3VXOA

Hla-a24 in complex with hiv-1 nef134-10(2f)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 75
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxoA01
2HKFL 1HXYB 3D0VA 5D2LA 2EYSA 5DO2D 3AGVA 2QADC 5IVNA 1R3IL 1WZMA 3C09B 2FZ3B 4OD2A 5E8NA 1ZT7B 5EBGA 3TJEH 1KCVL 1RUMH 2VXSL 4APQB 4KDTC 2H3NB 4LLDA 3QJFA 4JM2F 1QACA 3VXSA 5T5FH 2GJ6E 1I7TA 4CNIB 1KCSL 3PWJB 3MLZH 3U46A 5BZDB 4G8IB 4UT7L 1ACZA 1P5UA 1KFAL 5E6IB 4LKCB 3KYNA 3C5ZD 4PJ5B 4ZPVA 2XA8H 3BPCA 3QCVH 5FAAA 3LEVH 4LCYA 4XI5D 2OI9B 3T65A 2DAVA 4LKXA 4OLWH 3LEYL 3H9ZA 2VDPL 1D5XB 3X3GL 3HAEG 3NTCL 4KJYB 1X44A 5BW7C 3P77A 3SGKC 2NXYD 4WHTB 4ZFGL 3V8OA 1Y6KR 1ZLUH 2CDGB 3MRGA 1JGVH 3TBSB 1U8QA 4WDIA 5EO1B 1R24B 1YMMA 4MB5A 4NT6B 4NKDA 1IT9H 2ADFL 5A3IC 3D2UA 4C55A 4Q9CA 4TUKH 3V6FA 4N1HB 5FGSA 2R0ZH 3W2DL 5KANG 3MFFA 4MAUH 5D7IE 1JJUA 5DJYA 4PGCB 1WCBA 1G9EA 1WTLA 1O0VA 3Q5TA 4OCRL 2NX5E 2P8MB 5JLZB 2BVQB 2K7PA 3KPOB 3LPWA 1X5KA 4MZ2A 3BP7B 4AH2B 1SBSH 3CZFB 4LPWA 2XZAH 3TIDB 1U8LB 3BWAA 3CDFA 5EWIH 3SDDA 4IRJD 4L4VD 2ED9A 4LMQI 3LIZH 3VRIA 5ECJE 4Q0XH 1J86A 1Y18B 1I3GH 4PIRF 2D7TL 1FZJA 3KYMA 4PJAF 5DQJB 4QRRD 3ZYZA 3EZJB 1J0KA 3GMRA 3MGTA 1TLKA 5JXEC 5F1NB 4MJ4A 2F58L 3VXPA 1F90L 1HQRB 4LDEB 4GH7B 2G9HA 1GPOL 5HVHC 1T0NB 2PYFB 2VE6A 3FB6A 3GZKA 3QEUA 1CE6A 5D5ME 1LDSA 4D0CB 4R7NA 3EYOA 2NY1B 4LLAA 3RVUD 4L3CA 4X7FC 5FO7B 4WU7B 1S9XB 5TFSL 43CAB 4B50A 3BPOC 2JB6B 5CKAA 5E2WL 1UKQA 3R8QA 4M7KH 2RB8A 4YBHA 2OXHA 4XXDB 1NMBL 3EYSH 4GAGL 4ZG1A 5TGBB 2W9LA 3GIZH 5HHOB 1BOGB 4UT6H 3SDAD 4CGTA 2AJZB 4F9PA 2GTWB 1NSNH 4P5TB 4E41B 2X4NB 4NUGH 2XNAB 3F5WB 1VFOA 2PF6A 4WFFD 4NO2B 4WI7A 3CMOL 4C59B 4K9EH 5F1OB 2DLFL 2EDLA 4YHML 4W4NA 2E27H 5J7CC 1A5FL 1I3UA 3EIFA 4EQ2A 5GIRB 1OAZH 3GKWH 3WIHA 3KPNA 4XVTH 1BAFH 1JWSB 2QQQA 2CSPA 5I1CL 4F3FA 1CLOL 3MXVL 4DKAA 4CVWA 2F54A 4Y4HC 1OP5H 3WO4C 4YFDB 3JTCA 1J5OH 3KYKL 1I7RA 4APQD 2ZUXA 4X98B 2DOCA 1IC7H 3ES6A 4X7TB 5E95B 1DVFA 5IV2A 1MFDH 1SMAA 2YMXH 4OD1H 3VI3E 2RFXA 2BOBA 3ET9F 4R7DB 3B2UC 2EEBA 3PQYE 1F58L 4KQ3L 1EHNA 4XP1H 1FJ1B 3C9NA 4S2SB 4U6YB 5C70A 1S7SA 1GJIA 4OT1L 5CEZH 4PJ5D 5C0RH 1A6TA 3PL6B 1P4BL 5C6WH 3ROLB 1GC1C 1IEAB 4YNYA 4I2XB 4CJ1A 1HZHH 2VLRA 4HPOL 4B0MM 1G7MA 4HUNB 4U2ZA 3ROOB 2CJUH 3NPSC 3IFNL 5CJXC 5I1KH 3KXFB 1RJLA 3DXAA 3TZVC 3QPQC 1T66C 4GRLB 4PGJA 1PZ5B 3TVMC 2Y7QA 5CMAA 3BT2L 1A7OH 2VDML 5I19L 2PETA 2YZ8A 3TPUB 5E5MB 4PG2A 2CDEA 4NQVB 4YH6A 4IRSA 1BM3H 2ILLA 4RRPA 3QG7L 3WLBA 4JFFA 3RWHA 1CI5A 1IGIH 4PRID 3DJ9A 5F21B 2IEPA 3PXJA 3X11A 3BQUB 3RGVA 3GSVA 4JAMA 3MXWH 2GUOB 2EKJA 4RX4D 1YPZB 1CIUA 5J3HD 3IDGA 3BPNB 5DA0B 5T1KD 3BH9B 1CTOA 1OAXH 4N0UE 3D48R 1U3HC 2PTTB 5CILH 2P8LB 1GGCL 3LZFL 1U93B 3MNZB 3MOQA 3KLAB 5AUMA 1AE6L 1S5IH 1B6DA 4NQDA 5IKCB 4D0BA 2PW1A 4HZLA 5F7NC 1NDMA 5C0GB 3IRZA 5FGBA 3PHOB 4AM0A 1NCUA 1KG0A 3A6CL 3DURA 4D94A 1N4XL 5FO9A 2ZNWA 2NY5H 4U6TA 3T0EA 5EOTB 4MCYB 2PXYA 4J6RL 3LKNA 4JM2C 2IADB 4HMEA 4O58H 1IM3B 1QBLH 4KQ4H 2NY1D 4TTDC 4JG1H 4UDUB 5B39A 4JFZL 1MCKA 3PP4L 5DURD 3LOWA 3KLHD 5F7EL 5GGUA 2BX5A 2CK0L 2BMKA 4FOMA 5F1IA 3M8OL 1H3WM 2OP4H 1INQB 5D72L 1T83C 1N6VA 5IOPB 4XNUL 4MJIE 3DHJA 4QXGH 1CK0H 4XNZC 4P5TD 2F53E 3PGDA 1EO8H 3RWEA 4LSDA 5FCUL 1X6LA 3GSNA 4XNQA 1ADQA 3G6DH 2ICCA 3AVEA 4K3EL 4Z7NE 2WWKT 5DD3H 4IOIA 1OT2A 3D3VD 5F44A 1DQJA 4HFWB 3WLWD 5C0FA 4TSBL 4R0LB 5INCA 4DGIL 4OV5B 3HI6L 4NSKB 5DD0L 4WHDA 5MHSE 4ZAKD 5JNYA 4ZS7H 5FM5O 2ED7A 1HSAB 5ISZB 3U0TA 3IT8D 3P9MA 5L2KB 5DQ9A 1UB5A 4L29A 4KZDL 4K3DL 3C60D 4PG9A 1CVRA 1MEXH 1K4CA 1QLFA 1KB9J 3CCHB 4P3DA 2NY0D 5JMOC 2JK5A 2YSSA 3DOSA 1D5ZB 1CDUA 2NY6D 3V6OE 3DGGB 1TCMA 3OTTA 1F42A 3MREB 2YEZB 4YUEH 2QQKL 5ID1B 4ONGH 1N6UA 4ZUUB 2PW2A 3QUYC 2V17L 5D7SH 4P59H 1EJOL 3DX9A 4XBEH 5GGSB 1EMTH 3TH2T 3U36A 1FPTH 4HJJL 1GH7A 2MHAA 1W0WA 5DFTA 5CZXC 3QDJE 4LSSL 4FQ1H 4TPRL 1S7QA 2OMNA 3PL6D 5EBLA 1P7KB 4HGWA 3WIIL 1JP5A 3EO0A 4EI5D 1U8IB 1URLA 3Q3GA 1BEYH 4X99A 1WVZA 3QA3A 1S8DA 4M6OH 2VLME 4JM4H 4PJIA 1CLCA 4X5XB 3V6ZA 3W9EB 5EU5A 2DQUH 1VENA 2R8SL 1P6AB 2B4CC 2WK2A 3HR5B 1J7VR 4KH2A 4QLRA 4DTGL 3KXFD 4C56A 4PREB 1T5XA 3ABZA 4XP4L 4XVJL 1OAUL 1BOYA 1UH4A 4G5ZH 3TT1H 1RJZA 4QY8A 3RIAK 2P5EE 4XWGL 1Z5LA 3EZ8A 3BD5A 1DQTA 4XVSH 4QTHB 3H3PL 2FD6L 4AT6A 1IAKB 2XZCH 4U1LB 3RUGF 3QEHB 3V4UL 5DEGA 5K9KA 2DQEH 1BLNA 5C9JA 4N68A 5L9DH 2R1XB 3BQUD 3B3IA 1PG7H 5I0ZA 4BZYA 1NJ9A 3OKKB 3WS6C 4LLUB 1UA6L 2A9NH 1W0YT 3LQAL 1A7NL 2UUDH 3EOBA 4P57B 4K7FA 5IVXA 3EO9L 4MYWB 4PY7B 1I1YA 3WUWG 1NAML 1BQLH 1SEBA 5KTEH 4XPGL 4K94L 4ZXBA 1FSKC 4KMTL 1N3NA 2BVYA 2DRUA 1OVZA 3OKEA 4DGYH 2E6PA 1A4KB 2XWTB 5BW7A 4YDJA 3O2WH 4W70A 3I3DA 4ZSOB 4NQTA 4YHIB 1QD0A 3NACL 4H25B 5BV7H 1ZGLB 4PJHB 4PP1D 1JMZA 1OLLA 2HMIC 5CHNB 5KOMC 4C4KT 4CW1A 4AEHH 4YGVA 2ZSVB 5HHMB 3AFLA 4NCC1 3S37L 2KL6A 4OZIA 4QKXB 1ZT1B 4V1DB 2E7LE 5KJRH 1AQDB 4MNQE 2RIKA 1CICB 3VI4F 4X4ZA 2IANA 1A47A 4JHAL 4GOSA 4B5EA 3HC0B 1TJGL 1QP1A 3PWNB 1CGSL 5JW3L 1WIOA 3FT3B 3NFNA 4BFBD 1NMAH 3A67H 1YEHH 4PJGA 2P1YA 1T20A 1MFCH 3KDMB 4HHAB 1LO4L 2ICWI 3I85A 3QNXA 1FVEB 2P49B 2ERJC 3H7BB 3BW9B 5TPWH 4TUOB 3HRPA 5JUEL 1ZVSB 2H32B 2MOVA 1M7XA 3DI3B 5BS0D 3BIBX 3DVIA 1X6NA 4NOFA 3T3MF 5EG6C 1FVCB 4S1DD 2LU4A 3UDWC 3FZUD 2DQTH 2H45A 5IT2H 3RTQD 5JA8B 3AS3A 4KMLB 2EC8A 1AO7D 4D9QE 5L2KD 3SGJC 5ISZD 4XPBH 2FCBA 4JFXA 1IGMH 4I0CC 1J9CT 2ZCHH 4WJ5A 1SY6H 3S7GA 5MERB 3QISA 1PJ9A 4YX2L 1XZ0A 5E08H 1QPXA 2YUWA 3BYTA 1Z9SA 4KMQA 1KBGH 3MYZA 2YWZA 3ZHKA 4HS8L 4HWEL 4DN4H 1AGCA 1TQBC 2DLHA 3FT2A 1FG2B 1YPZF 1UH3A 3RVTD 4R2GB 2SEBA 1W2KT 5L8KB 4OCSL 2UV3A 2X2YA 4JRYA 1WISA 3ARFB 1NAMB 4ONHA 4AEFA 4N0YL 5LCVL 1AHWC 4MVBC 2EH8L 1MHCB 2CPCA 4Y4FB 4HBCH 4MAYD 1P69B 2IQAA 3IAGC 3OXRA 1KCUL 3C09C 2AQ3A 1OGTA 4N0CC 5JHDA 3QXAA 1U6AH 3L5IA 3TBYB 3VRJB 3ZDZF 1H3GA 1KLGA 4X7EC 4OFVA 1A2YB 3OB0H 1ND0B 1PKOA 3O3EB 4MJ5B 4OM0H 4FFVC 4FQJH 3VWJC 1K4DB 3F7VB 3NCYS 3BZFB 5GS1A 3F8UB 1MAMH 3RI5F 4I18B 5LGJA 2GEEA 3PWUA 4I4WA 3B6SA 1N5AA 5E6IC 4LLVB 2FJGA 2X1OA 4X5WA 1GCFA 4PYHA 5CIPA 5T3ZH 2FEDC 1GGIH 1ZHLA 2OI9C 3ARDB 4JO1L 3GSRA 3RWCA 3MV7B 4QGTA 5GSRA 3QH3A 1G6RL 1ZEAH 4XCNB 4O4YH 2YD2A 1S7VB 2F19L 4JQVC 4KKAD 4HWZA 3C6LD 2DMBA 3JV4B 4RAUB 4OTXL 2C1OA 4MD4A 5D2LE 4UOW0 5B21A 1Q9LA 5IB1B 3OF6D 1FL3B 1MFEL 5I18H 1KELL 2XY2A 4FQQA 2W9DH 2BOCA 3DLQR 4H1LA 1QFUL 4OAWB 3O9WB 3MA9H 2HP4A 1KTDB 1B0GB 4K2UL 4L8BB 1K8DB 3U7AA 4Q9QH 4LIQH 4OCXH 4ZUSA 2HWZH 3VXSE 3STLA 3GHBL 3MRPA 3DSNA 3S9DB 1VEPA 4DJMA 3TLRA 4YAQB 4G6JL 4Y1AB 4HC1A 5D1ZC 3KWWA 1LDPL 3NFSH 2BDNL 3IJYB 4KVNH 3RZCB 5D71L 3B8YA 3MRMA 2P48B 2UWEB 4OJFL 4PV9B 4DZ8A 7CGTA 3WIHH 1JE6A 3IAQA 4NM8L 2R9HC 2WW8A 4WEBL 1JF6A 3TVMA 2X40A 1BQUA 4LF3B 4V1DD 3ARBB 5C0IA 1ORQA 4U1SA 2YD9A 5HJ3B 4J23A 1NUFA 1P2CB 5HDQL 2BNQD 3FKUS 4HJ0D 1J0ZA 4FG6D 3LS4H 3MLYH 1JZ5A 1U3ZA 4HQQH 5DZOA 3PHQA 3VMPA 4U1NB 1UXSB 3DV4A 4WO4A 2D03H 3QWQB 1XGUB 3KPPA 5C0BD 1A7PL 1P7QD 3KPRA 1L9NA 1YEFL 4PRHA 1IQDA 1P9MA 3T2NL 1IVLA 2WBJB 3U9PH 5IF0B 4QHNB 4G8GB 4HUMB 1NDGA 1JPGA 1RZKL 5HPMB 3KGRA 2X9XA 5AZEL 4M1CD 4LEXH 4NIKB 1JPFB 1YJDL 1CFNA 3MRFB 5M95B 2FR4A 1G6RB 5CP3A 3N9GH 3ZL4H 1N5YH 1SHMA 3KR3L 1ZHBB 3TBVB 4OUUB 4UTAH 2VITB 5C0DB 3IYLW 4M3JA 1UM6L 5ICXB 2AABH 3B83A 2W9EL 4JRXA 1A3QA 4L8DB 2EDDA 1FLRH 5D1QA 2QKIB 4O00A 2YS4A 4MB3A 5FYLH 1N6QH 2HTLC 1BD2A 4LU5L 2NY4B 4OLEA 4XNXL 2ARJA 3ARFD 1IARB 4NOBA 1OF2B 4MWFB 3IVKA 1CF8L 4Y4FD 2J88H 5BVPH 4HUXB 2EH7L 3BFOA 3NPZB 3FT4A 2WUCL 3HNVL 1NCCL 1QVOA 3QQ4B 2Q3ZA 2O5YL 3BXNA 3FAXA 3DVGB 1G0YR 3AAZA 3H3BC 4PJHF 4AG4L 5JPMA 5I8KL 2VABB 4MNGB 5K9OA 3QCTL 4U0RB 5E2TL 3P4MB 5HI3D 3ZKQD 3R06A 3O2DA 4RGOH 3GDBA 2EDJA 2DB8A 1MH5A 1TTUA 2B1HL 2BNRB 3QDMB 4PYGA 4HK3N 1EX0A 1S9KC 1RD6A 5IHLB 4WUUB 1LEIA 4Y4KD 4MQ7B 2H8PB 3ARDD 2IMNA 4JPKH 4TUJA 4RAVA 1IFHH 1PEZA 2H2PC 1H0DB 2I9LA 2R4SH 3V5HA 4HWBL 3DRQA 1T1YB 1XIWD 2A74A 4IMLB 3IU3A 4NN5B 1KT2A 2F54E 4X4MA 3GM0A 3OV6A 3IDMA 5IMLB 2FX8H 3L3JA 4IDJL 3PV6A 3O4LA 4PJAA 1OT1A 3BSZH 2Z35A 1T4KA 1F13A 2WZPD 2VAJA 4DKDC 2AGJL 3Q6GH 1S7WB 1CL7I 4HS3B 1WFOA 3JSSA 1QEWA 3D25B 1DN0B 3UJIH 5T5NF 3WFDL 3FQRB 3M1BA 1ADQH 1Q72H 4HUWB 4JZJB 1M7DA 3RZCD 1D6VH 4M6MH 4MS8C 4LVNC 1GOHA 3TPKA 4NJ9H 4HT1H 5IMMA 3R8BB 3RDTD 1XF2A 2IGFL 4G9DA 4HS6A 5TE4L 2VLRE 2LVEA 3MYJB 4WI6A 4XGZB 2CRMA 4QGYA 2ATKA 4HKBB 3LN4A 5JQHC 1X3DA 1JNNH 1OP9A 5D7LA 3QWOB 5CEXB 1UVQA 1KXTB 2Y07L 2DM3A 32C2B 4PV8A 1U8OB 4P5KB 3U30B 3EOYG 2ADGA 3DXAE 4YWGL 2EKSA 4E9LA 1HK6A 3PJSA 1HDMB 3SBWA 1MIEH 3QUXB 5BRZB 5FKPA 4UIKH 3GI8H 1VGEH 1PYWA 2VLJB 3ILQD 1Z3GH 5KW9L 1OQXA 3ZHLA 1ULVA 2ICWB 3HE6B 4ZODA 5JO5A 2Y36H 4GKZA 2LAAA 3ILPB 3MLWH 4RSVA 3D39B 4JFFE 1RUAH 5DK0B 3WL9B 1D6EA 1UKSA 2BVTA 3MV01 2PO6B 4FQ2H 5C0JB 3GJFH 1B4JH 4UNTA 1ZVHA 1YNKL 3SQOL 1A9BA 1S9YA 3WNLA 4P23A 1U8KA 4Z77B 4Y2DB 5IQ9B 3UTSB 5AAWA 4KTEL 2Q7NA 1AXSA 2IQ9L 3OX8A 1BVKB 2OS7A 3PABB 3MACH 3H42L 3ZE0E 3SCMB 1RFDL 4OQTA 4M61A 3EYQD 5SX5H 3K80A 4B41A 5DR5H 5I16B 3AROA 4MA3A 4IRJA 2VLKA 4L4VA 1GZQB 4NQDE 5I1LA 3FOMA 4R97B 5D9SB 1MFAL 2Y25A 2NY4D 1MIMH 3CSYA 1FNEB 1T04B 1PGRB 4QRRA 3T0EE 4OM1H 3T0DA 4R0LC 1ORSA 1ZSDA 4IOFD 4OZFA 1CD1B 4ZD3L 2YKLL 3PDOA 2FH6A 4G3YH 1I9EA 2JIXD 4GRMA 3S35L 4K71C 2X42A 1O7VA 2C26A 1RJYB 3V4PL 2CQVA 2B20A 2XXMB 4OLVH 1EFXB 4JKKA 2HVJA 1ZLUK 2A9ML 3ZMRA 4PJXB 4U6XA 3MJ9H 2IALA 4PD4K 1J8HB 3FQUB 4J3SA 3O8XC 1T80A 4QOKB 3HA0A 2CLZB 2NXZB 1LD9A 1PSKL 3KG5A 4J1UB 3UDWA 2IF7A 5IG7B 4CRPA 2BSED 3R4DA 2BNRD 3MMEB 3QDHA 4ZYKA 3W5NA 5E99L 5SWSB 3SGJA 4WI9A 3S34H 4FQIL 3SDAA 2R1YB 3L7EA 2HTKD 3B9KC 3ARWA 4NNYB 4O2EA 5EZLB 3TN0B 5GS2H 2BXZA 3QUZD 2NR6D 2A6DB 1AKJB 4I5BB 3TFKC 1VACA 4ISVB 3WKMH 1A3LL 5ACZB 2ZUWA 5E5RB 1HXMA 1RY7B 4LSPH 5FEBA 1AD9B 5C7XL 2EDWA 1G7IB 2EEDA 2VDQL 3VFVA 4XB8A 2Z31B 3MJ6A 5GGTL 1JF1B 4FQPA 4GW4B 5I2IB 1AHWA 1MHHB 5E5UB 1YECH 3TYGH 2OSLB 2NY2B 4UQ3B 3T09A 1QLEL 1S9VA 4M5YH 3SE8L 4MQXD 3UYOD 4N0CA 4Z7OF 4H26B 4APQA 4KROD 3C08L 5C09D 4D9LH 4HK3J 1JZ7A 5CLWA 4XBPB 1D7FA 3SHSA 4PJ9B 5I1DB 2WUBL 3MUJA 3GNMH 1LQSR 4CN4A 3PWJA 4DFHA 2F5BH 5BZDA 3NIDE 2BRRH 4G8IA 1XGRB 1M71B 1ZV5A 5D93B 5E6IA 4LKCA 4PJ5A 3HZKB 4IDLA 4PJIE 4LQFH 4O2CA 2OI9A 4KKLD 4I0KA 4ODWB 1B2WL 2CXGA 3VFUB 1GGUA 3MV9B 4NKIH 3TA3D 4C56E 1ZLWH 2HJLB 5FDWA 3W0WD 1D5XA 1XF3B 4KJYA 2YBRB 3QUXD 2FX9H 3EHBC 1OTUC 3BP6A 4JLRB 5IFJB 4WHTA 1P6FA 2VL5B 2R69H 2A6JB 1NH6A 2IPUG 1AGFB 3O2VL 5EOCJ 2CDGA 3ZDYF 2HLFD 1F6AB 4PRNA 2PR4L 5FHAH 3TBSA 3GBMH 1PFCA 5EO1A 1R24A 4NPYB 1MELA 4Y19D 3J8F7 4PY8I 1HIML 3TESA 4OFYA 3G6JF 4NWUL 3HZVB 3VWKB 1CICC 3H3KA 3UTSD 1JUFB 1J1PL 4X5LA 4YE4L 3GRWA 1UC6A 4ODVH 4P5MB 1KC5L 1N0XL 5IVXE 4AY0A 1T5WB 3SCMD 2P8MA 2XACC 2BVQA 1G9NL 3KPOA 5JLZA 3CFIC 4U1JB 3BP7A 4AH2A 1U8LA 1FORH 3HMWL 5IBTH 2AJSL 2D2OA 3K2UH 1Y18A 5CIPH 3CK0H 2XTJC 3TO4D 1CD8A 3V79C 1LK3H 1DEDA 4G6FB 2D0GA 3WDHA 3F7RA 5DQJA 1B0RA 4QTIH 1FYTD 2FDBP 1ES0A 1LO0H 4P3CL 4YPGB 4R8WL 3OZ9H 4LRNL 3S5LB 5F1NA 4LPTA 4ORZC 4OZIE 1X9QA 3O81A 3SEPA 5B4MC 1HQRA 4PB9L 4HGKC 4Z7QE 1T0NA 2PYFA 5TQ2H 3MGOA 5C3LD 2IANE 3JWOL 5HI4C 1EFXD 3RJDA 2AEIT 3LQAC 1KN2L 1AGDB 4D0CA 1P4LB 3K8KA 1LO3L 1T2QH 1F02I 5FO7A 1K3IA 4R2GC 43CAA 3N50A 4PJGE 2JB6A 1GC1H 1IM9D 4UUJB 2NXZD 5FUZL 1V7NH 5EA0H 5IB2B 4K94C 4XXDA 1G0XA 2FBOJ 2GY7B 5C0EA 3QIBC 4OLYL 1BOGA 4RFEA 4DFIA 3PWPB 5SWSD 1UEMA 2AJZA 1WUNT 2GTWA 4P5TA 1BQSA 1EXUB 4NQUA 5TDNB 1F6LL 3TN0D 3L3DA 2XNAA 3F5WA 2V6HA 4NO2A 4JQXC 5D2NB 1OGAB 3T0BA 2ZUQC 2BY3A 1BZQK 5FM8A 4OGZA 4I77L 4MMZC 4TSAH 5HHVL 1E27B 1PAMA 5GIRA 5GGVY 5I15L 1FCCA 4ZMAT 4I3GA 2YPVH 1F8TH 1T03L 1JWSA 1IEBB 2BVPB 5EBWB 2CKNA 5FYJD 2VDOH 3RAJL 3KLDA 5HTSA 4Z0BH 4J3WA 1BQHG 3QIUB 1IGYB 3MV11 4JRYE 4PJBA 4WENB 4ERSH 2BJML 4K8RL 3QP3A 1A7BA 4WI5A 2JE8A 1F4HA 4W6XB 4X7TA 3O6FB 4PJ9D 5E8EA 4HG4K 2XN9B 4KK6C 2B5IB 4R7DA 1ZWIB 2J3SA 3ULVE 4EBQL 2QQNH 5JHDE 3LHPH 2OTWA 1FJ1A 3IB4A 3QPXH 1TNNA 4YGAB 3O9WC 4U6YA 2VOTA 3WBDA 5GHWH 1BGXL 3LEXB 3MQIA 3PL6A 5DVMA 2F74B 4PJDB 3WFBH 4EI5A 3ROLA 3MLTB 1IEAA 2OK0L 3UYRL 4I2XA 4Z6AT 3MV9D 4WU5B 2DBLL 3MBXH 4OIBA 4P9HC 1MWAL 3HC4L 4JY4B 1LO2L 5GRVK 2OBGA 1A3RH 2BVUA 1SM3H 1E4KC 4HIXH 1S7XB 3RBSA 3BRGC 2A83B 2MQ3A 5CJOH 4RBPH 2GJ6D 1F2XK 5KBNC 3KXFA 5T33L 1GL4B 1FIGL 1HHJB 4NN6B 2UYLB 4PJXF 4XVUD 2IG2L 3STZB 1QRNB 4GRLA 2MPAH 5DFWH 3TT3L 3VXOB 4AEIH 9CGTA 2O61B 1PZ5A 2DWEB 3MA7B 4OBSA 2I26N 3ARBC 4WIQA 4HCRH 3TPUA 5E5MA 3VWKD 4GKOA 4NQVA 5JIKA 1UYWH 4MXQD 5BJTB 2NQCA 3QRGH 1JPSH 1EVTC 3ARGC 3O3UN 1X4YA 4JN1H 3WNMA 1I1AD 1MJ7L 3BH8B 4JJHA 1H15B 1MAJA 1OP3H 3BQUA 3RWJB 4MS8A 1OM3H 3O2DH 4TNWK 1C16B 2E7BA 1SJEA 4G59A 4JQIH 1MPAH 4JY6B 5CZVH 1YPZA 3QXTA 3IXTB 1H8SA 2WBJC 3OWEA 5L0QC 2GTZB 3HMXL 3VG9C 3RL1A 4OD3L 1CDJA 3BH9A 4HKZB 2PTTA 3L5JA 2P8LA 4G6FD 3MNZA 3RWDB 3MRHA 2OJZH 3KLAA 3QR2A 5IKCA 1IQWH 1MRDH 3J7HA 4GRWE 1C08B 1UCBH 5BZWB 3MJGX 1KCRH 5AAMA 4X9FA 3PHOA 4KVCH 1YC7A 5GGVL 3ZSTA 5DUPL 2EXYD 2DL9A 3GSOB 2NX5D 3P9LB 5EOTA 3EDDA 4LAQL 1BFVH 3E0GA 2QSCH 3L3KB 2IADA 3UTTB 1UB6B 5GPRA 4DEPB 4G6MH 1IM3A 4FP8L 1A6PA 2J7LA 1ACYL 2X1WL 5FYKL 4QRQB 1CQKA 5ITFB 4KTDH 5HYQB 1KULA 4UDUA 1E4XH 3KPRE 5F7WC 5FO8B 1DZBA 1KCGC 5IBLC 4LSVL 4RISL 1VPOL 3IKCB 1G7LB 3CFBB 1DBBL 4FXGB 5GGQH 4AIOA 5D70L 2JJTA 1TNMA 4GT7A 4WEUD 1MWAB 3VXMB 3LRGA 2FB4H 5IOPA 2B4CH 2ZJSH 4HFUL 4BZ1H 4M1DH 4R90H 4NP4H 3DV6B 2CMRL 4JO3H 1INEH 3LKPB 1OGAD 2R0WH 3QB7C 5CJBA 1OD7A 4EVNB 4UB0L 5BS0A 1CFVH 1WTGT 2UUDK 4IRZH 3QAZC 3LH2L 4HFWA 2MCG1 2MJWA 2Z8VC 3ERYA 4OV5A 4NSKA 3OR6B 4JRXE 4KK8C 2E9IA 3S96B 2RBLA 2J8HA 2X4PA 2IFGA 5E6YA 1HSAA 5ISZA 5L2KA 5T1MB 1LNUB 1BD2E 1IKNC 1YEDB 1V5JA 3RU8H 3P73B 4IOSD 4F7EB 1KN4L 2AEWA 4JY5L 1S7UB 3MRKA 1AFVH 1X5FA 1ZMYA 3CCHA 4H88H 4DVBB 1D5ZA 5C2UB 4DKEH 1F4WH 1CXLA 3DGGA 1DP0A 5IHZA 3OGCB 3MREA 2YEZA 2R23B 4RGNB 2XN9D 5ID1A 1CU4L 4ZUUA 4NN5C 1RZKC 2YRPA 4DQOH 1LQVA 1K6QL 4OCWL 5DF0A 3IU4H 4PJ8D 5FM4A 1PKQB 2A77H 3HAEB 5DI8B 5GGSA 1YJDC 4JVPA 2A6IB 1NLBL 4RMQA 4DW2L 5DQDH 5E00A 4A6YL 1QNZH 4LASL 3CAFA 2KQNA 2XQBL 2G5RA 1P7KA 4OQTH 3H9HB 5D7JD 1U8IA 3DX8A 2VXVL 1C12B 1I1CA 1Y0LB 2BFVL 2X44D 2X10A 5IVZB 4JZJC 5CINH 3QYCA 4HH9B 4HXBL 3CMGA 3S88L 1L7TH 5AWNL 4X5XA 4YHNB 5DYOB 5HGBB 3W9EA 3HCVB 4XAKE 3NABH 3UC0L 1XR9B 3HR5A 4M93C 2X70B 3AS2A 4PREA 4WUKL 3QUML 2GSGB 4OZFH 3PQYD 4FZ8H 1MF2H 1QRND 3WXVH 4AYFA 4WWKC 2AK4D 5IQ7L 1ZVYA 2VYRE 4R4ND 4QTHA 1MHPL 2GITB 4X4ME 1WV7T 3BMWA 2DLTA 3FFDB 4YXHL 4U1LA 3QEHA 3O4LE 4PJAE 4UIMB 1YQVL 5DJ8B 2R1XA 3NCJH 3KPMA 1WT5A 1XGYH 5IB4B 1QSEB 5B8CB 3OKKA 3HG1B 4HKXB 1UG9A 3AU1A 3U6RA 4XPFL 4P57A 3FO0L 1FDLL 2CKBH 2QQLH 4KJPC 4PJEB 4EKXA 5BOZG 3NIGE 5HDLA 4PY7A 4YHLL 5E4EB 4HWNA 5C2BL 4Y2DC 2ICWJ 2KUTA 3O6ML 3E6FB 1HH6B 1KIPB 5KVMC 1A4KA 2COQA 2XWTA 4ZSOA 4YHIA 1MREH 3EOAB 5GS0H 2XQYG 1MFBL 5ENWA 4CDHA 2XOTA 4LVEA 4H25A 1ZGLA 4PJHA 5TE7L 5D7LE 3OB0K 5CHNA 1I9JH 4DVRL 4NHCH 2HFGH 3OKLB 2ZSVA 5IWLC 5HHMA 3HN3A 3P2TA 1UM4H 2PTUA 1ZT1A 4V1DA 5JIPA 5DVOA 4HEME 1LMKA 1CICA 4A6YB 3ARTA 2DYPB 3QHFH 2AXGB 4UTBL 2B7DT 2AJYH 3HC0A 3D69B 3PWNA 3UJTH 1P84K 3FT3A 5KSBB 1YY8B 2LE9A 3T08A 4OI8A 3KDMA 2OL3L 3FRUB 1EVUA 1FVEA 5IW3A 4R26H 3FB8A 3I50H 1OLZA 1YY9D 1XF5B 3H7BA 4NZRH 2NLJB 1RK0B 4TUOA 2YXMA 1ZVSA 2H32A 3JVGA 4HIHB 3BJLA 4XMKL 1CTNA 4AIZB 4EI6B 2WIIB 4WFGE 3FTGA 5FA4B 1JZ8A 1FVCA 2BCKB 3S3JA 1EV2E 1DANT 2WM0A 2LVCA 4IIQB 4N8CH 5T3XH 4L4VE 1FL6B 5BO1H 2QBWA 3S36X 1LEGA 4OLXL 5MERA 4BQBA 4HSQA 1DSFH 5B38G 4QRRE 3HFMH 3HRZA 2DTSA 5HGDB 4PJFA 4TULL 4TVPL 2IFFL 4RGND 1FG2A 1I8KB 5CEZD 4S1SL 2Z31C 4HXAL 2X6MA 1AJ7H 1ZTXH 2VR5A 1NAMA 3ARFA 3HUJB 3MSPA 3GRWH 3RQ3A 1MHCA 2OZ4H 1KNOB 1IC4L 4Y4FA 15C8L 2NY2C 2D9CA 2PYEB 4X4YB 1H3PL 4YBQC 1J1OL 1F4YH 4KV5E 4FFZL 3K7UA 2CGRH 5LXGH 4YXKL 3NGBC 3TBYA 3VRJA 3BP5B 4X9BA 4G9FB 4TSCH 1A2YA 1X7QA 1WWCA 4TRPH 1ND0A 3BYYA 2V5MA 3O3EA 1DDHB 4MJ5A 4BSVB 4YK4B 2HKFH 2ED8A 5DDHA 1K4DA 5JOFA 3F7VA 3GBNL 1R3IH 1OTSD 4I18A 1IAII 5C0ND 5EZIL 4WFFE 1KCVH 4Y5YB 2VXSH 3QJHB 4LLVA 1JPTL 5TH2B 1WBXB 2IBBA 1BIIB 1TVDA 3QDJD 1RZGB 1YQ2A 3MLUL 1OARL 4XPTL 4LQ1A 3ARDA 4XRCB 3MV7A 1KCSH 5DT1L 2OR8A 1C7SA 4UT7H 4RRPG 1RUKL 1UWGL 3WDJA 5ESVB 1KFAH 4Z7WB 1VKXB 1S7VA 1JWMB 4Z7UB 3THML 4RAUA 5L6YL 1N0LA 4GLRH 4M7JL 2VXQL 1FL3A 4QWWD 3MFGB 4OAWA 3DROB 3O9WA 3LEYH 1KTDA 2EZ0C 2VDPH 1B0GA 3NTCH 3N1MC 2C3WA 3X3GH 3K46A 1A6VL 3DETD 4N5EC 5D1XC 5E1AB 1XGQB 3MRJB 4RGMC 4JB9L 1QQDA 1S78C 1FFRA 4YAQA 2K9UA 1V05A 3LN9A 4KJQC 2DIBA 5ITBL 3IJYA 3RZCA 3CXDL 4PJ5E 3U9UB 2ADFH 3K81A 3ZLQC 2UWEA 3EYVA 4PV9A 1QFWL 3GMNB 3GGWB 1NEZG 3FB7B 3W2DH 1ZA3B 4MSWA 5A43C 5AZ2L 2P45B 4LF3A 3OL2A 4V2CB 5T3XE 5HJ3A 3HPLB 4OCRH 4UZGA 2OCFD 1P2CA 1S3KL 4L9DA 2LQRA 1AC0A 3MLXL 3L3GB 1UXSA 4ZTOL 2VKXA 4MA1B 3MUZ1 4NO5B 4LSQL 5KVFL 1XGUA 1Z9OA 5A2IH 5BVJA 2D7TH 3HS0A 1KPRB 4I0PB 1RHHB 1T7YA 1GYAA 2WBJA 4GQ9L 1P1ZB 1HWGB 2BVOB 2LAGB 2ORBL 4QHNA 5H2BB 5IF0A 4XAWL 3E2HB 5HGHB 5HPMA 2DJUA 2F58H 2VR4A 1F90H 1Q9KB 1FFOB 4MNQD 1JPFA 3OR7A 1GPOH 4GFTB 2XZZA 5FYKU 3VFNB 3MRFA 2V7HB 3IRPX 4NM4L 1UKTA 1N2RB 5K9QI 1ZHBA 1CWVA 1NUGA 3TBVA 1D9KB 5TFSH 4OUUA 5JHLL 5C0DA 4TVSa 5KSVA 5E2WH 3SGEH 5ICXA 2X4TB 2W0FB 2GFBB 2QKIA 4EN3C 4QNPE 2Q8BL 1NMBH 4GAGH 3BEVB 3I6LE 5JW4R 4PLOB 3KYAA 1RZJL 1WSST 1RK1A 4X6DB 1XF1A 4JHBA 4JG0L 4M6AA 1OF2A 4PJEF 1TTGA 3CMOH 2DLFH 4YDIH 1V3JA 4HUXA 1SBBA 4D9QD 3QULB 3QIUC 1A5FH 3LKQB 4FTVB 1A6AB 2DQFB 1G9NC 1QR4A 2MQ0A 1MUJB 3QQ4A 2HVKB 1BVZA 3SE4A 3DVGA 1M4KA 3H9SB 3RL2B 5JZ7D 3WYRA 5I1CH 2VABA 3O6FC 1CLOH 3MXVH 4MNGA 5EO9B 5JTWA 2W59A 1H5BB 2HKHL 2B5IC 1NBYB 1RJCA 2IBGA 4BQ8A 4M43L 3KYKH 4GBXC 2KH2B 1MNUL 2BNRA 3QDMA 4LSRL 5F7FA 1CLZL 1UH2A 2VLLB 2HT3C 4WRLA 5CD5D 3F62A 4WUUA 3TF7A 5GISL 4MQ7A 2H8PA 3WLWC 2A2QT 2X4QA 1CFSB 3QEQB 1Q0XL 1U92B 2J8UB 1U8PB 1F58H 1GAFL 4KQ3H 5KSBF 1H0DA 1JIBA 3O6LL 3BUTA 3U0WL 3JWOC 2HRLA 4GAFB 1QSZA 1U8NB 4OT1H 5SX5K 1T1YA 3WUWB 3GSUA 5C07B 5M94B 2ICES 4L3AA 3BKCL 5IMLA 1P4BH 5DTFB 5CFHA 2Q3AA 4JPWL 4PJBE 3UP1A 1FC2D 4HPOH 2NY3C 4J7RA 3HNSL 3EFDL 4PD4J 2X1QA 2BSSB 4WI8A 5DJDB 1S7WA 3T3PF 2GT9B 3MCLL 3FQWB 3D25A 3ARXA 3IFNH 5FXCH 5HHPB 5C09A 1FNGB 3VI4E 4JZJA 4YDLB 3BT2H 5E94B 4BELD 5F7HA 2VDMH 5I19H 2CUIA 4EEEA 4UU9B 4HIJB 1JK8B 3REVB 3ECBB 3ZTJH 3N0PB 3QG7H 4I2XE 1TDQA 3ALXA 2VZTA 3MYJA 1WBZA 4XGZA 5EUOB 1ZXQA 2I07B 4EJ1C 1PY9A 2XFXB 3HUJF 3PDDA 5E9DD 2X4UB 4I48B 4W4OA 1QRKA 1IAIL 2E7CA 3MPCA 5CEXA 32C2A 5TDPA 1U8OA 5J0BA 4P5KA 4UINL 5K59F 3KXFE 5CP7B 3W0WA 2DLGA 1HDMA 3C5JB 3QUXA 3T3ME 4U7MA 2X4SB 3OQ3B 4K8RC 1RZ8B 3BRFA 2EXWC 3SDCB 3TPUE 1HNFA 2R29L 1GGCH 3LZFH 4I0PD 2ICWA 3HE6A 4ZQKB 2NPLX 2ZCLL 1KXVC 1MVUB 3ILPA 1AE6H 4Y19A 3K0WA 3WL9A 5IJVB 2PO6A 5C0JA 3P30L 1LP9B 1PZUB 2LV4A 1OCWL 3A6CH 5IMKB 1N4XH 4DCQB 4KGJA 3ELAT 4N1CA 1MJ8L 5CGYD 4Z77A 4Y2DA 4J6RH 5IQ9A 3UTSA 3LRSB 1YPZE 2V5RA 1K5NB 1QLRB 1HI6B 1BVKA 2UVEA 3PABA 1TVBB 3UTPD 4YDKL 1OWWA 4PLKC 3SCMA 4HKJB 1O7SA 1CGYA 1YMMD 5I66B 1D9KD 4JFZH 3D2UD 3PP4H 3MCKB 4Q6IC 3C8KB 1S5HB 4ZO7A 5F7EH 5I16A 2CK0H 2EYRB 4Z7UF 1GZQA 3M8OH 5D72H 5D9SA 2A1WL 4LEOB 4XTRC 1R3LB 4ZFZB 1MSPA 1FNEA 4H5SB 4XNUH 1T04A 4Y16C 5IUSA 1EEQA 1FYTA 5H37H 2F8OA 5FCUH 4XWOD 4OF0A 1CD1A 3RVVD 5J4MA 4YLQT 3LDBB 4XP5L 4MMXC 5EORL 1ZLWK 4CUCA 4FTVD 1F3JB 4CU6A 4P4KC 3G9VA 1OD9A 3RWGB 4TSBH 1EFXA 1DQQB 4DGIH 1H3TA 3RNQB 3HI6H 3KS0H 5DD0H 1CXFA 2GKIA 1J8HA 4GMSL 3FQUA 2EYTA 4OBRA 3L3HB 4KZDH 1IM9A 4QOKA 4K3DH 3NA9L 5H35A 2CLZA 4P2RB 4HAGA 1IAMA 2IH3A 4GSDL 3U83A 4J1UA 5T3ZD 35C8L 5IG7A 1WIUA 1W8NA 2X05A 3BN9C 2KKQA 4CADB 5SWSA 2R1YA 1DQLL 2QQKH 4FFWC 5BS0E 2Y5EA 4NNYA 4KRMB 4D8PA 4PTUA 3JV0A 1NCDL 5EZLA 3QEQD 3TN0A 1IL1B 2V17H 4NCC2 2A6DA 4TN9A 5EO0B 3HZYB 4I5BA 1EJOH 4ISVA 5ACZA 4ENED 4HJJH 1FHGA 5JQ6L 4TNVF 4FZEL 5ISZE 5L2KE 2OTUB 1G7IA 4LSSH 4TPRH 3JXAA 2Z31A 3G5XB 1P4IL 4GW4A 3WIIH 5HVWA 5IB5B 5I2IA 3NCCB 1MHHA 4NNXB 2OSLA 4P4RB 4MLIA 3Q1SL 1JGEB 3RZWA 5C08B 3IFLL 4HMCA 2R8SH 4OLUL 3BO8B 4H26A 3RPKA 4DTGH 4XT1C 4XP4H 4XVJH 1OAUH 2DJSA 2EDBA 4YBLB 3U0PB 2BSRB 3DO3A 4XBPA 3GUTA 2H32H 3F58L 4PJ9A 4XWGH 1NAKL 3C2SA 4Z5RA 4IEFB 2FBJL 4PY8J 5B8CC 4TTGA 1MY5A 3PGFL 3LS5L 1FH5L 4QHLB 4Y0GA 4LOUC 2F54D 1F4AA 3H3PH 2FD6H 3RGHA 1WF5A 1XGRA 3CFKA 1M71A 4JFOB 2E9BA 3V4UH 2EE3A 4X6DF 3HZKA 1NGWB 3D0LB 1N26A 3ZO0A 1EDQA 3AY4A 1WGOA 3CSBA 5D6DC 1K2DB 5EZOL 1FAKT 3VFUA 3SKNB 1UA6H 3MV9A 2HJLA 3LQAH 1A7NH 5JOPD 1XF3A 2YBRA 4I9WD 4N90D 3EO9H 4JLRA 5IFJA 1NGQL 2VL5A 2A6JA 1I7UB 5IROC 2HT2D 1DANU 1AGFA 3GJFB 1NAMH 4XCCL 1F6AA 3W9DB 4XPGH 2WQRA 4K94H 4PRAB 1T22B 4KMTH 1L4IA 2VLRD 4ELKB 1CD9B 4HBQA 1CFTB 2FECL 4HIIB 3VWKA 3HZVA 4OF8A 4Z7VB 5F93C 3NACH 3ZE1F 2QR0B 1WFNA 3BHBB 2C7UA 1JUFA 3DXAD 3CDGA 3ZKXB 4P5MA 3ZDXF 5F9WB 4LMQE 4WW2F 4U1GC 1T5WA 2J8UF 3QSKB 2WINB 4U1JA 4D9RE 5BMFL 5FYLD 5IMOB 1YNLL 4PGDB 3UTQB 2QADB 3MJ7B 4JHAH 2A0LD 4JFFD 2EDQA 1TJGH 5L88L 1CGSH 4ZSOE 4LRIC 1MJJA 5JW3H 4XMPL 3JZ7A 4AK1A 2L7JA 1OAYL 4PJHE 2VWEC 4M8QB 3CVIL 1LO4H 4KWUA 3SQBA 1J05B 3MLSL 4IIQC 4YPGA 1YEGL 5HHME 1UM5L 3S5LA 1HOCB 3STBA 5JUEH 1ERNA 2CRIA 4V1DE 1WC7B 5MENB 4O9HL 2B1AL 2YR3A 2HLAA 3CFJB 3CC5B 2X41A 4P3WA 1WLHA 1N7ML 4JZOB 1AGDA 3IXAB 2O93L 1CD0A 4NQDD 1P4LA 4RBPK 4UI2A 2HT4D 1CXKA 4UUJA 2PUQT 5EUOF 4YX2H 1M05B 5IB2A 3I75B 5MI0C 1X5GA 4LK4A 4WGWB 3UZEA 4HS8H 3PWPA 3PWLA 5FIEA 3CLEL 2XA8L 4U2YA 3LEVL 3V9FA 3DX6A 4QRPB 1EXUA 3AMKA 3L3OB 5TDNA 2W1NA 3VXNA 1ETZB 1GZPA 1DTUA 1A4JB 1OP3K 1JV5B 4N0YH 3K4AA 5LCVH 5D2NA 4HV8A 3MRLB 2AK1L 2EH8H 1OGAA 5LBSL 3MTRA 2Z0BA 1MY7A 2AERT 4XXCA 3VA2C 1E27A 4V3EB 5GJTL 1KCUH 4XNMB 1LP9F 3AM8C 2EO1A 1HEZB 1IEBA 2YHGA 2BVPA 3PUCA 5EBWA 3OKYA 4GS7B 4PJFE 4BH8A 5DWUL 2JELL 3QIUA 5F9AC 1IGYA 3FHAA 4P2QB 5DLML 4U6HB 2P5WD 2J12B 1CGXA 1QPPA 3G5VB 1PVHA 4Z8FL 3K1DA 3O6FA 2XN9A 3QCUL 4QXWA 2VAAA 1ZWIA 2IBZX 2AQ1A 3K3QA 4JO1H 2Y4SA 1DQDL 5HVHB 1G6RH 3D18B 3QZWB 3LEXA 4HLZH 2F19H 1KTLB 4OTXH 2F74A 4PJDA 5EN2B 1NBVL 1H8NA 5I1EL 1DJSA 1MFEH 1KELH 3F7PC 4L4TB 4JY4A 4NQEB 1UACL 2CIIB 4PGEB 1H3VA 4ZUWB 4FQXC 4K2UH 1S7XA 2AEQL 2A83A 3QI9B 4Y5XB 1I7ZB 3EKCA 1MRFL 5E2JA 3GHBH 3MV7E 3ZT6A 5GRXG 1JI1A 2UYLA 3STZA 1QRNA 3VXOA 1E6OL 2LTQC 2O61A 1EGJL 2DWEA 3MA7A 4G6JH 4KKCD 2AK4A 1LDPH 2BDNH 5D71H 3WFCL 1SVZA 5BJTA 4QRSA 4OJFH 4L9LA 4MDIB 5EU4B 4NM8H 3VGFA 3BH8A 4MA1C 4CN6A 4RDQG 1H15A 4C83B 1QFPA 4LP4A 4BM7A 3RWJA 4G7YL 1A9EB 1C16A 1NBZB 5HDQH 1ED3B 4JY6A 4Y4HB 2QADD 3IXTA 3WO4B 4B7LA 3FN0L 3K8LA 4MXWL 2GTZA 3BIKB 8FABB 4RA0C 3CH1A 4HKZA 4POZC 2VH5L 4U31A 4OLZL 1R3KB 1A7PH 4NN7B 3R0NA 3B5GA 2UWEE 3KJ4C 4NFCA 2GJJA 3RWDA 3CXHK 4MXVF 1YEFH 3Q0HA 2EICA 1R0AL 4XCEB 4U6VL 2VXUL 3T2NH 4CVXA 1NQBA 5F3HB 1XFPA 1SYVB 5CJQL 1NC2B 3FB5B 4V3DB 1RZKH 1TJHL 3GO1L 3GSOA 1FFPB 3P9LA 5AZEH 3GI9L 3VFOB 2VDLL 2XZQL 4LPYA 3UTTA 1YJDH 1JWUB 1UB6A 2FLRT 3VFGL 2DQGL 3PIQB 4QRQA 2YD6A 2XA3A 2DQCL 3FO2B 3DECA 5HYQA 5FHBL 3KR3H 4OZGB 3CVHL 2ESVB 3NPSB 5FO8A 3INUL 4X80L 1ZANL 1UM6H 2YRZA 3CFBA 2W9EH 1DUYB 4FXGA 3TZVB 5GS2D 3DMMB 3RX8A 1FC1A 1MWAA 2XG4A 4M62L 2BNUB 5F7MC 2AW2A 4LU5H 1I3RB 1IMHC 2A73B 4QRPD 1Y6MR 4XNXH 3GMMA 3DV6A 1MRCL 3FONB 5LKNA 3LKPA 5IR1B 4JGUA 1CF8H 1GHFL 1RUPL 1EAJA 4EVNA 2FGWL 1H5BC 5J1AB 1JMXA 2EH7H 3LVEA 1NC4B 4XCFL 2WUCH 3HNVH 1NCCH 2O5YH 3EW3B 3OR6A 4JCLA 2Y06L 3LB6C 3S96A 5IJKC 1KPVB 4AG4H 5I8KH 5T1MA 1LNUA 1YEDA 3QCTH 5E2TH 3P73A 4PJ7B 4LDOB 4F7EA 4WW2C 4P2QD 1S7UA 2EIZB 3BEWB 4KUCF 3EYFB 3S36L 3VXTB 3OGCA 2B1HH 1P84J 4HLJA 2R23A 4ZUVB 5DC9B 3IDYC 4POUB 5JXED 4W6YB 1WZ1L 1PKQA 3HAEA 2VKWA 1JHLL 2A6IA 4NRYB 3E3QC 3T8XB 2BXYA 3AXLB 4U1HB 5JIHA 3ZDYE 1TETL 4HWBH 4MNGE 3RPIB 1KGCD 3H9HA 1MCSA 4NYLA 3VGEA 1C12A 4ZFFA 4IDJH 1Y0LA 5IVZA 1U41A 4HH9A 2W60B 4FABL 4NQED 2BNRE 5LG1A 3QDME 3F6LA 4YHPB 2FX7L 4YHNA 5DYOA 5HGBA 2AGJH 3HCVA 3T1WA 2FSEB 4WUUE 1XR9A 2X70A 3QUZC 2NR6C 1HHIB 1RZJC 3CVHB 2GSGA 4XNZB 5DJ6B 2ZG1A 3WFDH 3FMGL 3U4BL 3GSQB 1OAQL 1EFQA 4KHXL 4QHKI 5HSFA 1IZJA 3VRLF 4M8VA 5I1JL 3T77B 2GITA 4MX7B 4GLRI 1UGNA 3BZ4A 2IGFH 3FFDA 2E8ZA 3W82A 1MFNA 4WHYH 4UIMA 5TE4H 5DJ8A 3P9WB 4E0RB 3SDCC 1FRGL 4HWUA 5IB4A 2GHWB 2ICEB 4NZJA 3MV8B 3HG1A 4Y4HD 4HKXA 3BZEB 2Y07H 3NAAL 1Z0MA 4YWGH 5C09E 5CBEB 1NANI 3G6DL 3GSWA 1FZKB 4HJGB 4PJEA 4S1RL 5F1KC 2BY1A 3VDAA 1CE1L 5JORA 4J3UA 3S98A 5KW9H 4GG8B 3QUYB 3BGAA 2DL2A 4BFIB 2KPNA 2UY7A 1LK2B 3B2UD 4TQEL 4YHOL 1TQCB 1HH6A 1NMCB 5K33A 3EOAA 1AR1C 4PP2B 1JHKL 1T7VA 1MCIA 1YNKH 2EDYA 3SQOH 1I1FB 3R1GL 4YHZL 2AV1B 2JB5L 2ARJQ 3OKLA 5GZNC 4X83A 4KTEH 3W0WE 2YWYA 4XC3L 2JJWA 2EE6A 2IQ9H 2ZUUA 3QFDB 5ELIA 1DLHB 4NBXB 1CDGA 3H42H 4M03A 2R0LH 2ESVD 2BK8A 5DJAB 1RFDH 2AXGA 1EK3A 2V2XB 3QO1B 1R5VB 4X8JB 1EEYB 1T7XA 4QXTB 2WLZA 3QPQD 4Y19E 2P5EB 1T66D 5HDOA 3AREC 3BRDA 1ITCA 1RMFL 1HHHB 3TVMD 5KSBA 1MFAH 1YY8A 2WWKO 3LDBC 4NGHL 2KQMA 3FRUA 4Y88A 1OB1A 1XF5A 4OFDA 3UTSE 2NLJA 1RK0A 4KI5F 2UY6A 4S11A 1RZIB 1BQHB 4ZD3H 2YKLH 4LRIA 5I71C 4HIHA 1DBJL 4AIZA 4EI6A 2WIIA 3HTLX 1IGFL 4V2BA 3S35H 5FA4A 2RQ8A 1NC4D 2BCKA 2XRAL 5E8PB 3V4PH 5J8OA 4PRHD 1MI5B 3SGEI 3WNNA 4IIQA 2NYYC 1FL6A 1R3HB 1M1SA 3TO4C 3WXWL 3X14A 2Y23A 2A9MH 3AUVA 5A2KH 2HFFB 1U3HD 1JHTB 2IMMA 3K8MA 4QHMB 1S9WB 3UPCA 4OFIA 1S7RB 1N8ZA 1FYTE 1PSKH 3CSGA 1K8IB 4KKBC 5HVFB 2BHZA 5HGDA 1T2XA 1T89A 1AI1L 3MROB 4NZTL 5E99H 3U4EB 5DMKB 5GSVB 4FQIH 4ZPTB 1PLGL 2FL5A 5FUCC 4RCAA 3HUJA 1IGTB 1KEML 3LN5B 3WD5L 3HE7B 1KNOA 4JM2D 3VU2A 4OIAA 1A3LH 2XKSA 1TENA 4JRXD 2PYEA 2W38A 3D6GA 4X4YA 5C7XH 1J8HE 4TTDD 2VDQH 4P46B 4QOKE 3RVWC 5GGTH 3BP5A 3RWIB 4JJ5B 4G9FA 4YBLC 2GSIB 5ESAB 1LE9B 1DDHA 2JF1A 2M8XA 4BSVA 1QLEH 2X5PA 5SWSE 1CDHA 1T21B 2LFGA 5H8DA 3SE8H 2ZZUT 4Z18A 1D5BB 4Y5YA 4OZGF 1EO5A 2ERJB 3C08H 5TH2A 1FV1B 1WBXA 3TBTA 5LWYL 1BIIA 2AI0H 3TCLA 1RZGA 2WUBH 3C5SB 4F7MB 2W07A 5IGXL 4QT5A 1LVEA 3NN8B 3ESUF 1HYSD 4UOJA 3V0VB 1L7IL 1ZS8B 2MWCA 1C8PA 1RUQL 1T3FB 5ESVA 4X8XA 2DQJL 4Z7WA 1VKXA 5FYJE 1JWMA 4Z7UA 1A02N 5CUSL 2CKBB 1QYGL 1B2WH 3B5TA 4NBYB 2DBJA 3DROA 4YQXL 4DKFL 1YEIL 3MO1B 4PLJC 2ATPB 3VW3L 4NUJB 4NCDA 5IEKB 2JJSA 3MRJA 3SY0B 3O2VH 7FABL 4OGYL 3QUYD 1I9IL 5DSCB 2PR4H 4PRDB 3TH4T 4C4KO 3KPSB 1WAAA 2KZWA 3ZKXC 3O4LD 4PJ7F 5F9WC 1JFMA 3U9UA 1HIMH 5I9QC 4EXPX 5CZXD 4NWUH 3GMNA 3GGWA 1OSPL 5E08L 2EO9A 3FB7A 2J6EL 4B7IA 5DD5L 3X17A 4NDMA 4NRXB 4U1IB 5SX4I 3MV9E 5KSAC 1J1PH 1NCWL 4YE4H 3VFWB 1YDPB 1FCGA 4LVOC 4U3HA 4F58L 1KC5H 1N0XH 4LFHD 3HPLA 4EIGB 2WANA 5CKGA 1CL7H 5E9DA 3VWJB 4ODHL 1G9NH 4DWHA 3SKOA 3QFJB 4LARL 1YN6B 5F9JB 1EPFA 5C92A 3L3GA 3UTOA 3NCEB 3HMWH 2AJSH 2H1PL 4MXQC 1KPRA 3RI5K 4I0PA 5I8CB 1RHHA 1M6OB 5D7LD 1JNLL 3MRRB 3VG0H 1P1ZA 2BVOA 5H2BA 4P3CH 3RY6C 4GG6B 4R8WH 4LRNH 3E2HA 5HGHA 1C5DB 5C0AD 4JN2B 1HH9A 1Q9KA 1FFOA 1RURL 2XXCB 4PB9H 3MBEB 3VFNA 1SY6A 1WEJL 2V7HA 4OD2B 4Z7NF 2C1PB 4ZOCA 4JFEB 1NPUA 3JWOH 1KN2H 3V95A 4M6NL 1N2RA 1LO3H 4LLDB 1D9KA 5TQ0L 3VXSB 2GK0B 3IJSA 3EYUL 3NMEA 4P23D 1KIQB 2X4TA 5FUZH 1JYNA 2W0FA 2GFBA 5E6ZA 3BEVA 4OLYH 4EZMA 5D1ZB 4KUZL 1H8OA 1LE5B 3BPCB 3VXUD 4X6DA 1GXEA 3LY6A 4WFGD 2HMID 3MA9L 3UX9B 3L5HA 1PX3A 4GS7C 2VLKD 3QULA 4FTVA 2FEEL 3LKQA 1A6AA 1OQOA 2DQFA 1Z2KA 2CRZA 4I77H 5HHVH 1MUJA 2HVKA 5I15H 3H9SA 2V2TB 3RL2A 1T03H 5I73B 2K1MA 5EULV 4AZ8A 5EO9A 2R2HB 2G60L 5F7DB 5A40E 1FE8L 3RAJH 3PWPE 4ZO6A 3CU7A 1NBYA 2BJMH 3ZZ1A 5D2NE 4K8RH 4BK5A 1OGAE 3FAWA 2VLLA 4HUUB 4IHOB 5MP6L 3C2AL 1B3JA 4XX1E 2VDRL 4ZOBA 1CFSA 3QEQA 4EBQH 3P0YL 1U92A 3I3BA 2J8UA 1U8PA 4RFOL 2L7UA 1T1XA 5FECB 3SDDB 3I02B 4X6FB 1U8NA 1YZZA 3WUWA 2Y72A 3KHOA 2X1XR 5C07A 1BGXH 4KI5C 4NQCB 4O5LL 3MRNA 3QI9C 4Y5XC 3RUGB 1EERB 5DTFA 2OK0H 3UYRH 2R1WB 2DBLH 1MWAH 3HC4H 1LO2H 2BSSA 5DJDA 3VMNA 2XN9E 5KAQG 2GT9A 2D7OA 4LEXL 1T1ZB 3D87B 4GO6B 3K4DA 1UZ8B 2O26U 2GCYB 2Q7YB 2Y1VA 3FQWA 5GS0D 2X4RB 5KVGL 3SOBH 5HHPA 5T33H 1UJ3C 3ZHDA 1FIGH 4QHUB 3QEUB 1VFBB 1FNGA 2IG2H 3TT3H 4HK0A 1I8LC 4MVBD 5E94A 4R7NB 1H3XA 2JJUA 2NTFB 5D7JC 4UU9A 1KTKE 5DVKA 3KNBA 4HIJA 3BGMB 1JK8A 3REVA 4PJDE 2RCSL 3ECBA 4EUPG 4Q58C 3WJJA 1C1EL 4N0CD 1FLRL 5CAYB 3H7LA 2NW2B 2I07A 4FS0A 1MJ7H 1QSFB 4BFEA 5DJ2B 2XFXA 4OCYL 5FOBB 4NN7C 4FFVD 4MHHG 1TCRB 2ZCKL 5ERWB 5FV1L 3TJHA 4F7CB 4RQQB 5CP7A 4OGAC 1R5IB 1QRNE 3C5JA 3HMXH 2X4SA 3TO2B 4OD3H 5F8RC 1RZ8A 5E6ID 2CRYA 2AK4E 3SDCA 1QR1B 3FJTA 1EBPA 3HAEH 4ZQKA 2BY2A 2FEDD 3TNNB 2EE9A 2NZIA 1XCQB 5IJVA 1ZHKB 1LP9A 1KJ2L 5FB8B 4CBPA 1G7HB 5GGVH 5T3XD 5DUPH 1UFUA 5L2JB 5IMKA 1Q1JL 4L3EB 5B38B 2EE2A 4DCQA 5CD3A 1J12A 4LAQH 3HR6A 4Y5VA 3SPVB 3LRSA 4W6WB 5INDB 4JFED 4MCZB 2W91A 4M7LL 1K5NA 1QLRA 3DMMC 4FP8H 4JPVH 1TVBA 3IKKA 5FYKH 1ACYH 3VD9A 1RAMA 4HKJA 5I66A 5IV2B 4XB7A 1JBJA 4LPCA 3B9EA 4RNRB 4OFYD 2IBZY 3DX7B 2BOBB 3SE9L 3OG4B 3MCKA 1AH1A 3C8KA 1S5HA 4FQLL 4KK5C 2QSQA 4RA3A 2EYRA 4LSVH 4RISH 1VPOH 5DMGC 3U7YL 1DBBH 3ULUL 1AD0B 5D7KE 4JFPA 5D70H 3MRIA 4LEOA 5D1ZD 5CJ8A 3UBXG 1R3LA 1NUDA 4LBEB 1VFAB 4H5SA 1BZ9B 4AENB 2DI7A 4HFUH 4LVNB 4ONOA 1BWWA 4JVUA 3UTTE 2XWJB 4GXUN 3BMVA 3VD3A 2G75B 2CMRH 2R9HD 1EZVX 1PX4A 4UB0H 4XPHL 5TF1L 1F3JA 1XH3B 3SE3C 4JFHD 3LH2H 3RWGA 3GSNL 1DQQA 3RNQA 1YUHB 3WDIA 2W0LA 1BBDL 3I6LD 4RMTA 3L3HA 5SWZB 2CDEB 5ADPL 5J9PB 3JWNC 4DN3L 4JY5H 4Y89A 1KCLA 5EB9A 4Z0XB 3V52L 4RWYL 2NNAB 1JGDB 3QQ3B 3NH7L 1OTTC 1DBKL 1CU4H 3BUYB 2DD8L 1K6QH 4OCWH 1IL1A 3VFRA 3HZYA 4WFEE 1E4WL 3T04D 2CDFB 1NLBH 4DW2H 1KIUA 5FGCB 4A6YH 2OTUA 3BKJL 5HHOD 1KJ2B 2XQBH 1AGEB 1FBIL 4JKPL 4PTTB 4ZS6C 4XHJC 4GG6F 3WSQL 2VXVH 3AS1A 4E41D 4NNXA 2BFVH 3P4OB 3G04B 4BSJA 2QSVA 1X5HA 4DUWA 4KKNA 1NDMB 1QO3B 1JGEA 4HXBH 4RGNE 5C08A 5AWNH 1NEZB 2OQJB 3S88H 1KG0B 3DYOA 3M07A 3UC0H 5CEZE 2C9AA 3QEGL 3BO8A 2A6KB 4WUKH 2P5WA 3QUMH 1PKQE 5KVEL 3U0PA 5F71A 2BSRA 4X6CA 2R2EA 3HHRB 5IBUG 4LL9A 3S3PA 5IQ7H 4LCUB 4QHLA 3T0WA 2VTFA 1HHGA 1UADC 1MHPH 4K71B 2YD7A 5GGUB 3IDIB 4JFOA 3RKDC 5F1IB 4YXHH 2VJXA 4NZUL 1RIHL 1YQVH 1NGWA 5F96L 3D0LA 1B6UA 1OTSC 4M3KB 1K2DA 4UMGA 1DBAL 3O8XB 3BKYL 1C5CL 4XPFH 1TQCC 1A7QL 1PEWA 2FWOB 4BQ6A 3GSNB 1FDLH 1NMCC 2ITCB 3WFHB 3CUPA 4FQCL 2VQ1B 4IOIB 3QXUA 4YHLH 3GJFA 3ZYJA 1CT8B 4R3SB 3W9DA 3B9KB 5C2BH 1JRHL 1NUNB 4PRAA 1T22A 2LU3A 1XCTB 4M5ZL 3O6MH 3MNWA 25C8L 2H2PD 4ELKA 3CX5K 4HIIA 1EEUA 3U0TB 2FH8A 1MFBH 2CIKB 5EC1B 4Z7VA 3H8NA 4L3ED 3MJ8B 2IJ0C 2QR0A 2C3XA 4OB5L 3E6HB 5TE7H 3LKSB 2ENSA 5FUOL 1RVFL 3BHBA 3HG1E 4RZCA 3QNZB 1WWWX 4GRLD 5EBMB 3UTZB 4MA8L 4PJEE 5ESQB 1FAIL 2PW2B 1R5WB 3UTQA 2AV7A 4NKQB 4JR9L 5JDJA 4BK4A 4UTBH 1F3DJ 4JPIB 4MQTB 1RIUL 1PDKA 3U7WL 1NL0L 4KDTA 2NW3B 1SEQL 2YD5A 4J2XA 2OL3H 4M8QA 4MS8D 4QXUL 4JO4L 2Q86B 3Q3GB 1J05A 4U1KA 3WN5B 3QA3B 4I8DA 1HOCA 4PJIB 2ID5A 3MUGB 3PF2A 4FXLA 4XMKH 5MENA 1BWMA 1TJIL 3MJ9A 2IAMC 1E6JL 2FLBT 3CFJA 3CC5A 3VFTB 2OLDA 3SO3B 4UT9L 5JA9A 4JZOA 3SJVB 3IXAA 5CBAB 4MLSA 1HKLL 5IESL 2VZ3A 5KSBE 3SGKA 5SWZD 4OLXH 4OGXL 5DRNB 1M05A 1KF9B 3HE7C 3I75A 4EIZC 5E8OA 4ODSL 1C5BL 2E7LC 5AG9A 4TULH 4TVPH 2IFFH 3PXHA 3QNYB 3QXDB 4X9GA 3L7FB 4QRPA 4P46C 2V7NA 3CXHJ 4S1SH 1ETZA 4HXAH 5CZKA 1A4JA 1JV5A 4GW1B 3EOBB 3MRLA 5FK9B 1IC4H 2BSTB 4UBDC 3D1MC 15C8H 4X6EB 4NFDA 1F3RB 1H3PH 3IDXL 1J1OH 1IZKA 1KENL 4FFZH 1I1YB 4YXKH 3L5XL 4ZXBB 3GHEL 4Z95L 1HEZA 1Z6JT 1N3NB 1HINL 3NZ8B 3T2OA 1Q9WB 1JZ6A 2C3HA 3ULVL 2K3TA 1INDL 2XTJB 3DUHA 4P2QA 5HI5D 3GBNH 4U6HA 3BZDA 2YUVA 3HUJE 5EZIH 4CW1B 3G5VA 4F57L 1JPTH 4OZIB 2PYEE 3CDYA 3FL7A 4LGRB 3RVXD 5FKAB 3AC0A 5JXEA 3MLUH 1OARH 4XPTH 4P2OB 3GB7B 2P43B 5DT1H 1WCQA 4P9HL 4G9FE 1I8MA 3D18A 1RUKH 1UWGH 3QZWA 3WFEL 1KTLA 3THMH 5EN2A 5L6YH 4M7JH 1AXIB 2NY7L 2VXQH 3O8XD 3QXWA 4L4TA 4NQEA 2CIIA 1UWEH 4ZUWA 1F11A 1A6VH 1RSFA 3QIBB 3QI9A 2I60H 1I7ZA 1W8OA 1X4ZA 3B9KD 3QQ9C 2IPKB 4JB9H 3E8UL 3BAEL 2AXFB 5F9OL 1L8JA 2G5BB 1F2QA 3TFKD 4ELMB 4LLQB 5I8EA 2ITDB 5ALBL 4Z7WE 5ITBH 2P46B 3CXDH 3X3FL 4Z7UE 3X13B 3BIAX 2ZUQB 4R96B 4WJ5B 2MNUA 1QFWH 4MDIA 1CN4A 5EU4A 1C7TA 4HC1L 3C6SB 5AZ2H 4C83A 4D0DB 3EDEA 1AGCB 1MCFA 3O3BA 3T0VA 4NQSA 2AXHA 3EJZC 2SEBB 1NBZA 1S3KH 1ED3A 4Y4HA 4AJ0A 2H26B 5J13B 4JRYB 2ZG3A 3E1F1 3JUZA 3BDBA 3ZE0F 3MLXH 3BIKA 1R3JB 8FABA 3IS0X 1WAAE 4ZTOH 4LSQH 5KVFH 5JR1L 1FO0L 5EU7E 3OXRB 1YNTA 3MBEC 2YZ1A 1BVLB 1EA9C 4XCEA 4DAGH 4GQ9H 4F37F 1MCBA 1SYVA 2ORBH 5HGGS 1NC2A 3FB5A 4XAWH 3QWRA 2NTSP 2YPLB 1FFPA 5E9DE 3UJJL 4PB0L 3VFOA 4D9RD 4WI2A 3QXVA 1JWUA 3MODL 5F70A 3ULUF 5E56A 3SJVD 1Y6NR 3QT2A 4OZ4B 3PIQA 3FO2A 3WS3B 4NM4H 4N8VG 1QKZL 3NIFF 3FQTB 5DEFB 1G6VK 4OZGA 2ESVA 3EHBD 1OTUD 2RR3A 2QQNL 3JWDL 5JHLH 1JNHB 3RWCB 3DUUB 5DRZB 3GMLA 5CJXA 5IM7B 1U8JA 3TZVA 2FIRT 2MCPL 1KLFA 3DMMA 1W72L 5HHMD 2BNUA 1FYHB 2Q8BH 5I17A 5IW1B 5ILTL 4TYUA 6FABL 1PBYA 2C1OB 5JPNB 1RZJH 4LHQB 5AYUL 1CICD 3C87A 4JG0H 2EDNA 3FONA 3ARGB 5IR1A 5I73C 3QIWB 4KRPB 1U9KA 3UTPE 2XWBA 1EGJA 3QDGB 1YMME 5J1AA 4ORGB 3SGDH 1NC4A 5FCSH 3CX2A 2DQIL 2IWGA 4F2MA 1OL0A 1KPVA 5KG9B 5L0QB 5HHNB 2VZVA 5ANMB 3VG9B 3VXRB 1U3HA 4PJ7A 2HKHH 2XTJD 5J56B 4X6DE 3TNMB 2EIZA 3BEWA 1O5DT 1I8IA 3S4SG 3EYFA 1ROWA 3RVVC 3SDDC 4M43H 3VXTA 5F89A 1MNUH 4LSRH 1CLZH 4ZUVA 1VGKB 2D0FA 4BZ2L 2XKNB 2WWMD 4RWHA 5GISH 4FTVE 5B4MD 4OKDA 4QHKJ 1FO0B 1UXWA 1Q0XH 4JM2A 1GAFH 1HE7A 3H9SE 3O6LH 4NRYA 2FNBA 4JREB 3U0WH 5C6TL 1G7QA 3AXLA 4U1HA 4WGVB 5E8DH 4J4PC 4LNRB 3RPIA 2OM5A 2FHFA 3ULSB 3CFEA 1QFOA 5IHBA 2H9GB 4ODXB 3BKCH 4R2GD 4ETYA 5TJWK 4PJIF 2ZUSA 4JPWH 4YHKL 4LHUB 5T3ZE 4KK9C 4G6AC 2E9WA 3O4OB 3RHWF 2P24B 3A6OA 4YHPA 1T83A 3EFDH 1J0JA 2FSEA 3KLSA 2J4WL 3PG2A 4N0RA 3MCLH 3QRFM 4HCRA 1HHIA 2WY3A 1NCAL 3QEQE 5FA3B 4XNYL 2J8UE 3L9RB 5JIIA 3VCLB 2VSCA 4MQSB 3P11L 3GSQA 1W72B 2WAHA 4LCCB 2FYYB 2ZOKA 5C07E 4XH2B 3T77A 2EC9T 1DLFL 2R15A 3QAZB 4LIQE 3G6JB 4QCIA 5HDBE 2VRAA 3M17B 4G8EA 3B5HA 4DZBB 4E0RA 3LSOB 4LSTL 2VXTL 2ICEA 5GRUL 3VH8A 3MV8A 2I27N 3P4LA 3HNTL 1IAIH 2QHRL 1ZA6B 3BZEA 4JHZA 4R90L 4UINH 1CLYL 3I6GA 3MV7D 1LILA 1AIFB 5CBEA 4H20L 3GMPB 4HJGA 1NCTA 1KB5L 2R29H 4IRZL 1A6WL 3ETBF 4GAJL 4GG8A 3QUYA 4BFIA 1UCTA 1LK2A 1J0HA 3B4NA 3MRDB 2ZCLH 3BXNB 1XF4B 2APBA 5MEPB 5FDYA 1II4E 3O9WD 3Q5YA 5F8QC 1DVFC 3P30H 4PS4L 5K9OB 4UV7L 1NFDB 4NO3B 3DHMA 1OCWH 4KPHL 4CN1A 1I1FA 4XP9L 2AV1A 1MJ8H 3O11B 4QRUA 4OZIF 3KJ6L 3PNWB 4U4BA 5IEHB 5DFVC 5JOPE 5ACLA 1KJ3L 5I1IL 2WBWB 4UOW1 3QFDA 4I9WE 4N90E 1DLHA 4Y1AD 4YDKH 1M7IB 3IFOA 1LEIB 5BQ7B 5DJAA 3UAJC 1S7TB 4M93B 2V2XA 3QO1A 5L7XL 1R5VA 1EEYA 4QXTA 3SKJL 4BKLB 2DMCA 4YIQB 1U8HB 1HHHA 2A1WH 4OCNC 1LP9E 3ZKNC 4GXUM 2A74B 4WWKB 4XP6L 5HD8C 3ARBD 4I3SL 5KS9B 4HPYL 5IK3B 1P5VA 3TH3T 1DUZB 1RZIA 4CAGA 1BQHA 5DJZA 5C0AA 3QDGD 4PG2C 1BX2A 4XP5H 5EORH 4IRSC 5FYLE 3WS6A 4ELMF 5E8PA 4P0DA 1MI5A 5J89A 4LCWB 2Y5TA 2AKRB 2DM7A 1R3HA 2WBJD 2F15A 3QHZL 1CDCA 3P0VL 1TPXC 4G8GD 3RGVC 4JGMA 1GGBL 3VXRD 4GMSH 1JHTA 12E8L 4QHMA 1S9WA 3IJHB 2YN3A 3NA9H 1S7RA 4G6KL 3FO9A 5EUKB 3MZTA 4GSDH 3ARZA 35C8H 4PDCE 3BKML 3C5ZB 3MROA 4LPUA 5GSVA 3T4YA 1DQLH 4ZPTA 3VXUA 3OJMB 3UPAA 2YUZA 2Z91B 1KB5B 2NCMA 1NCDH 1FNFA 1IGTA 4DUVA 3LN5A 1I9RL 3HE7A 1TVHB 5J1SC 4JDTL 3ULVF 2HT4C 5FGBC 5JQ6H 4GW5B 3H2WA 3GMOB 4FZEH 3ARPA 4HF5L 4P46A 3T0EC 3EFFB 2PXYC 1U2HA 3OJ2C 3RWIA 1P4IH 3DARA 1OAKL 4JJ5A 4I3RL 4LHUD 3OHXB 5DJ0B 5IBLD 5ESAA 1JYWA 1LE9A 2RHEA 1RPQA 1NGPL 3T1FB 3ULUC 4LSUL 2HJFB 3Q1SH 1T21A 4K3HA 4WCYL 4HX1B 3LRHA 2VR9A 4OLUH 4M02A 5C8JB 2P8PB 4YXLL 1FV1A 3H9YA 4X6BB 2XPGB 4ODTL 3F58H 3UCRA 3C5SA 1NAKH 5J06A 4F7MA 4G42B 3OKOB 4R6UA 1MLCB 2FBJH 3PGFH 2JCCB 2Y6SC 3LS5H 1FH5H 3NN8A 1J11A 3V0VA 2I9TB 1ZS8A 5F7LB 1T3FA 4IRJB 4L4VB 4U7KA 4M9OA 4KK8D 3DYMA 5IB3B 3QDMD 2CKBA 1LEKB 1IE5A 5C08E 2QTEA 3CSYB 4WUUD 5EZOH 3EDJA 2P5WE 4XCYB 2R0KL 1EO7A 2WV3A 5T1DL 2DQHL 2LABA 2BHUA 4Q6YA 4X6CE 2ATPA 1EZVY 4NUJA 5DK2B 1NGQH 2AJXL 4IMKC 3V0AC 3SY0A 2AAVA 5TE6L 4XCCH 5DSCA 2QEJA 4PRDA 5F6HI 2O5XL 5DK3A 2VZOA 3KPSA 2CLRA 4MVBA 4WTZA 2XTLA 1HXYA 3PE9A 4GRWF 2FATL 2NZ9C 4HMDA 2ZNXA 1BHGA 4J3TA 5IVOA 1B88A 4OIIL 1YEKL 2FZ3A 4NRXA 3NGBB 4U1IA 1ZT7A 2APVA 3VFWA 4XZUB 1YDPA 4ZYKB 3VGBA 2H3NA 1IGCL 4PJCB 3VWJA 3WJLC 3FRPG 5BMFH 4PP8C 2B2XL 3QFJA 1YNLH 1YN6A 5F9JA 1MCWM 4CNIA 1HILB 3WN5C 1IAOB 1RULL 3AB0B 5L88H 5EIIB 3G08B 4WWKD 4QF1B 4XMPH 4Z7VE 5I8CA 1OAYH 1M6OA 5JW5B 4F15B 3CVIH 2XV6B 3SO3C 5GRWA 3RY5A 3QHTC 3MLSH 1FZOB 5H94B 5LQBL 4BSWB 5HGAB 3FQNB 1YEGH 4GG6A 1UM5H 1C5DA 1S9VB 4YR6B 5BRZD 4JN2A 4JQVA 1WWBX 3KS0J 2YD3A 3MBEA 5GZOD 5KANI 1ODAA 2VLJD 4O9HH 2B1AH 3TP4A 2C1PA 3HE6D 4JFEA 1XGPB 4LCWD 2B0SL 2EDEA 3QO0B 1N7MH 3VFMB 3D39D 3MR9B 1YYML 4NT6A 3D9AL 2PO6D 4KJPD 2GK0A 4ALAL 5D1XB 4JFDB 4KAQL 1KIQA 2GI7A 4PRPB 4RGMB 2F5AL 4WNQB 4Y2DD 4PGCA 5IP4A 2DTML 2OZ4A 1BIHA 1OP5K 5D1ZA 1ZKAA 1LE5A 3GJEB 3CLEH 4OSUL 4Y8AA 1BJ1H 3LQZB 4O2CB 4UILL 5MENE 2WP3T 4FMFA 1NEUA 1UQSB 3CZFA 4ZXBC 5J11B 3TIDA 5FDWB 3F7YB 2AK1H 3GK8L 5CSGA 2DDQH 5LBSH 1NGYB 3BP6B 1H9VA 3CNKA 3B9AA 5GJTH 4PRNB 2V2TA 2J6EA 1KYOJ 3VRLE 1NFDF 1VFMA 1MCOL 2R2HA 5F7DA 2BZDA 1DN2A 3O6KL 3GSXB 5DWUH 2PNDA 2CXKA 1MJUL 2JELH 4P2OC 4QRPE 5DC0A 2DS4A 5DLMH 4E42B 4PRIB 3CH8A 2D7PA 4KJWC 4Z8FH 4HUUA 4IHOA 1FNSL 1X5IA 4K7PX 1WIPA 3QCUH 2RJMA 1P7HL 4WU7A 1S9XA 1J8HD 1U0QA 5AD0B 4QOKD 1DQDH 4QYOB 4ZUTB 5FECA 4MNHB 5KS9F 3I02A 4X6FA 5T1KB 4NQXB 3F6IA 4XC1L 5DUBB 5TGBA 4NQCA 5HHOA 3RUGA 4P2QE 1CG9B 2R4RL 1B0RB 4E41A 1NBVH 2X4NA 3BDYL 1NLDL 2R1WA 5DJCB 2MTPA 5EU6B 3S35X 4Z76B 5I1EH 1AKJD 1ES0B 4RMSA 1U58B 3X12B 1SJHB 1UACH 2AJVL 4H0GA 4J4PA 4EN3B 1T1ZA 2AEQH 1UZ8A 2GCYA 2Q7YA 4FA8A 4L1DA 2X4RA 3MGOB 4YZFF 1MRFH 3OJDB 2Z31D 1FGVL 3G6AB 1VCAA 4QHUA 4DK6A 1VFBA 3NIGF 3ZTNL 1E6OH 3KHQA 1J0YA 1EGJH 4MHHI 1IC1A 3WO3B 2NTFA 3K4ZA 1MCPL 2NY2D 4CMHB 3BGMA 3WFCH 4N9OB 4YBQD 1KGCE 5DURB 4F33B 2QHLA 5J13C 2AJ3B 5MEQB 1PW3A 3VE0B 4OZHB 3V6BR 2NW2A 5HBBA 3P4NB 4L4TE 1QSFA 5C0EB 4X98A 4NQEE 5DJ2A 1FNAA 2J2ZA 1Q0YL 4RFEB 3GM8A 5FOBA 1MLBB 3DVNB 4KI5E 3ULVC 1TCRA 4G7YH 5ERWA 4F7CA 3L3DB 3B2VL 4RQQA 2AJUL 1R5IA 3FN0H 3W81A 4MXWH 4S2SA 4MDJB 5GGSY 3TO2A 4GBXB 4YDIL 1T6VN 1DR9A 2VH5H 3V7MA 5EC2B 2M2DA 2O5ZL 4OLZH 1QR1A 3D3VB 5GS1C 3SKMB 1EHXA 3KAAA 3TNNA 1R0AH 4U6VH 2VXUH 4LHJB 1XCQA 2EIEA 4IJ3C 3PWVB 4ZAKB 3ZYOA 1ZHKA 5FB8A 1G7HA 3G5YB 4M48L 5CJQH 3ROOA 4KZEL 1MCCA 2Q6WB 5HYFA 1TJHH 5L2JA 4RDQF 3GO1H 4G80B 4L3EA 3C60B 5B38A 1BPVA 1RHFA 3GI9H 2VDLH 3SPVA 2XZQH 5INDA 4GXVL 4PJBB 3RY4A 4MCZA 4YPJA 2NY0B 3VFGH 5DMJB 4FQHB 4HUVB 2DQGH 2NY6B 3UBXI 2JCCF 2NY3B 2DQCH 5E8EB 2EZ0D 5FOJA 5FHBH 4RMUA 4RNRA 4UQ2B 3CVHH 3DX7A 4HDIB 4N5ED 4ODBD 5D1XD 4RAHA 4JFDD 3INUH 5EIQA 1JZ4A 4X80H 1ZANH 4PRPD 2OTWB 4WV1B 1QBML 5ID0B 4L1HA 5HYSG 3QIWC 3DIFB 1S78D 2EDTA 4KRPC 1AD0A 2JLLA 2BHYA 4KJQD 4M62H 2YA0A 4LBEA 2OTPA 1VFAA 1AQKL 1BZ9A 4AENA 4HD9A 5JW4N 4BH7B 2HN7B 2W0PA 4EI5B 5F7UA 2GUOA 1YEEL 2XWJA 2RGSA 2BERA 5IFAL 1YMHB 1MRCH 2G75A 1LGVA 1FZMB 3CX5J 3RIFF 3LPFA 1GHFH 1T1WB 1RUPH 2FGWH 4OZGE 2ESVE 1I75A 5DS8B 1XH3A 3BE1L 1CBVL 1DQML 1U93A 5CCKL 5IW6B 4XCFH 2YC1B 1EHLL 4KV5F 1YUHA 3H6JA 3ZKMC 2CUHA 2Y06H 1R6VA 4KY1L 2EC9U 5I30L 5C0GA 5KOVC 5SWZA 5J9PA 2N4IA 5K93A 3DTXB 4MCYA 1OPGL 3V2AR 5EPMB 4Z0XA 4PJCF 4JREC 5GRYA 3S36H 2NNAA 3FO1B 4WO4C 4URTB 1JGDA 3JTTB 3QQ3A 4Q97A 3BUYA 1T7ZA 1SJEB 1P9MC 1WZ1H 2VISB 3IDNB 4PRHE 1JHLH 2CDFA 3O4OC 3RL1B 3DPBA 1INQA 2XKUA 2V5TA 2ZUVA 1TETH 3VJ6B 1KJ2A 1F3DH 3PWPD 4PJ7E 1AGEA 4ZOEA 4PTTA 3JWDC 3MRHB 4Q6IB 5DHXB 1E0OB 5EU6D 5KN5B 3P4OA 2VC2L 3G04A 3U1SL 4FABH 1QO3A 1NEZA 2FX7H 2OQJA 4LCCC 4EN3D 5T1LB 4AQ1B 4WI3A 3MLVL 4AL8L 2A6KA 4Y2OA 2JKXA 3HB3C 4Y16B 1MCDA 3AS0A 3MNVB 4R0LA 5E4IA 4FHBD 5D1QC 3WNPA 3ZT7A 2Z9TA 3FMGH 4Q9RL 3U4BH 5F1SA 4DOHB 1OAQH 4LCUA 3LD8C 2F8VA 1FL5B 4KHXH 5HY9B 5I1JH 3QIUD 3HLAB 5F6IB 3IDIA 3DYPA 4F7PB 1JTPA 4P4KB 1KLUB 1EJ6A 1BBJB 3BGFC 4H0IA 5MEOB 5E7BA 1FFNB 2BRQA 1SQ2N 2WLYA 1FRGH 4JVWA 3O6FD 1BJMA 3O8XA 5F7YC 1D5MB 4NJAL 1JN6B 3NAAH 1DFBL 2FWOA 1A6ZB 2MSPA 2ITCA 2DJ4A 3WFHA 1JCKA 1XEDA 4GBXD 4S1RH 2VQ1A 1CE1H 5BS0B 2HT3D 5SWQB 1CT8A 4R3SA 3OAZH 1HYSC 3B9KA 5E2UL 3N06B 1QFWI 4TQEH 4YHOH 1XCTA 3TFKA 4ZTPL 3RTQB 3N85H 2X4PB 4FNLL 2ADIB 3TIEB 1V7ML 5EOCL 1A14L 1AO7B 2OJEB 4MA7L 4M1GL 2CIKA 1HSBB 5EC1A 4CKVX 1JHKH 4IMKA 3MJ8A 3MV8E 2DF3A 3GIVB 4L4JA 3E6HA 4AMKL 3LKSA 4PGBB 3MRKB 3R1GH 4YHZH 2JB5H 4ESKA 3QNZA 4R4FL 4TNVK 2ADJB 4XC3H 5EBMA 4NHUB 5IHZB 3REWB 3UTZA 2NY3D 1JYXA 3S3SA 5ESQA 1R5WA 1ZGLM 2DQDL 3EJYC 2D7MA 1FGNL 1TZGL 4JPIA 1IAKA 2D9QB 4S10A 4NWTL 4NC1C 5GRJL 3TWCL 5DMYA 2NW3A 5E00B 4MAYB 3S97C 1RMFH 1FNHA 3WJLA 5DO2C 3U2SB 4NGHH 4JANB 4FFYL 4LLUA 4QNPF 3DX8B 2Q86A 2W65B 2M26A 4HZAA 3V0WL 2E7MA 1PD6A 4GMTL 3WN5A 5KVDL 4S0UC 2AEPL 5C6PB 4G7VL 3MUGA 2ZOLB 2D4FA 4H8WL 4J12A 5CEYB 1DBJH 2ZPKL 4J8RB 1IGFH 5A1AA 4EXKA 3UO1L 2X4OB 3VFTA 2XRAH 3SJVA 5CBAA 3W5MA 1X5YA