X6DF 4OZHF 4G8IA 1BFVL 2IH3A 5F70A 4DUWA 2QADC 3EDFA 4KVCH 1I3RA 1CFVH 2DM2A 4M3JA 4YK4B 3B9KB 4EI6B 2VDRL 3M17B 1WBZB 4E5XA 4XMPL 3RU8H 3LIZL 1UZ8A 3GUTA 1DCLA 2R2EB 3PHOB 5BVPH 1EJOL 1NMAH 3LSOA 4S1SH 4F37K 2V6HA 3VRLF 3CMOL 5LQBH 1N59B 3D5OF 1BAFL 2E9WA 1QFWM 2NZ9C 3HNSH 3HLAA 3WXVL 3RZCD 3L3GB 4V1DD 1NCAL 5DZOA 3EGSB 1M1SA 4BFGA 3WLWC 3I6GA 2E9JA 5DEZA 1C16B 5INCA 3RWDA 1WC7A 3U7WH 1KELH 1DTUA 1NEUA 2BVYA 1YY9D 4IDLA 4XCEB 5FFLA 5I75C 3BE1L 2JB5H 3QRFM 4PR5B 1QBAA 5ESQA 1BVZA 5HI4C 1SYVA 1D5ZB 2FLBT 1N8ZB 4CN1A 1UG9A 5DSCB 2W65A 1OGAA 1P4IH 4XH2B 3V4VH 2UVEA 5SWSA 3WFZA 4X6FA 1ETZB 3KYOB 4GAYA 4JQXA 2WNGA 4OCYH 3NH7L 1DQTA 4U4BA 4GKOA 5KOMC 3OKYA 3K4ZA 1S7SA 3W2DL 5EN2A 5F7FA 3C5SB 1CGTA 5DRZB 3MJGX 5JPMB 3ULVF 1DL7L 3OKKB 5CAYB 2BNRB 1PVHA 4FNLL 4N9GA 1FDLL 1J5OL 3TV3H 1F3JB 5JORA 3QI9B 2YSSA 3V6BR 1KSRA 4U0QB 4Q9QH 3T0EE 4M5YL 5BZDA 5JIIA 5A2FA 4N8VG 4M4RA 4PRPB 2D31B 1BD2E 1A6VH 1GC1H 5CWSB 1AGBB 2J6EL 3RAJL 3KDMA 2Z8WC 3ETBF 1FO0A 5FO9A 1IEAA 1TVBB 1HI6B 1EEYB 1VPOH 1CLYL 3FRPG 4Y1AB 2DM7A 2Y4SA 2NMSA 4RNRA 1IGCL 2EIEA 1MCJA 1TCRB 1QD0A 1DR9A 3UTZA 1AP2B 5KVGL 2HTKC 3ARED 2FEDD 5EH1A 4JPIA 1CS6A 2IQAB 2MNUA 5DJ2B 3IDNB 5GGTH 5KTEL 4I5BB 4XXCC 3QPQD 2D7MA 4N0CD 1INDH 4U7SA 3RZCA 1HWGB 4G8GD 5DD1H 4AL8H 4V1DA 4D3CL 3PWVB 3C8HA 2VXUH 4DGIL 3RP1A 4ZFOL 1VACB 4L3CB 3VE0B 4LHUD 1U8MB 3K3QA 4JM2B 1PKQB 1WF5A 4ZFOA 3N06B 5JW5A 3MUY1 4OGYH 4KRPC 1KLGB 5TDOA 2J4WL 3O9WB 1WTLA 1T89A 1VENA 3C6SA 3GI8H 3MLVL 3MV7D 4G42A 1T7XA 1ZLWK 2GK0A 1YMHA 4FTVE 3L7EB 1YA5A 3O3BB 4LFHD 5CLTA 1CICD 1HH6B 1QHOA 5IW6B 2R0KL 3UO1L 2FIKB 5IT2L 3H9YA 5K9JL 1DEDA 1M7XA 1PY4A 4KK5D 4FQLL 1P7QA 3C9NB 3U9UA 4Q58C 4WEUD 4ZO9A 4UUJA 1Q1JH 3HZMB 1UM4L 3TIDA 4ZO7A 1AE6H 1X3DA 3C09B 1XIWD 1JWMA 3OAUL 4P0DA 3THML 1E6JL 2GAZB 2MKLC 1L7IH 1WBYB 2EZ0C 4JFPA 4NNXB 2HTLD 4GKZB 3ULUH 1NMAL 2E3VA 3QIWD 5I2IB 4JANA 3TPUE 1GVIA 4X6CA 2XWBA 3OJ2C 1N3NB 1EAPB 4UILH 3UX9B 1KPRA 4P4KB 3ARWA 3I50H 1VERA 1TZIA 4FQJH 5FIEA 1ZA6B 2RGSA 4RMRA 5DS8A 1NFDA 2NXYD 3VFRB 4M43L 1CLCA 5E00B 2JB5L 2UUDH 4AEEA 4JKPH 4K94H 1UXSB 4KQ3H 1UXWB 2EICA 4NZUL 4KJQD 1ED3B 3MFFA 2KH2B 2EXWC 2BC4A 1JI2A 3PWPD 3CVIH 1Z0NA 4X7FC 3K2MC 5LGJA 2VJXA 1BD2D 1KTRL 1ACZA 1DSFL 4HJGB 3O6KL 4M6OH 4G80A 4PG2A 4LCWD 1BIIA 2H8PB 4N0CA 4JAMA 4JPWL 4EIZC 2BY0A 4G8GA 5H8DA 2FSEA 2YEZB 1J88A 1R5WB 3H7BA 4OFDA 4UDTA 5DFVC 4ODBD 4OT1L 5E4EB 4KJWC 5D96C 3TV3L 3V4PL 4OLVH 5FOBA 4GRLB 4OSUH 4BZYA 2HG5B 2EYRA 2FX8L 4PJDB 4Z7WA 2LVCA 4NQCD 3P4NB 2P24A 4DEPC 3Q5OA 4Q9QL 3MJ7A 3MV7A 1YEIL 4JRYB 4OZIA 4OZ4A 4P9HL 4PGCB 1OQOA 3FT3A 3PWUB 2NY3C 1U3YA 3S5LB 3MBXH 1T83A 4MDJA 3X17A 5BMFH 3GMOB 4U6YB 3HC3L 1U95B 2H26A 1U8JB 3BEVA 2D9QB 4ZTPH 5EOTA 4PJBF 4ZUUA 1VA9A 1OAZL 1XIWA 2AK4B 3RWGA 4MWFA 4PJFA 5KSVA 4LLDB 5C0CD 4L4TB 2ATPA 4YDLC 2F5BH 3EDKA 5TPWL 4WW2B 2OL3B 4YHIA 2P49B 5FCUH 3IDIA 3MRRA 4FFVC 5DRNB 4LSQH 2AJSH 2D2OA 3EFFA 5GGTA 5EIIA 4RQQA 1CDGA 4AL8L 1MJ7H 1KTLB 3PXJA 2AXFA 5C71A 5JR1H 2DDQL 3TO4D 5D5MF 1TJIH 1UJ3B 2EE3A 4DFIA 5FEBA 2GCYB 1IQDB 4YGVA 3OAZH 2VLME 3DVNA 1UM5H 1KLUB 4U7KA 2HJKB 4XMLH 4G8EA 4WWKB 2MFNA 3K0WA 5T1LB 3GI8L 5HDQL 4Y5VA 1HH9A 3VD5A 3B6SB 3G5YB 3PWPA 1VFAB 1U8LA 3DTXB 5A16B 5ACZB 1I8MA 1NUDA 1FAKT 4XGZB 3DSNA 1TJHL 4LCWA 5IVXF 5C0JA 4PLKC 5MHSE 3G5XA 1FVDA 3TYFB 1DN2A 3MRJB 2BRRH 5GGVL 2VL5A 5EPMB 3R0NA 5JMOC 4AT6B 5ICXA 3W11D 4JGMA 4S0TD 3ZHDA 1NC2B 1RZKC 2VH5H 5I74C 4JFXA 5JO5B 1HWHB 2D0GA 1K8DA 1SJHB 4NQCA 5DUMH 1DBMH 1R3IH 2YKLL 5ANMA 1QBLH 3ARDB 4OF8A 5MERA 3Q6FB 4HMDA 2Q3ZA 2JB6A 4S10A 4F7EA 2GSGA 1A6ZA 3ZKXB 3U0TA 4LPYA 4EN3B 1QSFB 3IDMB 2GUOA 4HD9A 3T3PE 5F9JB 1KPVA 2DTMH 1HILA 4KQ3L 5DVMA 1TZGH 2J1KA 4F8QA 1G9MH 4OUOA 5T3ZH 3L7FA 2ZSWB 2PCPB 4EXKA 2AJUH 2H45A 5GHWH 5C0CA 5DMIL 4WIQA 2OI9B 3WUWG 4OZFB 2DQGH 5JTWA 2CO7B 5B8CA 5JNYB 3UZEA 1X4XA 2B20A 1JPTH 4Q6IC 1QO3A 3IJYA 3WN5C 4F7CB 3MV9E 1ND0A 4IDJL 1NCTA 1JWSA 3CSPA 2ICWJ 1S5IL 4LGPB 5EU7C 2I9LB 5DA4A 1NGPL 3MRHB 3QP3A 5D2LE 3EYFA 4HIXL 3BGAA 4KH2A 2VDLL 4DN3L 5L0QB 1IM3A 3MCKB 3BP7A 3D39E 1FYHB 3BN9C 4KHTL 1PEZA 2ATKB 5INDB 4IIQA 1AFVL 5DK0B 2E6QA 5TGBB 2YD8A 1H5BB 1IC7H 1Q94B 1T0NA 3DVGB 4JKLA 4KK6D 3MBXL 4PJ5B 4JRXD 1NEZA 2ADIB 3GB7B 1CGWA 5CIPB 5CMAA 2B2XH 3E2HA 1NMCC 4UQ3A 1EZVX 1VB9A 3DWTA 2FATL 3RJQB 1MH5A 3W5MA 1AI1H 3RTQC 2CIIA 4ZUTB 2F5BL 3S35H 4PG9B 3CFJB 5MI0C 4M5ZH 4NO5A 4P2RE 1MJ8L 1ZT7A 2HP4A 4HIHB 4CVUA 4S2SB 3EIFA 2VERN 3LN4A 4LSQL 4NQED 1KXQE 2VOTA 2FX7H 3VDCA 3KXFA 4W81A 3O2WL 4NKMB 4ZYKB 3SKNA 5MHSD 2EE6A 1NKOA 5AD0A 5HDBE 2CKBB 5E8PA 1NPUA 4XNUH 3CU7A 4P5TD 5FYJH 4RMQA 5I76A 3QEUB 3QT2A 4LVOB 5FYKH 4MMZC 1BQHA 1SMOA 3DX9A 3G5VA 4GT7A 4LLVB 4Q2ZB 5JHDE 4MXQD 2GIYA 3NFNA 1P53A 1CD9B 4YXHH 4WTZG 5DJZB 5I17A 1KTDA 1W0WB 1Z9LA 1U41A 2QADB 5HGAA 1IKFH 4JM4H 2QR0A 2QL1A 5K33A 4PDCE 4UV4L 2X4NA 2BOBB 1T0PB 1A6AB 4KJPD 3AC0A 1WBXA 3EOYG 5GJTL 1VEPA 3W39B 1K3ZA 3HB3D 3DURB 2FDBP 5DJYA 4Q9CA 2X7LA 4TRPL 4NOBA 5MEPA 5HHOB 2K7QA 5KSBF 4NC0B 2X4PB 5BV7C 5BRZE 1NGYB 2OJZH 2BNQB 2XKNA 2A6KA 5ENWB 3LN5B 4WUUB 3RZCC 3A67H 1VADA 4JRXA 1T1YB 4D8PA 2YXMA 5I75B 3V7AG 4JGJA 2NW3B 3D9AL 4FQ1H 5EU4A 2DTML 3T2NL 3QDHA 3QRGH 3O8XD 5FA4A 5LJYH 1YY9C 1GHFH 2IANB 3IU3B 1G9ML 4HF5L 5ICZB 3BH9A 1MHHB 4UTAH 3D39D 5GHWL 1XCQB 1YMME 4OAWA 4TUOA 1NDGB 3EO1A 1Y6NR 5E99H 2V2WA 4ZPTA 4HUWA 3MMEB 4YFDB 1NCDL 5EO1A 3FO0H 4NQEA 2EDRA 5AZEL 1JPTL 2V7HA 2CK2A 3TZVD 3W9DB 5D72L 3T77A 4V3DB 1X7QA 3L5JA 3GKWH 3N85L 3UBXI 4YPGA 1CFNB 4I3RL 4P5TA 3MRDA 2VN7A 2YUVA 3FONB 3OXRB 3SCMD 1KIRB 1U3ZA 3MNWB 3B9EA 3E6HB 4FXKA 4X80L 3ZE0F 2CXGA 2VL4A 2VDPH 1KACB 3ARXA 3HCVA 4P3DB 4B7IA 1KJ2B 3FHQA 1PLGH 1RJCA 3MJ8B 1IC7L 5HPOA 4CU8A 4G6AD 1Q8MA 1QBBA 2OP4H 3BESR 1LD9A 3SGDI 4F3FA 3QA3B 3CH8A 1QLRB 2X4TA 2BSED 5F7MC 3ZZ1A 5DRXB 4LASH 1LO0H 3CFBA 1YEEL 1C7TA 4LCYA 1PBYA 5FM4A 4PGBA 3JV6B 4AM0A 4EUPB 3BZEA 4XWOD 3U48A 3BP4B 1CIDA 5FGSA 4HG4J 2VITB 3D25A 1N6VA 4PJCF 4PJEA 3AREC 2FEDC 3ZLQC 4YDVB 3SDXB 4PJGE 1IC1A 2L7JA 4TPRH 4WU5A 2AABL 1LGVA 3QPQC 1FNGB 4N0CC 1DDHB 3WO3B 3MUJA 3FO1A 4XBPB 3L5HA 2R4RL 1F6LL 1I8IB 4BZ1L 3BVNB 1N5AB 4N0UB 5EU6B 4DW2L 4KRPB 3SGKA 1KBGH 1D9KA 2A6DA 2EIZA 3BMVA 5T1MB 2HH0H 2XXCB 3FCTB 3NCFB 4QCIA 1XR9B 5FF6A 4F7TB 4OKDA 3OKLA 2P5ED 2R1XB 4Y19A 1A5FH 1OT2A 3WFBH 1IKFL 4YX2H 1QUNA 1QQDB 4P9HC 2DS4A 1CICC 5CBAB 1V7ML 1AO7D 3J7HA 3GI9L 3L5XH 4ZS6D 2R15A 3NCMA 4YEFA 1Y6MR 1UJTA 3B9AA 4KK5C 3S4SB 4K3DL 1V3LA 4LSVL 5CJQL 5A2JH 3LEVL 1LEKB 2MHAA 1G6RL 1I9EA 1YMMD 1MSPA 1XIWC 2FL5B 4H5SA 4HKZA 1J9CT 2OMNA 1FNAA 1XCTB 4OJFH 5DJCA 3QIWC 1V8HA 5IVOA 4U1KA 3SDDA 2X9XA 3SO3C 3TIEA 5ADPL 2DTSA 1G7PA 4XVTH 1ZHLB 4FQ1L 2NXYC 3TJEL 3QRGL 1UCTA 2VO5A 4MD0A 4YZFF 4GG8B 5TDPB 1ZXQA 3HI6H 1JTOA 1U36A 4UTAL 4H1LB 4NDMB 4NRZA 3SE4A 3DIFB 3MFGB 4ZFZB 3FOMB 4KJQC 3HR5B 2MQ3A 4HK0A 3CFIC 5F8RC 1JGUL 4XCYB 3EYSH 3FTGA 4I77L 4HGWB 5GIRB 5KVFH 1BFTA 3D18B 4NKQB 4HULB 2B5IC 4Z8FH 2WQ8A 4I8DA 3MRCB 5GJSL 2L7UA 4P5MB 5IQ9B 1XGYH 4OFIA 15C8H 2XT1B 5D96B 4OD2B 4LPWA 1BVLB 3MRLA 1MHEB 1IAIL 4DEPB 3EO0B 4PJIA 4UTBH 5J6GA 3VD9A 2XACC 3GMNB 2XZAH 1HYSD 5T33H 4X7SL 1X5XA 1OAKH 4LDOB 1RHFA 2NY3B 2CQVA 2VLLA 3O4LE 3WL9B 2R8SH 2P5EA 4QRTB 3C60A 2OP4L 4U6VH 1KIQA 2V5MA 4IEFB 3V7MA 4OCXL 3VFPB 1AO7A 4J12A 4CGTA 4JLRB 3CFDA 2NR6D 4O9HH 5J6HB 1FNFA 1TNMA 4ETQB 3QHZL 5LAXB 4P2YA 1Q0YH 4YDLB 5AWNL 1ZLWH 3CK0H 5IB2A 4LAQL 4HPYL 2P48B 3MRPB 2VE6B 1BLNB 1HHKA 4HHAA 2ED7A 3SGDH 3VXQB 5B8CC 1E4WH 1OM3H 4MJ5A 4X7DC 1FC1A 3VXSE 3WFEL 2ADGB 3TO4C 3CDGA 2ZUUA 3KLSA 5E8OA 4PJ8A 4DKFL 1D3CA 3IDGA 3MRGA 4U1NA 3P30L 3ARFD 3MLTB 3MLYH 4HCRL 1O5DT 2XZCL 2BMKB 2OTWB 3SDYH 5F88A 4XPFL 4F7PA 3ZO0A 4JN2A 3C8DA 3VFMB 3JZ7A 4IIQC 4OLYL 5DI8A 3QDJD 3AU1B 2XWJA 3VGBA 4YX2L 5IEKA 5FGBA 1CD1A 1I3GL 5HHMD 4D0BB 4KHXH 4N1HB 1KG0A 3RDTD 1NKRA 1JZ8A 5IWLA 3E2HC 3ECBA 1CVSC 3MLSH 5KSUA 2ARJB 4O2CA 3NA9L 3RIAK 3BO8A 4EDWL 4U49A 1SJVA 4H0HB 1GGYA 1QKZH 4CJ0A 5I74B 2GK2A 3TA3A 1NCCH 3W11C 1SM3L 1BQSA 4GKNB 3QNYA 2VQUA 3QZWG 2PNDA 2IH1B 4WFEE 4K23H 2EEBA 2H32H 2UZIL 4L9LA 1MLCB 2VAAB 1F2XK 3E8UL 43C9B 3ULVH 1EVUA 1KN4L 1YEDB 3KLHD 3EJZD 3MCLH 4KK9D 3JV4B 5C1MB 2HRPL 4QHLB 1EEZA 4XPGH 3HI6L 4L5FL 3SQOL 4MA1C 3GBML 3IDXH 2JJTA 1YYML 4HX1A 3RUGB 5J11C 4DK6A 4ORGB 1QFWL 3CXHJ 5GS3A 4GBXD 1S9VB 3O4LD 1S78D 4OM0H 1J86A 4LVNC 5IESH 3QFJD 2IH3B 3GMPA 4Q6IB 3WN5B 4Z8FL 4JFDD 4RFOL 3U82B 5IKCA 2RCSH 4HT1H 1I3RB 1GGBH 3ME0A 1MHPL 1NBVL 3MACL 4CMMA 3MLWL 3PWNA 3HKFA 2AXJA 4E5XB 1MCDA 2C4FU 4HWZA 4H26B 5F71A 1LO5B 1UZ8B 4NBYB 3UJIH 3GUTB 2F53B 5JDSA 1ODAA 2ARWA 4UTBL 5I16A 3LSOB 1OAKL 1L8JA 4J4PD 4MB4A 3HLAB 3B9DA 4I3SL 4HGKC 1YY8A 3QDJA 3N1GC 2HFTA 5D1QD 5C8JA 1NMCB 5EOQL 5HHMA 4KK6C 5JDJA 4CMHC 4YHNA 5GS2H 3RDTA 3UBXA 3ZTNH 4GAJH 5ESQB 3RTQB 1SYVB 1E0OB 4NWTH 4GUPB 3GMQA 4NKOB 4NZTH 3L6FA 3D2UB 2W65B 2VRAA 4XXDA 1G9MC 1MRFH 4PD4J 2GYSA 1EHAA 1S7QA 1P4BL 3GSVA 3PQYE 3W0WD 3DROB 4GAYB 5D6CB 4X6DA 4OZHA 4NQDA 2IGFH 3I3BA 3NIDE 2BVPA 1RVFH 2GTWA 1NANH 4LEOA 5HHXL 4KKNA 3H9ZA 4Q0XL 5EN2B 4APQD 5EC2B 1ITBB 4L4VB 5DMYA 3FT2A 2D03L 3QWRD 4YE4H 3Q6GL 4P5TC 2YA1A 2YSSB 3ZL4H 3SDYL 1N4XL 1F4XH 3T2PA 3VXMA 4I0KA 1D5XB 3MRIA 1DBJL 4M8VA 4YH6A 4XMKH 4LARH 1F4AA 2LFGA 4MXQC 5IBTL 3IVKB 5ITFA 3KDMB 4U3XA 2R1YA 3QFJA 5FO9B 5AYUL 1II4E 4ALAH 4JFDA 4UB0L 3ZYZA 3KGRA 3T65B 1EGJH 4GMSL 4JFHE 5GS2D 3IRZA 3TN0D 4RNRB 1NCCL 1O0VA 1QFHA 4KJPC 4JPIB 2QV2A 3EOBB 3QWOA 4NZRL 4YGAB 4Z0XA 3HB3C 4HZLB 1H8OA 4XC3L 1LDPH 2VDKL 1SQ2N 4XRCB 2DQCH 4J4PA 3VDBA 4JZNA 2NXZD 5EIVA 4JN1H 3RZCB 3F7PC 2BNUA 3KYKL 3MCLL 4V1DB 4XP4H 2H32A 1WWWX 4LSTH 4CDGC 3QG7L 4OI7A 3M1BA 3CMGA 4ZFOB 3MRMB 5JW5B 5JZ7D 2P5WE 4K3HA 2A9MH 3O8XC 3SGKC 5TDOB 1QBMH 5FGCE 2GFBB 3C6SB 3VWJD 3DXAE 1RPQA 4UIMB 5D7IB 4OM0L 2ORBL 1JN6A 3L3HB 5IESL 2FB4H 1X5JA 3W0WA 5CUSH 2K3TA 2DJSA 2PYEA 3O6LH 1U2CA 2P45B 3ARPA 4TVPE 1U92A 1R3KA 4YDIH 1H3VA 1D7FA 3TZVC 4HLZG 3D3VA 4UUJB 3X13A 4PYGA 3UC0H 1LK3H 1FYTD 1JWMB 2R23B 3FQTA 3QWRA 2QHRL 4U31A 1CTNA 3U4EA 1JNJA 3F7RA 4JANB 3SCMC 3PQYD 4O58H 4HIEA 5DC4B 4G6MH 1CFQA 1TZIB 2VXSH 1PSKH 4MSWB 4GXVL 4W68A 4Y2OA 1FFQA 4G6AC 1WFOA 3ROLA 1V3JA 3BYTA 1ZT4A 4YJZL 1W0VA 3NFSH 2CR3A 3QIBA 4QT5A 1F4WL 1EJ6A 3AS2A 5DUPL 4HXAL 5JW3L 3MFFB 1TXKA 2BC4B 1AD9A 3SE4C 3WSQH 1F90H 3AREB 4IRSD 2CDEA 4XWOC 5LGJB 4TULH 1JNNL 1EEUA 4JFFE 5F3BA 3G9VA 3WFDH 1RY7B 2BFVH 3TBYA 4JAMB 2D0FA 2B1HH 4G8GB 4ZUVA 2XWTB 1WGOA 3H7BB 1ONQA 4UDTB 1IZKA 1JTTA 5SX4I 1DQJB 2A1WL 2EC9T 1JZ4A 3LS5H 5M94B 4LHUB 4Z7UF 4ZG1A 5FOBB 1YYLL 3OKMB 3WEXB 1IGFL 2YS4A 4Z7WB 5C2UB 3ZKSD 4OFYD 4HS8L 2P24B 4F7MA 2M8XA 3MJ7B 4R90H 1SJXA 4OZIB 1Z5LA 2ZCHH 3FN0L 3S5LG 3BSZH 4XMKL 3D69A 2ZOLA 4LARL 1JNHA 1KB9K 5FECA 4GMTH 3P73B 1CICB 3BKJL 4ALAL 4D9QD 4MDJB 5DF0A 2C3HA 1GOFA 4Z0BH 4JO3H 5E4IA 4PTUB 5HHQB 3JBG7 3LHPH 1EGJL 3BEVB 3MZTA 5HJ3A 1BBDH 5EOTB 2P5WD 4ZS6C 3B5TA 5SV3A 4ZUUB 1EGJA 1FYTA 4PRAA 1NMBH 4MWFB 2IPUK 4HWBH 2JLLA 3DXAD 1RIVH 2ATPB 2CR6A 3BZFA 3IJHA 2R2HA 2EDXA 3QIWB 1NC4A 4YHIB 5F44A 3G6JE 3MRRB 3LPWA 3SO3B 4X4MA 3EFFB 4PJXE 8CGTA 4OIIL 3BOVA 1K4CA 2HA1A 1FZOA 2AXFB 3HI5H 4LSTL 2W1NA 2W9DH 3V6ZA 1MVUA 4PJ9A 4RAUA 2E7LA 2NXYB 5I19L 2H2PD 2F19L 4BA8A 4KKLD 1KIPB 3VJ6A 1FN4B 2DQJL 2J8UE 4MNQD 2NY7H 4LP4A 1CFBA 2AVGA 4Y16D 1QBML 2NX5E 1Z9OA 1HH9B 1IMHC 3PWPB 4LKCA