3VXUA

The complex between t36-5 tcr and hla-a24 bound to hiv-1 nef134-10(2f) peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 68
structure length 274
sequence length 274
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxuA01
4HF5H 1YDPB 3SQBA 1Q0XH 3ARDB 2DM4A 3EJJX 2OR7A 3SKJL 4LPTA 1KF9B 4U6TA 5I1LA 1B6UA 4D3CL 1MNUL 3LHPH 3ZT6A 5JR1H 2IQ9L 3SY0A 1BREA 1XFPA 4P2OA 4TRPH 4UQ2A 1DBAH 1RJLB 4PD4J 3MGAA 1QO3A 4N0YL 1FZKA 3FO9A 3ZDXF 2X6MA 1TVBB 1RIHH 5F8QC 5GGTH 3RWGB 3I84A 3OV6A 2FZ3B 4QKXB 3V9FA 4MS8D 1K5NA 2HT3D 1G84A 3TF7A 3DX9B 3PWPA 3THMH 3NCYP 5ICYA 3IT8D 3F12B 3D3VD 1EJOH 4XWOC 3UJJL 1A7OL 4PY7A 3WO4B 2G5BA 1SBSL 1C7SA 3N06B 1MCNA 1S5HA 3PWLA 2VDNH 3DRQB 4TULL 5C6WH 2W07A 8FABA 4KDTA 1XZ0A 5HDBE 4D9RE 4MLSA 4PRIA 5F9JA 5JPNA 3VFMB 1U8HB 1P84J 4QLRA 1FV1A 3S96A 1U8PA 3QDGA 3LQMA 2VLJD 1JCKA 4YDVB 3MRGA 5K93A 3GKWH 3FQRA 4JQVC 3P30L 2ITCB 2W9EH 1FJ1A 2J8UB 4PJDA 2NY3D 1KGCD 4RA3A 3GJEB 1A4KA 1XGRA 3OAYH 3UO1L 4G59A 3RGHA 1JRHL 3E2HC 3H9YA 1NC4A 2Q6WA 2BX5A 4K7PX 1KIUA 1HI6B 3BRDA 4P3DA 1QTYT 3VRIA 1I3VA 1G9MH 4XP5L 1GHFL 4P46A 5F7EH 4QTHA 3S34H 4U1LA 1ZT1A 3BP4A 3NAAH 1A7NH 3C8KB 3QQNA 3GSWB 3L3OB 3LS4H 1F4YL 4HIXH 1N7MH 5AD0B 4PP1D 5DLML 1F11A 1R3KA 1MH5B 1S7SB 3B2UC 2W65A 4JANB 2FYYA 4YXHH 5CINH 1YJDC 2R1XB 3Q5YA 5LXGL 1KENL 1VACB 2EO1A 1QQDB 1IGFH 3T4YB 5C0EA 5E2JA 4PJ7E 5DDHB 2K7PA 3CIQA 5I1KH 2HT4C 3PDOA 4OGZA 1E6JL 3IRZA 4ZFZB 1P5VA 4M43L 3U30B 1DDHB 2H3NB 4KRPD 4G8IB 2IH1B 1RZIA 2BHYA 1A1MB 3IJHA 3C5ZA 5TDNA 1KTRL 4KUCF 1T04B 3D85D 4ZO9A 3FQUA 1BEYL 4ZXBA 1F8TL 4G9FB 1QR1A 3EOYG 3EGSB 3PWUA 4JQXA 5C7XL 2D7PA 5EWIH 3OX8A 4P3CH 4KXZI 1MFDL 4WI9A 1B4JL 4JFFE 4YHKH 5T1DL 2WP3O 4C55A 4Y1AE 4NKQB 3B5HA 1IQWH 4PRAA 3LOWA 3RX5A 2GJ6D 3VD4A 1RPQA 1XGYL 4JG0H 2O5ZH 2PN5A 1ZWIA 4XP1H 3P9MB 1OP3H 2YN5A 5IEHB 4YFEA 3T65B 1P7HL 4PRPE 1RZ8B 4TUOA 5D1XC 5IB5A 3I6GA 4MJIA 2BZDA 3CFDA 3IXTA 4X6FA 5F3HB 4OJFL 2R0LL 3ALXA 5JORB 2L7JA 1UVQA 1KUMA 5AYUL 2BVEA 1KG0A 5ACZB 2OL3H 3PXJA 1CFQA 4PG2C 3SDAB 4FQ1H 4IRSA 1FVEA 2DQFA 4X7TA 2YMXL 1VKXA 5FYLL 5HVHC 3SDCD 1INQA 5F88B 3D0LA 2ZCLH 1V5JA 1I1AA 4M1CD 4KVNH 4XPHH 5DS8A 2HMID 3ARFD 5IW1B 1MCRA 3DETC 3LKOA 3HG1B 2F53D 2BNQB 4GQPH 1S7VB 2CDGB 2EEBA 2AEPL 5FYJE 1G6RA 2DQIL 4OLUL 1REIA 2CIKA 1YJDH 3I02B 2OYPA 1AI1H 4NOBA 3TO2A 2AEIT 2VABB 5D7IA 5FKPB 1WTLA 5I1HH 1S9WB 1FH5H 1JRHI 2VDOL 4XP4L 1T2JA 1J86A 4EIZC 1EXUB 1QEWB 1OW0A 4P4RA 5BOZG 5IR1A 5F70A 4X7FC 4XZUB 3T2NH 1FNHA 4NO2A 4AEIH 4HDIA 4ZFOL 4PREB 5F89B 4KK8D 4P3WA 3KLAB 3HNTL 1ES0B 4AIZB 5L6YL 4YX2H 3GBMH 2NY4B 4AEHH 4HW6A 1BECA 4HKZB 5GRJH 2XN9B 5ESQB 4JZJB 4PRBA 4JRYB 4LPCA 5DJ2A 1XF2B 1KJ2B 3TIEB 3RNKA 3P9WB 5F7DB 3CFKB 3LD8B 4P5MA 3EO1B 5E8PB 4AENB 1FZJA 4U1IA 4K55A 1ADQH 1MCBA 1OWRM 3RIFF 3SGDH 3ZE1E 3KDMA 3RKDD 4LEOB 1WT5A 4PB9L 2DTML 4HLJA 1UM4H 5EBMA 1BLNA 4GW4B 1CGSH 4AM0B 2C9AA 4YBLB 4HPYL 2G75B 4I77L 2VLJE 1F2QA 3KLHC 1A5FL 3MV7D 5FEBA 1ORSB 5BRZD 3R4DA 4JFPB 5CEXB 3GSNB 4YDKH 4OD2B 1KGCE 5IV2A 5EO1B 4R3SA 1UB6A 3EJZD 3NACH 2COQA 4Z77B 3EIFA 2DQDH 5C0AA 4YEFA 1CDCA 3D2UB 4HGWA 4M48H 3C60B 1LQSR 3MGTB 1RUQH 4M7LH 5B39B 1R24A 2DD8H 1S3KL 1GGTA 4F2MB 2OR9L 2XQBL 3QISA 4M7KL 1X7QB 4KZEH 5C0FA 5L7XH 5DJDA 5BZWB 4DW2L 3OSKA 3QCTL 3TNMA 1CE1L 2CK0L 2E27H 2VXTH 3F7VB 5E00A 5GRZA 1BFSA 3F58H 4YXLH 3BWUC 4GRMB 3DBXA 3HNVL 1DN0A 3VGFA 2A6JA 3KPSD 3CCHB 3B3IA 3ULUF 1NGPH 1JGVL 4OIBA 4FMKA 5I66A 1XT5A 2GKIA 3BESR 2VTFA 5DC0A 4UIKH 1MCSA 1I9IH 4MZ3A 4NWTL 4H1LG 5EOTB 2P47B 2Y5TB 1EHLL 2IALA 3CSPA 2CXGA 1WWWX 2EO9A 3OGOE 3HLAA 3FRUA 4PP2A 2LABA 4OZIF 2QQKL 5IHLB 1PD6A 1J1OL 2MCG1 1XMWA 1FZKB 3L3IA 1OT1A 3O8XA 4UI2A 2J4WH 1MI5A 2A0LC 3OKLB 3T3PF 3QIBD 4BKLB 1K5NB 3FFCA 1I7ZB 1NKRA 5A2KH 5C86A 1QSEA 3CZFA 2UUDH 1UZ8A 1LP9B 2DI8A 3OAUL 3I9GH 3TF7C 3ARBB 2GJ6E 3BPLB 5BS0D 5DF0A 4OQTL 1A7QH 5JOPD 4WWKA 2JB6B 2BOCB 3ZE0F 2D0GA 3UZVB 4XCNA 4Z7QE 4YHML 2FWOA 5TDPB 4YFDB 2CKBL 3PGFH 3QH3B 5C6PB 1A6AA 2GITA 4WUKL 3MYZA 4PRIB 3MLVH 5T3ZL 5E24E 4XBPA 5EDXA 3OKEA 2J5LB 4KDTC 2RFXA 2EE3A 4HXAL 1IC5L 2YRLA 4LLUB 2ADIB 4WTZA 3H7BA 5BV7B 3S3JA 4H88H 2VR5A 3MFFB 3MCLH 2L7UA 2ZCKH 5I1EH 4G6JL 1MFBH 3F65A 5BVPL 1GAFH 3O45A 1U36A 2PYED 2NY6C 4OD3L 4JPWH 4JDTL 5EC2A 2F53E 3AS1A 1F4XL 4NJ9H 3LKNA 1I9EA 4AL8H 3WIHL 3MODL 2QADD 1UFUA 1L0XA 4JLRA 3QUYB 5JDSB 4FXGB 5E4IA 3S4SA 1UWEL 1E4XH 4M3KB 4N8VG 1ZT1B 3QUYC 4LDLB 3BISA 3S37X 3TVMD 4RRPG 1LWRA 4FABL 4X6EA 1P6FA 3HC3L 4OIAA 4L8CA 3HZYB 3L7EA 3LCYA 4NN7B 1TITA 2AJVL 4MAYB 3UJTH 5I8CB 1T2XA 1GGIL 3HI5H 1GGCH 4R6UA 5CWSB 5K59F 1MQKH 1M7DB 1R3HB 5AEAA 4QHKI 3QAZC 1CXKA 3D1MC 1UKTA 4M1GL 2KUTA 2Y9RT 1PYWB 2NXZB 4YK4B 2GUOB 1KIPA 5E9DA 1BPVA 5EU5B 3EYOA 4Z0XB 3UTPE 4YC2B 5E5RB 5E99H 4HUWA 1T7XA 4S1DD 4YK4C 1C5DA 2E6PA 4N8CH 2X4NA 1MHCB 1AGFA 3CVHL 4XWGL 1R0AL 3C5ZC 4HIEA 3NN8A 1ORQA 1WAAF 4F15C 4PJHB 4CU8A 2BMKB 2PXYD 3VFNB 4ZXBC 1P7QB 4KROD 4NQUA 3ARED 4PLJC 4NHUA 4ZYKA 5D6CB 3RL1A 5ICZB 3LS5L 4EDXA 4KI5D 1AP2A 1V7NL 2VDKL 3OB0K 1FGNL 5BZDA 3MV7E 1HDMA 2NW2B 2FR4A 1T03L 5BRZE 1RIUH 43C9A 4HQQL 2XRAL 5ETUA 1KEML 3HR5B 5CILH 4GW5B 3BGMA 4GRWE 1ZA6B 4HGKC 4UMGA 1EO5A 1UH4A 3CFDB 3GMPB 2H26B 3GSVB 1K2DA 4POYA 1MCEA 1BJ8A 3MJ9L 5EORL 2CIIB 2CKBA 3HI6H 3FB5B 1PDKA 4IOIA 4O5LH 4Y19D 5A2JH 3OR7A 3PGCA 3OJDA 1R6VA 3LQZB 1WC7A 2HKHH 2O26U 2GIYA 1QLEL 2B20A 1INQB 4K3EL 4DEPB 5GPRA 1Q9LA 2P1YA 3EO0A 3RPIA 5KANG 2YSSA 3TZVD 2APTA 1VFOA 3BJLA 5E5MA 4DEPC 3LKOB 1I1AC 3UPAA 4RIRA 3FO2A 3VFOB 1H15B 2DBLL 1JJUA 3LDBC 1FGVH 2WIMA 3KPSE 3MV8B 1KIRB 1PKQB 3ZHKA 1I85A 1IGCL 1G6RB 5D6DA 2IAND 4PJ8A 4CVZB 2P5WD 1S9YA 5JOEA 2R9HD 2RHEA 3WIHA 1D9KA 1LO3H 5D1ZB 1MFEL 1RFDL 5D1QB 4X4MA 2PTTA 4TPRL 2VH5H 4NKIH 5ESAA 1YEJH 4PJFE 4KKCD 4GMSH 3MLUH 5SWZD 3VFPA 4P4RB 1BBJA 3QSKB 5LWYH 3QQ9C 4U4BA 4MMZC 3TJHC 2PR4H 4ELME 3NCYS 2ID5A 2HFGL 1OW0C 4GJTB 3OBAA 2GK0B 4J2XA 1OCWL 3V5KB 3SKJH 2ZSVB 2FRGP 3GO1L 4IMKC 4D3CH 1MNUH 1XF3B 1T2QH 5FB8A 1RJYB 5IW3A 2XTJD 1QRKA 3WIFB 3OF6D 2IQAB 1WFTA 3U7WL 3T0BA 1QRNA 3BXNA 5MEOA 3OG4B 5BS0E 1GOHA 4N0YH 5JOPE 1MIEL 3QG7H 4UU9A 1U8LB 1AGBA 3OZ9H 2IJ0C 3GEWB 3VI3F 2ARJA 4S1SH 4PPTA 3JTSA 4RAUA 1U95B 3QQ3B 4OGAD 1I4FB 4ZS7H 3MRNB 1HHHA 1C16B 3L3HA 1NEZB 2HVKA 5JZ7C 1NSNL 3L7FA 1WT5C 1BLNB 3RZCB 2VL5A 3M8OL 4TVPD 3LEYH 2W9LA 5F7UA 1F58H 2VQ1A 1L7IH 1AIFA 2FSEB 3N1PC 2RJMA 4UQ3B 1KPUA 4D8PB 1EAPB 2MOVA 5I1AB 3O3EA 1BQLH 4QHKJ 4IMLA 2C1PA 4OCYL 4MXWH 1E4JA 3RGVB 4G8FA 4P5TA 1N6QH 1K4CA 3BEVA 4UV7L 1KNOA 1Z3GH 3MREB 1HK6A 4HGWB 2NQCA 5FCUH 3P30H 4B53A 1YYLH 4OZHE 3PWNA 3L3DA 3MJ9A 3RUGE 3C08H 5DR5L 4ZUVB 5A2FA 2IPKA 3B43A 5FUOH 2XICA 4RQQA 2F54A 1G6RH 3K2UH 1W0WB 4OCWL 3VG9C 1CGWA 1C5CL 3FB7A 3FQXB 1HHJA 1G1YA 2AJSH 1GHFH 2V2WB 1A6UL 4XX1G 3RL2B 3V5HA 2Y6SD 4LAJH 1CLOH 4UINL 3O6FD 3QUMA 4WW2B 3ZKND 1IBGH 3RTQA 2HT2C 1ND0A 1F4YH 3QHFL 1FYTD 3V6ZA 1BVKA 1JK8B 1Y18A 3L5JA 3IJSA 2DQTH 1GJIA 2ILLA 5DLMH 1AC6A 4Z78B 3T2QA 4LGPB 5F7MC 2HYMA 3MGOB 1Z9OA 3V52H 2GSGA 4G6FB 4RDQG 5HHVH 3GJFB 4AG4H 4X7EC 1KENH 1NC2B 4X4ZA 1W8OA 3FRUB 4JG1H 4QT5B 3NZHH 5K9QI 2VKXA 2Z4QB 1BD2E 4N5ED 5JW4M 2IPUK 4M43H 3DI3B 4WFFD 1JPFA 1RI8A 2X1OA 5D5MA 4WV1B 3UMTA 3SO3B 1ZT7A 5A2IH 1JPTL 2X9XA 3P0GB 2EKJA 2ATPB 2C1OA 3KS0J 3WFCL 1QKZL 4QRTB 1DBJH 2EECA 1I7RA 4J4PA 2AJXL 1BEYH 2Q76B 3QPXL 4JY6B 1WISA 3HCVB 5C7XH 1G7MB 2FWOB 2WP3T 4HKXB 3HZKA 4KK5D 4WWKC 1AGEB 1JFQL 1MFDH 1Q94B 3D25B 3S35H 3UTSD 5GS1A 4QHMB 5I76B 5J7CC 4PV8B 3OXSB 3EYSL 3GSQA 3MJ6A 5T1DH 5A3IC 2GITB 4LPWA 1I8MA 1XGYH 5I75C 5DA4A 3QWRA 1W8NA 3TBYB 2IEPA 4CUCA 3U83A 2BOBB 2APWA 4HAGA 1QLRA 4R0LB 4M6ML 2ICWB 5EZJA 2VZOA 2P24A 5I2IA 2EE9A 4LFHD 7FABL 2D9CA 4HS8L 4CL7A 1YN7A 5IB2A 3KPLA 4L9LB 4FQXA 2VN4A 5FHAL 1YMHA 2EDDA 4OJFH 5C0RH 4UTAL 2R0LH 4P2CG 4NCC1 1NGXB 4FZ8L 4Y8AA 3MMEA 2F9BT 1R3LA 4R4ND 5JLZA 5DQDL 5DUML 1M1SA 1KJMB 5FYLH 2O5XH 3EFDL 1KTKE 3MRMB 1KT2A 3MNWB 3DX6B 2R39A 4NFDA 1JMZA 4NM8L 1NAKL 4O02H 3RZWA 1F3DJ 2NNAB 5SWZE 1CT8B 2DQUH 1YNKL 4FG6C 1L7TH 3MLRL 3L3KA 4G42A 5GHWL 4BZYA 3L7EB 1IGMH 1DUYA 1XH3B 5L88H 4OLUH 3RI5K 2YKLH 4LSQH 4ONHA 4MQSB 4Q9RH 1LVEA 4YE4H 4EI5B 5LQBL 5ITFB 5ISZB 2C7UA 2XTJE 5ENWA 5DFVC 4EI5C 4WO4D 2ESVD 5GGSA 5GZOD 1LO4L 1NLBL 4WCYL 5ICXB 1JZ3A 4NSKB 4I4WB 1RUML 5C6TL 2E7CA 5IGXL 5DMGC 4DVBA 4XH2B 5K9KA 3IAQA 2I9LB 5TF1H 4I2XA 1EMTH 3MUHL 4G5ZL 1TPXB 3VFGL 2BFVL 2EKSB 5B39G 3U0PA 4LCWA 3WFBL 2VAAA 3EO9H 1J1XL 1I3RA 2A73B 4XTRC 1BZ9B 5GXBB 2ORBL 4NHUB 4D2NA 4OUUB 4TVPE 3D9AL 5C9KA 2XWBA 3SE8L 1LP9F 12E8L 2PYFA 1MAKA 2VN7A 2HJFA 5IJKA 5F7WC 3K1KC 3CPLB 4PB9H 2DTMH 1U8IB 4N1HB 1O7VA 4JFYA 4XHJD 3RVUD 2A6DA 2OTPA 5A16A 5IFHH 3OKNA 5AZ2L 2VLLA 2MQ3A 5C8JB 1ZT4A 1PZ5A 3FQWB 4LHUD 4H0IA 5FK9B 1I7UB 1A5FH 4NZDA 2ATKB 3MNZA 1A14L 4GAFB 4K94C 3X13A 5CZXC 2Z35A 3TA3B 2CDFB 1J0IA 1ZVYA 4CN6A 3KJ4C 1A9BA 1IAIL 2ZUQB 2O61A 3MRQB 3RPIB 4KDWA 2EIZB 5D7KD 1XGTA 4KY1H 4GUPB 5C0BA 1SY6A 3FN0L 4ALAL 2A2QT 3HUJE 4BELD 4YHYB 1HEZA 3FJTA 3H9SA 1S3KH 2W9DL 2OR9H 2XQBH 5FA3A 4YUEL 3H9HB 1FYTE 1II4E 1I85C 2CK0H 4PJ8C 3BOVA 2JE8A 5LJYH 1MCKA 4BK5A 2AERT 4NQSA 3HRZB 3JTCA 3BZ4A 3KJ6H 4QRRD 4ZO6A 1EERB 4P9HC 3A67L 1N0XH 4YHPB 1F4WH 1F42A 3W5NA 4N0CD 2IG2H 1U3ZA 4I5BA 4NWTH 5DJ0A 3TO4B 3V6OA 2AKRB 3ARTA 2NY0C 4JFDA 5EBWB 3MRPA 1I9RL 5J1AB 1UA6L 4WFFE 2AK1L 2J8UE 3TO4C 5FYKL 2EDOA 3VXTA 3BQUA 4XGZB 3OHXA 1T0MB 2BNRD 4LDEB 2QQKH 2BJML 4XAKD 1QFUL 5F97E 1RJCA 1FBIH 5E6IA 1DQDH 3T0EA 3HE7A 1JGUH 2D0HA 4YHNB 3UTSE 3UCRA 1HHHB 3TH2T 1YY9D 4U31A 2JIXB 5HD8D 2F8XC 4PJHF 1B0GA 5C08D 1P53A 1HQRB 3KPOA 1CDJA 4M5YL 1H8SA 4YHMH 2W0PA 3V0WH 4K94H 5J13C 4LKXB 5ELIA 4GKNB 2CKBH 4YFLI 4KJWD 4HUUB 2IAMB 3BDYL 5JTWA 1N6UA 1YNLH 3MRFA 3PL6B 2DWDA 3L5IA 1DLHB 4K8RD 1QSZA 2B8OT 3KS0H 5JUEH 1NCDL 2K9UA 1KIQA 1JHTB 1IM3A 1JGDB 1FL5B 1MCWW 2EH7L 4ZO7A 5ACLA 4NDMB 4KRNA 4MA3B 4R2GB 5IMOB 2F54B 3DVGB 4LP4A 5INCB 1F4XH 4UNTA 4L3ED 4R2GC 1N8ZA 3PHQA 1S9VA 4CADB 5H8DA 3E6HB 2X4RA 3MV9B 4IJ3B 3OL2A 4DN3H 4F7PB 2JB5H 2WLYA 2QL1A 1YPZE 1CE6B 2UY7A 3FMGL 1KTDB 3WNMA 3GMLA 4P9HH 4X6CE 1VENA 5DTFB 1VGKA 2OTUB 4XMPL 1IAII 2FEDC 3OR6B 2HKFL 4LLMA 3RTQC 3U46A 2A83B 4XCFH 2J3SA 4G8GB 4XBEL 1C08A 1M4KA 4KK9D 4IEFB 5B4MD 4Y4HD 5CMAB 1MJUL 4LCIH 1SEBA 5IVZB 3UZQA 4LNRA 5KSAB 4NN6C 1RZ7H 4JFZL 4JFQB 1HQ4B 5CEZD 2P49B 1EVUA 4AH2A 3BO8A 5KSAC 2J88H 3QR2A 5KG9B 3TBWA 4OLYL 1KV3A 5C09D 2R2HB 3VA2C 5FXCH 1Y6MR 3FOMA 4FFZH 4LKCB 4UV4H 5JO5A 1B0RA 4PRHD 3V7AE 1ZTXH 4KJYB 3JUZA 5JDJA 1LE9A 1J8HA 3DUSB 3IS1X 3VWJB 1CICB 2N7AA 4JM2D 4PB0L 1VERA 1JGLL 1UEMA 1ZXQA 3BN9D 3HG1E 3SPVB 2HVJB 1M05B 3WO3B 4EQ3A 5ID1A 1QFWM 5M94B 3STBA 3V7MA 3CH1A 4ORGB 1C7TA 5C2BL 5HYIA 4MHHI 3FONB 2IADA 4XRCA 5E8NB 3BGAA 1NUNB 4LSPL 4U6VH 5DVMA 2KL6A 5AZEH 5D7SH 2VDKH 5GS1C 4RFNB 5TQ2H 4NZTL 3MRIA 4IHOA 4J3TA 2FJFA 4NPYA 2I26N 1BJ1J 2HA1A 2P8MB 2AV7B 3ES6B 2HFFB 4CJ1A 1OVZA 4L3AA 4NGHH 1BFOB 1KELL 3BUYA 4XNMB 2DICA 5D7KE 3O9WA 4XNUH 3VFUB 4FQXC 1QSFD 1CXFA 5CGYC 3VXUD 2Z92A 2L0DA 4JRYE 4YIQA 1VPOH 2Z31D 3PDGA 1TIUA 2J6EH 2FX8L 4K3EH 5BXFA 3FQNB 5D70L 5ID0A 4RWYL 1T1YA 4FXLA 3B8YA 1OF2B 2Z8VC 5FYJU 1UWGH 3IDYB 3A0OA 3QUMH 1OP3K 5E03A 2AJZA 1IAKB 2DBLH 3U82B 3G5ZA 3X14B 3MA7B 4FFVD 1ZHKB 3DXAA 1EO8L 3TBTB 2Z91B 3GI9L 4JPIB 3WSQL 1WQVT 1XAUA 3IETB 4RX4D 4QRRE 4ONHB 1LO2L 1MFEH 2CK2A 4APQB 5LGJB 1BIIB 3MYJA 4K3JL 3FN9A 4WW2F 2UYLB 4WI4A 2AJUH 2FH6A 3GSXB 4NQVA 5HYJA 3QEUA 3N9GL 1PG7L 3DGGB 4NO0B 5DWUL 1WZMA 4LLVA 2C5DC 1HHGA 1X5YA 2HFGH 4V2BA 3WKNA 3ZSSA 1TVHA 4XAKE 2D31B 3FB8B 3K8MA 2SEBB 2Y36H 2WBJB 4U1SA 2VISA 4DJMA 1WFNA 1AHWA 4M6OL 3SE4A 1HXYA 2BSSA 5EPMA 1J9CT 3VXSA 5T1LB 2X05A 3U7WH 3ROOA 1RUKH 1MHEB 2FJGA 4U6XA 4GQ9L 3WLWC 1YNTB 1C1EH 5C08E 1E4KA 5HY9A 4MA7H 4Z7VE 2ZSWA 5TPWH 4JKPL 1MIEH 2JCCA 2VLRB 4W4OA 4XP6L 3MRKA 2FDBP 1N0LA 5CGMA 3CDFA 1R5VA 4JFYB 5IJKC 1NSNH 5DMKA 2ZCHH 4ZNCD 1YEHL 1SJXA 2W38A 5F3BA 5I1JL 1FLRH 5DURB 4O4YL 5CD5D 1F13A 3F5WB 5DRXA 1FNEA 4MAUL 1FO0L 5FM8A 3MOBL 2DMBA 4DZBA 3WV0A 3VXMB 1P4BL 3T08A 2YBRB 3KPRD 4JZNA 1OM3H 3MLSL 4LBEB 1FNFA 1HH9A 1T20B 2DDQH 4UV7H 3MRJA 2DS4A 4L3EE 5GGRA 1UXWA 2MHAB 3RI5F 4OZGB 1DBML 2OJZL 3O41B 2AJ3A 3P4NB 1LK2A 4RZCA 3C6LA 3QNZB 2H2PC 4XP9L 3BP5B 4L8DA 3UTOA 5GZNC 4KTEL 4PV9A 2NY2C 3FOLA 3VA6A 1C5CH 2QTEA 1RV6X 1AD0A 1DN2A 1XCTB 3B9KA 3NGBB 2H32A 3U0WL 4JHBA 5I17A 1A9EB 2GCYB 3RU8H 1IILE 5C0DB 2Z93B 3RDTD 1MRDL 4I0KA 5KN5A 4ODVH 3WEXA 2NX5B 2VLKD 2BNUB 4RGNB 4BA8A 5DMIH 2B39A 3SJVB 2V7HA 3KHOA 3H0TA 4KJPC 4DKFH 5CEZE 3QHFH 3PP4H 3GSRB 2QR0A 4RFEB 4RMWA 4J3WA 4YR6B 5FUZL 3VGAB 3RWFB 3JZ7A 4WTZG 4AQ1B 1I8KA 1MF2L 3RWCB 1JPGA 5C09E 2AK4D 3SOBL 2YPLA 4X6DE 3V6OC 4FQIH 1V3JA 3MCG1 3QEHA 4PRHE 2WY3A 5SWSD 3FO0L 4ZG1A 1OLLA 1T4KA 4L4VB 1QLFA 1P84K 1NGQL 2FJHA 3MPCA 2GEEA 3LN5B 1ETZA 1BX2A 5MEND 4LIQH 3S4SG 5TE4L 3G6JA 3WMSA 4J1UA 5E6IC 4MCYA 3SKOB 2FLBT 5T1KD 4EN3D 3HE7C 4P57B 1BGXH 1XIWB 5IUSA 2EXYD 2GTWA 3R06A 4PJCA 4ZS6C 3D69A 3DOSA 4OCLC 4WW1B 4ODBD 1XIWC 3QO0B 1F3RB 2AJXH 3O6MH 3D39B 4QCIB 4WNQA 2DKUA 4DQOL 2VE6A 4P2QA 4EJ1C 5CD3A 3VWKA 3F7YB 4XPAL 3GB7B 5B21A 1MHHA 4E41B 1BQSA 2HTKD 1GGUA 4LRIC 3ZKMC 1W0VB 5D2NB 5GJTH 2WINB 4HUXA 5I19L 3HC4H 4Y0GA 4QXGL 1QSFE 4X4XB 1V8HA 2PW1B 3Q6FB 1SJEB 4P9MH 3VXUE 1ITBB 1NBZB 4KRLB 3NA9L 5JHDD 2NW3B 1BP3B 2P4AB 2Q8AL 1IGJA 3PP3K 1KIQB 1SY6H 5T1MB 3CVIL 1N4XL 2NXYB 3GBNH 1HIML 7FABH 3QO1A 2ICEB 2NZIA 4QXTB 3UYOD 3UBXA 4FTVA 1FO0A 4NO3A 4HC1A 3BIAX 4FZ8H 4K2UL 1MWAB 3D0VB 2V5SA 3G5VA 5IFJB 3P2TA 2A6IB 2GT9B 5DUMH 1P4LA 4KKLC 4PJHE 3EFDH 4OLWL 5DJAB 3DVNB 3KWWA 2EC9U 4GKSA 4LCCA 3GSUB 3BKCH 1UGNA 4IRJA 1NKOA 4G9DB 3IU3B 1W72L 1NAKH 1QYGH 3QUZA 5L9DH 2BSED 3H3KA 3V4UL 4Y5YA 5BQ7B 4ZAKA 1YY8B 1GPOL 35C8H 3MLRH 4OLVH 4OZ4A 2E7MA 3M45A 1IKFL 3LKSB 5JA9A 4JFHD 5FA4B 1BOGB 4YAQB 2NTSP 1RUPL 5H94B 1HZHL 2XZQL 3UDWA 1J88A 1NCCH 1EFXA 1TJGL 2WBKA 1T1XB 4QOKA 3RWJB 4AH2B 3BO8B 3IFPB 3NCBB 1GZQB 4BSVA 5IHBA 5IVNA 2YZ8A 1KCUL 4PJIB 1N5AA 3C5JB 4Q6IA 5I1GH 2HRPL 3DO3A 3DIFB 4P23D 3QI9D 2CKNA 1TZGH 5DJXB 5HHNA 4X0KA 2B2XL 5KAQF 3HB3D 3S36X 3VFGH 2DLHA 3NMEA 5C07B 5ID1B 5GS2H 4HH9A 4OT1L 5C92A 5CP7B 4JY4B 3V4PH 3KYNA 2Q1EA 4PJBB 1JPSL 3R0MA 2I60L 1OSPH 1SYSB 2Z9TA 1LEKB 2A74A 4RFOL 4XPBH 3D9AH 1NCWH 4X9BA 1NDGA 4PJ5D 3IF1A 4WUUA 1DQLL 5CEYB 4L29A 4NPYB 3NFPB 4G80B 3V2AR 1JZ8A 4PGEB 3C9NB 4ODUA 1RVFH 1S78D 2HN7A 3ARGD 3I3DA 4YPGA 3KPRE 2VITB 5HGHB 4UAOB 4K23H 4G6AD 2OZ4L 2FL5A 3PQYD 4KKAC 5EBLB 4Y8DC 2DL2A 2IBGA 1A14H 1DQJA 3SBWA 4MSWB 2Z92B 3O9WC 1IE5A 2X4UA 1AD9B 4IIQA 3JV4B 4ZO8A 5BJTB 4ISVB 4ZSOB 3SEPA 5EIQA 1FVDA 3FO1A 4UILH 3TJEL 1EIBA 5BXFB 1N5YL 3DV4B 1RQ5A 3P0VH 2P44B 1J05A 3MRRA 5D8JL 5CUSL 2MCPL 1MCDA 1G7QB 2YUXA 1LMKA 3QIWA 4V1DB 4L1HA 4I8DA 1YMMD 5DGQA 3H3PL 1OGTB 4P48A 2ZUYA 4QRPD 2XWTA 1G0DA 5LAXA 4TSBL 5GS0C 3O4LD 1DVFB 4HLZG 1FORH 4GXUN 5TGBA 4M62L 1G7IB 4XCYA 3X12B 1P1ZB 4CW1A 1BJMA 1UB5A 3B6SA 1NFDE 1Z9LA 1W72A 4WFHD 5SWSE 4KTDL 5GGUB 4I3GA 3SE9L 2IH3A 1MCIA 3VXOB 4HX1B 4U49A 5BVJB 4AIOA 4WHYH 1RUAH 4JPVH 4X80L 2A77L 3CC5A 3A6BL 5MENE 5F9WC 3IVKB 2VZUA 4Q0XL 2P46B 1U93A 3U4EA 3UPRA 1AHWC 4JCMA 5FYKH 3SE4C 2G9HA 2CUIA 3TPUE 1P6AB 2FNBA 5DSCA 4D0CB 2B1HL 4HZLA 3HRPA 1RZJL 2WWMD 3QA3A 2R4RL 1E4KC 2CLRA 5I6XC 2R69L 5DI8B 3QG6A 1KLUA 4GG6E 4W4OC 5FGRA 1TETH 5FGBA 3MJ8A 5IB1B 2IPTL 4L5FH 3MX0A 3CGTA 5L0QC 4X9HA 4M5YH 3EYQC 5F72S 5JHDE 3TH3T 4HK0B 5K9QG 2AQ1A 3PIQA 4I0PD 3GUTA 1FFRA 3BDYH 4CGTA 4WEUD 4WEMB 2X4TB 1BWMA 2P7TB 1PX3A 4F7CA 4WDIB 1R5IA 4NFBA 5B22A 1NCDH 2K7QA 4O2CA 1SMOA 5EU6D 1JYVA 1BBDH 3MTRA 1ZE3C 4WU5A 1CIDA 5J9PB 3P77A 3OMZA 4M93B 2CR6A 2BERA 3SDXA 2JKXA 4JDVA 4NKOA 5GS0H 4PJEE 3FOLB 4NUJA 4LSSL 4MXVE 1RULL 4E5XA 2BSRA 5IBLC 5BMFL 4E0RA 1UACH 1U3HB 3U7YL 2FATL 5L2KD 4N0FB 2Q8BH 4JFHE 4HKJA 4HCRH 5T5NG 3VMPA 3TN0D 1Y0LB 1U3HC 2P5EB 5KN5B 2X4SB 3GMMB 3WEXB 5HHMA 4JRXD 3BP6A 1CL7L 1U41A 4Y4KB 4DOHE 3KXFB 3H0TB 3D48R 5C0CB 4YDLB 1HNGA 4Y4KC 5CBEA 5TF0A 1LD9B 1F6AA 1K8DA 4YDLC 1T6WA 2DQCH 3MRBA 1JNNL 4XBEH 5K33A 1WCQA 5DYOA 3BFOA 4PG9B 3W9DB 4HSQA 4QHLB 1DEDA 2EC9T 1W2KT 2DJ4A 2CJUL 5E2TH 4JFZH 1U92B 4FFWD 1AGDA 3FKUS 1CK0L 5SX5H 2FHBA 3RVWC 1WEJL 4J3SA 2EC8A 5HI3C 5DK2A 4FQQA 5D9SA 1FG2A 4HIHA 2Y23A 1S7QB 3L5XH 3QEQB 4PJ5E 3HZVB 5FUCC 5TQ0L 4ZFFB 4HEPG 5EO0A 4H26A 4PB0H 4WI8A 3R1GH 4Z7UE 3FCTB 1FAIL 5DO2D 1FIEA 2BCKB 2XOTA 5F1NB 5TE7H 2KZWA 4NQCD 5C2BH 2B1AH 3Q3GB 4LSTH 5GGRY 4NCDA 5EIIA 4LVHB 3VWKC 3G5YA 4U0QB 3HS0A 1U8QA 2PO6B 1G7JB 4M7ZB 4LVHC 3MR9B 2A9NL 2X7LB 4NCC2 3IFOA 4M7ZC 6FABL 3EYUL 1VB9A 1KN2H 3CMOL 1VESA 1KELH 1F02I 3VGEA 2D7TH 4YXKL 4PS4H 3UBXB 4HMDA 2Q86A 3QIUD 1FRGH 2AQ2A 4NO3B 4P5KA 5DZLA 4Z7WE 1GIGL 2XY1A 2FGZA 1HKFA 1FZMB 1YMME 4HXBH 2H32H 1FNSH 1KPVA 3GDBA 3VDAA 3S9DB 1R5WB 4OCNC 1IM9D 4OZGF 1M71B 3P40A 4ODHL 3VXRD 4M8QA 3O4LE 2YC1A 1KCSL 5IMMB 1ACYL 2GHWB 4LCCC 3SDDB 1EHNA 4Y5YB 1ZLSL 4FXKB 4MB4A 4ELKB 1U8NA 1EO8H 1K9TA 1MHPL 4Y5VA 5C71A 4WFHE 4Y5YC 3HE6A 5AYQA 4POUB 3RNQA 2QQQA 2RIKA 1VEOA 5FO7B 5CHNA 4PJGA 4RGOL 3NIDF 4Y16A 4RNRB 4DGIL 1WICA 3GMRB 5CSGA 3W0WD 1EZVY 3WXVL 2LQRA 1LDPH 3MO1A 3UDWC 4N0UE 1CFBA 5I8KL 3VH8B 3ELAT 1HSBB 3T3MF 1PG7X 4ZFOB 1YEEL 4XC1H 4L8SA 4QYOA 1CL7I 2E7LC 4Q6IC 1U6AL 2B5IB 3AFLA 1OT2A 4HG4J 1WVZA 3SDYH 1EZVX 1S7UA 1S7WB 2B5IC 4RMRA 2J7LA 4GAGL 3QDAA 1RZFL 3KYNB 1FFOB 4I18A 4Y2DD 3DV6A 5C3LD 4U1KA 4JKPH 2OSLB 3HA0A 3P9LB 1NDMA 5IJVA 5DRWA 4MQXC 1JWUA 1X6LA 4NKDA 3OAZK 1KCRH 3C5SB 4XC3L 3MRLB 4EXKA 4LLDA 4F57H 4ODUB 2DIBA 4CVXA 4GRLA 1PJ9A 2ZKHL 5DJZA 4YPGB 1A3RL 5IHZB 2EH8H 3HNSH 1RMFH 4BM7A 2DQJH 4P4KA 4KRMB 5EIVA 3TIDB 3OJMB 5HDQH 4MAUH 1FO0H 4F58L 3RIAK 3NIGF 4HC1H 1IC4L 1V3MA 1A64A 2HT4D 4PGCB 4EIGB 1UG9A 3WFHA 2Y5EA 3ZTNL 2X4UB 1O5DT 1T0NA 1NUGA 5GGVL 3L5WB 3SBWC 2DQHL 1QP1A 4IIQC 1JV5A 3BN3B 4KC3B 1JYNA 1VFAA 3DI2B 3A6OA 2FH8A 4CAGA 1AKJA 3TBVA 3BE1L 2XXCB 4NJAL 4Y4FD 5L2KE 1DBMH 2OJZH 3C09B 3I3BA 4KI1A 1U0QA 4JGUA 2ARWA 1IJ9A 3PHSA 5HDOA 4HHAA 4EVNB 3C09C 4JRXE 5HI4C 1MCPH 3QIWC 5FHBL 4KTEH 1HOCB 1IC7L 3CFIC 3VFVB 4Q7DA 3FB6A 1FIGL 4YQXL 2YRPA 1T7WA 1B3JA 3ABZA 3MXVL 5KS9E 3V5DB 2JK5A 4UUJB 3JV6A 2ZWLT 4LARH 1T1ZA 2VYRE 4BQBA 1CFNB 2BVPB 5D1XD 1LEGB 3TFKD 5IEKA 4X98A 5E2WL 3UTTA 3CSBA 4UTBH 4BH8A 4Z0BL 3TNNA 3L3JB 2EDHA 5FUZH 4S2SB 3BP7A 3FQTB 1MJJA 4MMXC 5GSVB 5L2JB 1H8NA 5D7JA 1U93B 4DGVH 2O5YL 3GKZA 4YLQT 3PNWA 2EIEA 3H2WA 2G9HB 4RMQA 3BD3A 4PJIF 4MX7A 3PABA 3BYTA 3G04B 2AV1B 2OI9B 2DIAA 4F8QA 2YUWA 3AS3A 2LTQC 1D5MB 3DETD 1EHAA 3B2VL 4YBQC 4EI6B 4NQCE 3EOAB 1YUHA 5C9JA 3CXDH 2YD3A 1A2YA 3MV9E 4HWEL 3ROLB 4FRWA 1U8OA 3U9PL 1MAML 4A2LA 4QWWD 4PJ7B 1AE6H 2VZSA 4Z76B 2RQ8A 3WS3A 1CZ8L 4PJBF 1JMXA 5FGBC 1RK0A 2ADJA 4K71C 2XNAB 4BZ1L 1ZGLA 5I73B 4G8GE 4BUGA 4UT7H 4EDWH 1XF4A 3HN3A 1GOFA 1JNHB 4PTTB 2V7NA 2Y4SA 1M7XA 3LPFA 5MERB 4DCQB 1KJVA 5T33L 2X4QA 1FYHB 4P2RA 5CIPB 4OF3A 5JW4Q 2DQGL 5FKAB 1R3JB 4R9HA 5D7LD 3NA9H 2YRZA 3I6KB 2ZUSA 2Q8AH 5HYQB 3S7GA 4JFFB 1N4XH 1N6VA 1HIMH 3LH2H 4Y1AB 1JIBA 3STZB 4B50A 4WHYG 4KUZH 4NZUL 5GGQL 3VXRE 3TV3H 3MV7A 5IB3A 4NQDD 1A3QA 2HJLA 3QDJA 3MLZH 4BH7A 4JO4H 1OP5H 1F6LL 2NY5C 4E5XB 4UNVA 4PRPB 1KN4H 1DANU 1KTLB 1Q0YH 1VEMA 2GAZB 3WYRA 5IG7A 4HWZA 3W9EA 3QWOB 2H6PB 4NNXA 1UJ3B 3TYFA 5HHOB 5LCVL 1QG3A 4OLWH 1EV2E 3OB8A 4JHAL 1JYXA 4HIIB 5J3HD 1CFSA 4YHOL 1FFNB 3DTXB 3D18B 1W72H 2AI0L 4XI5D 3T77B 2ITDB 4DKEL 1VFUA 1ZA3A 1U8KA 3KLHD 1IKFH 4GBXD 4JFEB 4ETQA 5DYOB 3M17A 5K9JL 1JN6A 4XPFL 4C56D 3U7AA 5IQ9B 2A6KB 1MEXL 3INUL 4Z7NE 1T66C 4NQEA 2XZQH 3VW3L 3UJIH 1RJZA 5IB4B 3BGFB 2XKSA 3KPSA 4R4BB 1MLBA 3IS0X 3ECBA 2P42B 5HPMB 5ANMB 3QZWB 4M02A 4OAWA 1FAKT 3QPQC 1OAUL 4B5EA 5E2UL 25C8L 1HHKA 1XR9B 1MIMH 5A2LH 4JPKH 4M9PA 2GFBB 3BW9A 4ODTL 2R1YB 4PJFA 2B2XH 3LZFH 5IKCB 1VADA 4L4TA 4Q9BA 1BFVL 2AEWA 2AP2A 2EZ0C 3CVHB 2PW2A 1WZ1L 1SQ2N 3MBEA 3K4DA 2JCCF 3TBSB 1H0DA 1A7PL 1KEGL 5DHYA 2I60H 1JZ5A 4RFOH 1X5GA 3O3BB 3REVB 2ERJC 1KXVC 1U8QB 3SKMB 4GG8B 1NAML 4RMTA 1DQLH 1SEQH 5D72H 1E4WL 3CFEB 4LK4A 2J1KA 3AXLA 1UQSB 2VC2L 3ULVD 3IDGB 4J7RA 3ULUL 3U36B 5IM7A 5BS0A 3D3VB 1MVUA 3CFJB 1PAMA 4RAVB 3NH7H 3VXQA 5JW3L 2HWZL 2EYSB 4HS3A 5FAAA 3T8XA 1V3LA 3OG6B 2NY5H 4LSRL 3RY4A 4KVCH 3DMMA 5IOPA 1AQDB 1QHPA 4OLXL 4X8JB 4P2OD 4BQCA 4Z5RB 4FQHA 1OAKH 5HGAB 2FHFA 4HF5L 4DTGH 2A0LD 1Q0XL 3SKNB 2I5YL 5D71L 2C3WA 1IGTB 2WNGA 2VLJB 1X5JA 3VDBA 3OWEA 2P43B 1D5XA 5JR1L 1FL3B 2JF1A 4XX1E 3SGJC 4YGVA 2P45B 2NY3B 3O2DA 5D8JH 3PWPD 1F97A 4IBLT 4QGTA 4TRPL 4Q2ZB 1DBAL 4LPXA 3Q0HA 2H9GA 1U8NB 4Y5VB 1OB1A 4DUVA 2ED8A 1A1NA 2GJJA 1MJ8L 3DUUB 4JAMA 4TSBH 3JUYA 1RIHL 2NTFB 4Y5VC 5GGTL 4B41A 4XNQA 3RVTC 3HE6C 3LV3B 1SJHB 1IQDA 1PEWA 1UWXK 2QEJA 3P11L 5HYSB 2BSTA 4M62H 1A02N 3RUGA 4Y16C 4AEFA 2E6QA 3ZKXB 3THML 3U2SA 1IEBA 1NBYA 4PGBB 3HAEB 3MROA 3QDGD 3ZKXC 4KTDH 3HC0A 4XBGA 5FOBB 4XPGH 4XXDB 2VLMD 1IZJA 1G7PA 5DD6B 2NY6D 4L1DA 2VDNL 1NGYB 2A77H 4PP1C 1X3DA 5BO1L 4OZGE 3LN4A 3ZHLA 4O51B 4L8SC 2DN7A 5IW6B 1NMBL 1NC4D 1P69B 1OGAA 4LCUB 3SCMA 3G5XB 2B1HH 2F74B 4I48B 4NM4H 4BYHA 2E8YA 3G6JF 3SQOL 3M07A 4P46D 3GKWL 2ZP0T 2BK8A 4KRPB 3FT4A 2R4RH 2W9EL 4GAJH 4FNLL 1U42A 5DFTA 1ACZA 1Z2KA 2EDWA 4MJ6A 3UPCA 3D85B 4F7TA 1TMCA 1BD2A 4RGNE 1NBQA 3GMNA 1ONQA 5JXAH 3SJVE 1E28A 1TQBB 3KPMB 3AS0A 5JPMB 1G9ML 4JN1H 2V9TA 3Q5OA 3TGXA 5I16B 5F7EL 4GAYB 5D7LE 5FO8A 3NZ8B 1RHHA 2XPGA 1GZPB 4LCYB 3NAAL 5A43C 1BQHB 3N1GC 2NLJB 4P4KC 1A7NL 4QF1B 4ZPTA 5M7QA 2GJ6B 3LSOA 1NAMA 3LS4L 4NQDE 2FHCA 4ZUTB 4HIXL 2PCPB 4GLRI 4XVSH 4TQEL 4G6KL 1T3FA 3P73A 1NGWA 3QXDB 2WSKA 3EDJA 5AAMA 4B0MM 2UWEE 4YXHL 3OXRA 5CINL 3C5ZD 4UNUA 4CNIA 1I1FA 1FZOB 3EJYD 2G60L 2OQJA 1IGFL 1BF8A 3VXPA 4ZXBD 3GMOB 5I1KL 4R90H 2BVQB 1V05A 3GM8A 5EO9B 1Q1JH 1RULH 3KG5A 2G2RB 4R4FL 1ZK9A 4POZD 3SDCB 5BMFH 5HI5C 4OZIA 3MJ7A 1NFIB 1CDBA 5FECA 2VOTA 3IDIA 1I7TB 3ARFB 2E6JA 3SDCC 1IGIH 4E41E 5IFAH 4C56E 4LLYA 4HMEA 4M1CC 2Q7YB 2C4FU 2F53B 3ARFC 1WSST 4F7MA 1DQQA 1EEZA 4NO5A 3D5OF 4X99A 3BHBA 2OJEB 4BH8B 1DANT 2ENSA 4DZ8B 3P0YL 5EWIL 4JFXB 2UVEA 3KNBA 1ZHLB 4MJID 4X7DC 3PGDB 1ZHNA 4HS6A 3N1QC 4YHKL 5GGTA 1A6TB 4YDJB 3BZFA 1IQWL 3UBXG 3FFDB 4OIIH 4QRSA 5JMOC 3QDMA 3HPLB 4JG0L 5D7JC 4XP1L 4IRSD 3NIFE 5C0JB 3QFJA 1CK0H 4N1EA 4LVEA 2ZOLB 2APXA 4OV5B 1I1AD 5I1CL 1KOAA 4LQFH 5HVGB 3DVIA 3BZEB 3MJGX 4KK8C 3C6SA 3F6LA 4EKXA 2VSDA 5TQ0H 3I6LD 4TN9A 1G0XA 3RIAF 4FQ1L 1IAMA 3WS3B 2XKNB 3K0WA 3ULVE 2ZCLL 4HT1L 3E3QE 4XPHL 4KVNL 2DWEA 1AO7A 1GGBH 3QQ9D 3ILPA 2V7NB 2YEZA 2DYPA 4GS7B 2A9NH 4H0HB 2D0FA 3RKDC 5J4MA 5KSBE 5IF0B 4DKAA 1INEH 5FV1L 1CWVA 6FABH 1TENA 4MNQA 4XHQA 3VH8G 1AI1L 1EJ6A 1K4DA 3ZE2F 5DJ6A 4JRWA 5I1HL 3UP1A 1B2WH 2VXUH 1XR8A 3MV7B 5E8OB 5BRZB 1OAYH 1Q9KA 3VGGA 4LGSB 3EOTL 3T2NL 2D4DA 2H8PB 5C07E 1UCBH 3QNYA 4GRWB 4NRXB 1YDPA 3ARDA 4O9HH 4WFGD 1RAMA 3GBML 4AEHL 1CFSB 5HDBF 5FGCE 5GRJL 3SO5A 5JZ7D 3EJZC 3RWHB 1ACYH 1CGUA 1I8IB 1DQMH 3DARA 1IC1A 4CMHC 2AS5M 1JI2A 3QDGE 1WAAA 1ADQL 5KSVA 1TVBA 5C0NC 2VLME 1CBVH 1N59A 3RWGA 3C2SA 2FZ3A 4QXUH 1LGVA 1CFTB 4LGRB 4DGIH 1TQCB 4PJDE 3DX9A 3KPSB 4LHJB 5KANI 3WXVH 1MLBB 3UROR 1UM4L 3MC0A 5JNYB 4YHZL 3IFNL 3UTZB 4PGDB 1CGSL 3CDCA 3F12A 5E8EB 5C0AD 2R29L 5GIRB 1IGYB 3DRQA 1H3UA 4BFBD 1HN1A 4JO1H 3T0DA 3X3GL 4ELMB 1K3ZA 3VFMA 3HI1B 1U8HA 1JNLH 4LLQB 1RZFH 3NACL 2YA1A 5FYLD 2YUVA 1CDUA 1CQYA 3RHWF 4YDVA 3MBEC 3QIBB 1NH6A 2ITCA 1RUQL 2VKWA 4PJ7F 4M7LL 4NN5C 2J8UA 4HJ0C 3GJEA 3QIBC 4OGXH 3GNML 4XC3H 3R8QA 2R2BB 5BS0B 5EBGA 1NMAL 5I74B 2ZKHH 5GGVY 1HI6A 2E27L 2VXTL 3KYAA 1UXSB 2W60A 5DK3A 3VXQB 3HZMB 4W68A 3T8XB 2IC2A 4YXLL 3O3DB 3BIKB 2O93L 3C8KA 3ZTNH 1CF8H 3AMLA 1NGPL 3DMMC 3GSWA 3T2OA 3L3OA 4TTGA 5GGVH 4MA1C 3OKKB 3WNOA 4FZEH 2HLFC 2YD1A 3O8XD 5KVGH 1MI5D 5AD0A 4JR9H 4J3UA 1MH5A 1S7SA 3EHBD 3FFCD 3QB7C 4JANA 1WZLA 4ZNEE 1QSED 3DYPA 4Z6AT 4AQOA 2R1XA 2PYEB 1WJ3A 1VACA 4MA8H 1QQDA 3T4YA 3BJ91 2H9GB 2A9MH 3IDNB 5DDHA 4WWKD 1TVDA 4EUPB 1IC7H 2QADB 4L8BA 4JO2H 4PBVC 2J4WL 4TNWK 4ZFZA 1FIGH 1DDHA 2H3NA 4MJIE 2R0ZL 4G8IA 2IH1A 2QADC 3O4OB 4OZHB 5I9QC 2BSTB 3EZJB 5JQHC 5FO9B 5EFIB 4NWUH 5I15H 1A1MA 3TVMB 4BSJA 3DSFH 2AXFB 3I9GL 2FD6H 1T04A 5J57B 3MUGB 1CG9B 1MCOL 4G9FA 3EGSA 1Y6KR 4F9LA 5BOPA 2VNCA 5DQ9B 3PGFL 1ADQA 3S36H 1OD7A 3GSNL 2P8LB 1ZLWK 3MLVL 2O5YH 3ARVA 3ARUA 1CD9B 2C4FT 2MJWA 2JJUA 4OKVB 3QNXB 3QRGL 3P9MA 3SGDI 3SCMC 5FM5M 5IEHA 1RZ8A 4KV5E 4MDIB 3WL9B 1NUFA 3B2VH 2YS4A 4H88L 4JKKA 2W91A 1MLCB 3MCLL 2ZCKL 4LSVL 2E9JA 5D7IE 5I1EL 4PG2A 5F3HA 1GAFL 4FG6D 4RAHA 5JORA 2XQYG 4JPWL 2LAAA 2Y25A 5ACZA 1GC1L 3SDAA 4NJ9L 1E28B 2EDLA 1QBBA 1EPFA 1CZ8H 4F33B 5J6HB 2PXYB 1X4YA 2EDBA 4MWFB 5IBUB 3LQAC 4KROB 3AREB 3PWVB 4L9DA 5F88A 1E4XL 3ZT7A 4WU7B 1RSFA 5DZNA 2PXYC 2HP4A 3QQ4B 1UM6H 1CQKA 5DFVD 5IW1A 3DX8B 5HHQB 4KROC 5DUBB 3KPQB 3LIZL 5EA0H 4OUOA 3CDGA 3HG1A 2BNQA 2CDGA 2CRMA 1H5BB 5HGDB 3WHXB 1EH9A 1T3FB 1ERNA 3TYGH 5E9DD 2DQGH 1AY1L 5DMGD 3I02A 1MRCL 1GGCL 4WFGE 2VABA 5F71A 5FKPA 5CS7A 2M8XA 1BM3H 1MQKL 3O2DH 5DEFB 1S9WA 3MLWH 4NZUH 1EK3A 4M9OA 4Y89A 3O0RL 3VXPB 3IDUA 4XTRD 2XKUA 4Y19B 4F7EB 1EXUA 1QEWA 4XZUA 1BQUA 3E6FB 5F7NC 5ILTH 3WKML 3GHBH 3IJYA 4UT6H 4YDIL 4PREA 5F89A 4N90D 5FECB 2V2TA 5LCVH 3IDIB 1ES0A 5E99L 3TZVB 2FLRT 4U1HB 4JHAH 2DM3A 4N8CL 3MRHB 5IHUL 4HKZA 1D6VH 2XN9A 3K7UA 1G7HB 5ESQA 4JZJA 1ED3B 2R0KL 3SE3A 2AI0H 3VFRB 4BUHA 4JRYA 1XF2A 1KJ2A 5IROA 3TIEA 4UB0L 2IANB 5F7DA 3CFKA 1UJTA 4MB5A 2P5WB 3EO1A 5E8PA 2CGRH 4AENA 4NQXB 1T22B 2MPAL 4XPFH 5C0AE 2JELL 5CZXD 3OKMB 5SWZB 4LEOA 3VW3H 2V5MA 1RIUL 2YD8A 5T3ZD 1JHLH 4UOW1 3KLDA 2CMRH 4M6NL 3IGAB 4GW4A 5CILL 4AM0A 5FYLE 3D6GA 2G75A 4WI5A 4S1RH 2XTJB 3HI6L 1MAJA 1ORSA 4O5LL 3ARQA 4JFPA 4R97B 5CEXA 3GSNA 3LQAH 4OD2A 2IMMA 2XTJC 1Q9WB 4FOMA 2ED7A 2HKHL 1JGEB 4PJ8D 5EO1A 3P3YA 1YN6B 4PRNB 5DUPH 1D9KD 2ADFH 1A7PH 4Z77A 3P4MB 2XZZA 3D2UA 1HWGB 1EGJA 3C60A 3MGTA 5HYSG 4XPTH 1NAMH 3BSZH 4U7SA 1E4WH 1JUFB 4F9PA 1AH1A 4F2MA 1X7QA 5BZWA 2NY0D 1LO3L 3HMWH 1A3LL 4OFYA 2VH5L 1MI5E 2WUBH 3F7VA 4NRZB 1YEJL 3MLUL 2AEQH 3FFCE 1QSEE 1QRND 4OLXH 5LWYL 2FBOJ 1G9EA 4WHCA 3CCHA 4Z7QF 5JXEA 4X5WB 1E4XI 1NCUA 5F96H 1V7MH 2I5YH 3ARRA 5D71H 1A6PA 1T2QL 3ARDC 1VFBB 5EOTA 2MWCA 4OBSA 3ZYJA 1T1WB 2Y5TA 3I75B 2DM2A 3S5LB 3EYVB 4MVBA 1MREH 3IU4L 1J8KA 4W70A 2MFNA 1ZGLP 5KSVB 1MJ8H 3QG7L 1N59B 4AYFA 3OZ9L 5AWNH 3OKLA 4U6HB 4S1SL 4BKLA 1L9NA 3P11H 3HUJB 5KSUB 1I7ZA 4ZS7L 3ZE2E 3O6FB 3QULB 1KB5B 1LP9A 4URTB 4G3YH 1T83A 3ARBA 4YZFE 4P5TD 1J0ZA 1FYTB 3ZKNC 4UOW0 3LEYL 1IFHH 4C83B 1FSKB 2JB6A 4ZOCA 1F58L 2BOCA 5HVFB 1ZEAH 1L7IL 2DBJA 2EXWC 4DUXA 5TDPA 2XY2A 1O0VA 3WO4C 3QH3A 3QCUL 5BO1H 2ZUXA 1BQLL 4L4JA 1IAIM 4MCZB 3JVGA 1NMBH 4MXWL 4QTIH 2CDEB 1N6QL 2QHRH 1A7BA 1K8IB 1T6VN 4LLUA 1N2RB 3SQOH 2ADIA 1Z3GL 1S7TB 4N9OB 5FCUL 3V6BR 1CDHA 1YYLL 3MFFA 4FS0A 2FEDD 4FNLH 4PRHA 5HHPB 3C08L 4XCEB 3RTQD 2ENYA 5FUOL 1OAZL 1G6RL 2JJVA 3K2UL 3CFBB 2KPNA 2Z8RA 4HWBH 2JJSA 3QWQB 2NY1D 1V3KA 2XV6B 3PHOB 4NHCL 2AJSL 2W60B 5JDSA 3QUYA 3MACL 3Q5TA 3BD4A 4FXGA 5E9DE 2D4FA 3UTSB 2CLVA 3CFCL 1I9JH 1ODAA 2HLAB 1CLOL 5MHSD 1IBGL 1NGZB 2Y7QB 4HH8A 5LKNA 1OQOA 4DK6A 2ADGB 2DQTL 3HZYA 4OF5A 4TQEH 3STLB 4G6KH 1KPRB 3V52L 4MAYA 2OR8A 4N90E 5I8CA 4PIRF 5HHVL 5CWSA 4AG4L 1YEDB 4KQ4L 2G60H 4JG1L 1M7DA 1R3HA 1ZLVK 4J4PD 3NZHL 1E0OB 4D94A 4GRWF 4YO0B 3PV7A 3V8CA 2YD4A 4L8BB 3IXAB 5H35B 4R4FH 1PYWA 4U1MB 2GUOA 4R4NC 5EU5A 4LLWB 4Z0XA 3RX8A 5I8OH 3QUKB 4WEBH 1ZLUK 2EYTB 4C59B 4MYWB 2R2EB 3NPZB 3AM8C 1JF5A 3U30C 3SGKA 3MBXL 1MHCA 1KB5H 3QWRD 4ZFGH 1DBJL 4HUKB 4J6RL 1KJ3L 5T3ZE 4HBCH 4WVRA 4PJHA 1MFCH 2BMKA 3VFNA 3P0YH 4J8RB 1P7QA 3S35L 1CXHA 1YPZB 4FQXD 4F9LC 5D6CA 2CLZB 3LEXB 5ICZA 5CGYD 4X6CB 4XMKH 1LEIB 2BHUA 3BMVA 2NW2A 2EIBA 4HPOH 4WO4B 3M1BB 2ESVB 3VFWB 1QD0A 4LPVA 3IDJB 4UDUB 1CXLA 5CSZB 3HR5A 4PJFF 4GW5A 5I1CH 1ZA6A 3H9ZA 5D2LB 5HHOE 3GMPA 1HWHB 2H26A 3GSVA 4QXWA 4ACPA 4MQ7B 5C0RL 4OB5L 2CIIA 3FB5A 5AUMB 4ELMF 2VDPH 2YPVH 3LQZA 1S7XB 5F8RC 3QXWA 3SDAC 1YA5A 2O5XL 4HT1H 3BT2H 3TT1L 1FDLH 4JFEE 1EFQA 4S10A 3GHEL 2V5TA 1MUJB 4O02L 3CDGB 3VFOA 1NCAH 4KAQH 1H15A 2DQUL 1L7TL 5CJQH 2E7HA 1QRNE 4B7IA 3DYOA 3MV8A 1IGML 1KIRA 1PKQA 5L88L 2R8SL 4CVZA 2YKLL 5ANME 4LSQL 5EUOE 4XHJC 5F1OB 3RVUC 4Z8FH 5D1ZA 4RA0C 3QHTC 4LF3B 5D1QA 4LHUB 4EOWH 5CCKH 4Q9RL 4TNWF 4YE4L 1I3GL 1PFCA 3TJHA 4LCWD 1L6XA 2BDNH 1OHQA 3EOTH 3WJLA 1U91B 3MSPA 4X5XB 1UKSA 4IMKA 5EG6C 3IJYB 2V2TB 2GK0A 1JWMB 3V5KA 2ZSVA 2R1WA 1XF3A 1WZKA 4ZUUB 1RJYA 5TF1L 3G6AB 4IS6B 1EMTL 3WIFA 1LO5B 2NY4C 2IQAA 3EOBB 4NQTA 3ZKSD 1CVSC 1KXQE 2X41A 3EO9L 4JZJC 2D03H 3SE3C 4NRYB 5MP6L 1PLGL 5IROC 4ODSL 1Q38A 4OZHF 5KVMC 3LD8C 3D3VE 3RUGF 1T0PB 1U8LA 3P4LA 1T89A 1OP5K 1U95A 5EZLB 3QQ3A 1I4FA 3MRNA 1C16A 1NEZA 4DVRH 1PBYA 2AXGB 4G6MH 4YHZH 2A1WH 3RZCA 3IFNH 4QRRB 1Q9OB 4XT1C 5IFHL 3S88H 3VFSB 4H25B 5TE6L 4OF6A 5C0BD 2R29H 2OCFD 2FSEA 2H2PD 4YBLC 1S9XB 3RWIB 4UQ3A 4N0CC 5GZND 4D8PA 1EAPA 5I1AA 2NY2D 3JV0A 3H9SD 3MLYH 3X3GH 4GW1B 3UYPA 2BNRB 3RGVA 2J12B 5DXWA 4WGVB 4LNVA 4KY1L 5B3JE 3MREA 1JNJA 5DZOA 1T5XB 3WBDA 1WCBB 3DYMA 3N1FC 4KJPD 1HSAB 4ZUVA 1OTSC 3LRHA 3C60C 3GNMH 4S0TD 5DJCA 1WWAX 2HTLD 2MQ0A 5C08B 1W0WA 5E1AB 1YEIH 4OZFB 4F9PC 1NMAH 1YY9C 4Z7VB 5HD8C 1XF5B 4HWNA 1G0YR 1GC1C 3FQXA 1R3IH 1A7RH 1BZ7B 4KI5F 4JFDD 5BW7A 2V2WA 1CU4H 4BQ6A 3BWAB 1S8DB 3RL2A 3CDYA 1P4IL 3BQUD 4WW2A 1I8LC 3L3GB 5F6IB 3KJ6L 1N0XL 1JK8A 1F4WL 5JXEC 5E6ID 4IDLA 3T0ED 2IG2L 5JHDA 3HE7D 3V79C 3KPNB 4Z78A 4HV8B 5DEGB 3DPBA 3MGOA 2CXKA 4ZS6D 3MCKB 3B9VA 4UDTB 4X4YB 5B38B 4HG4K 5ERWB 3GJFA 2CD0A 1KJ2H 1NC2A 3DROB 1EBPA 1F5WA 5F9DC 4QT5A 5GS2D 2Z4QA 1RURH 1IT9H 4MVBC 4XCCH 5LBSH 1FBIL 4L3EB 1DQDL 3ZKMD 4D0BB 2E3VA 5J1SC 1JGUL 5I1IH 1IEHA 5E6ZA 2R0ZH 4XVUD 1WBYB 4WV1A 3PF2A 1HXMB 4S0UC 3VJ6B 2ATPA 1NJ9B 4JE4B 3VG0H 4QRTA 1WBXB 1K3IA 2Q76A 1MCOH 1T83C 4JY6A 1RIVL 3ARBC 3BPLC 1FNAA 4GSDH 3HCVA 4KKBC 1G7MA 1TTGA 1PW3A 5DRNB 3ULSB 4K94L 3V0WL 4HKXA 1AGEA 4Y4HB 4O2FB 1Q94A 5I76A 3D25A 4ZPVB 4QHMA 3MUY1 4LSUL 4PV8A 1OWWA 3OXSA 4C57C 3O2WL 2ZG3A 4YEEA 1X4ZA 5H37H 3GSNH 5B4MC 1YNLL 4Y4HC 1YEGH 3U1SH 4KKLD 1L0YA 2J2ZA 4JN2B 1GH7A 1MQ8A 4GKZA 3TBYA 3JVGC 2XXMB 1HINL 3QRGH 3ZHDA 2BOBA 3GI8H 4R0LA 2ICWA 5JUEL 2J5LC 2WQ8A 4OCXH 5C09B 1LILA 3B5GA 1EGJH 1D5BB 4TUJB 4L9LA 4X6DB 4QHNB 3HFMH 4LSVH 2V17L 4PRHB 1J5OL 2WV3A 5BV7C 1S7RB 2ICWI 1NGXA 3PWJB 1GC1H 1TZHB 4JM2B 5T5FH 5KOMC 1MFNA 4CMMB 4JM2C 4GT7A 4CRPA 3MXWH 1KJMA 3BN9C 2JJSC 1H8OA 4G7VL 3S3SA 2CLVB 3MRMA 4DN3L 2JB5L 5H2BB 1JF1B 4LVOB 5GRXG 3MNWA 2YXMA 4HKBA 3DX6A 1JI1A 4P9HL 3LIZH 4I2XE 5HDLA 1CYGA 2NNAA 1CT8A 4DWHA 4LCWE 3PV6B 1DZBA 5KZCD 1FFPB 3G08A 4XCFL 4YNYB 1XH3A 3G9VA 4TUKL 3LKQA 1AY1H 43CAB 1BVLB 1MRCH 1H3XA 5F7YC 4LCIL 4NN7C 3EDDA 4MZ2A 4X9FA 5EUKB 1J8HD 1FL6B 2F58L 3MNVB 4EI5A 4MAYC 1RZ7L 5ISZA 5ITFA 1QSFB 5GISL 3O0RH 3BKJH 1MY5A 5FYKD 1U8MB 3VXUB 2HFEB 4HUVB 2J88L 3OKOB 3WD5L 2Z31B 3VD3A 3LKPB 4MD4B 2D7MA 1YECL 3GMQB 1FN4B 4YDIH 3WKMH 5ICXA 4FFZL 4NSKA 3WLBB 4UV4L 5E95B 2NXZC 4BSWB 1F90L 1ZTXL 4I4WA 3DO7B 3G6DH 5IHUH 4XH2A 2HH0L 4YC2C 2I9LA 5B3NA 2R0KH 3X11B 3SGKC 2YWYA 2EKSA 2IBZY 2ZUWA 4OFDA 3WUWB 1KYOK 2A73A 4UB0H 1BZ9A 4KKAD 4FFVC 1RZGB 2VZTA 3T1FB 4OD1H 3K8LA 4OUUA 5EULV 3HUJF 6CGTA 2CPCA 2MPAH 2VZVA 4U6VL 3UC0L 4J3VA 3PG2A 5D7SL 5AZEL 5C0BE 3VFTB 3O9WD 2JELH 4KPHH 5TQ2L 5DD1H 3CPLA 4OCRL 2NZ9D 1U8IA 4W6XB 3H9SE 4M6NH 4NGHL 5I0ZA 1HHIB 5GSRB 5BV7H 1GXEA 2OLDA 2WZPD 5C8JA 3FQWA 3BKML 5JA8B 5FK9A 4XNUL 1I7UA 3ILQC 2ATKA 1SYVB 1XGQB 4K7PL 4BQ9A 4NYLB 5K9OB 1SMAA 4PRDB 1E27B 5DJYB 3DXAD 4ONGH 5GS0D 1VPOL 3TA3A 2CDFA 2J6EL 1MCHA 2I9TB 3MRQA 3VGDA 4W81A 1YZZA 2EIZA 2J8UF 3BVNB 1XGUB 3OQ3B 4GUPA 1UWGL 3V6OE 3QUML 2B4CC 4JFDE 1IEAB 3IAPA 5HYJD 2PNDA 4ERSL 3FT2B 1BFTA 3RP1A 2VXVH 3CJJA 5D4QA 3H9HA 1QHOA 4JJ5B 4PY8I 5INDB 1A3LH 2JTDA 32C2B 3T0EE 3N1MC 5D1ZC 2AJUL 5JIIA 1AGCB 5D1QC 3VXSD 2E8ZA 3HRZA 3TESA 2VXSH 3OB0H 3KPRB 3O2VH 1QVOB 1I1YB 1MFAH 3WJLC 2ZOKA 4YHPA 5IMKA 2Y36L 2R1WB 3OPZL 2QJDA 3BMWA 5EC1B 5LGHL 3BH9B 3TO4A 2AKRA 4ZQKB 3NFSL 5EBWA 2ICWJ 3CLEH 5J1AA 3T4AB 5SWQB 2Y06H 3GIVB 4MNHB 1RUKL 4XGZA 3P4OB 1T0MA 3EYQD 3IU4H 1XGPB 1C1EL 4OFKA 5GJSH 4WFED 1ZVSB 3GGWB 2ZPKH 4MA7L 5TPWL 1FFQA 3TCLB 4PUBL 5T3XL 2JJWA 3RDTB 4EBQH 4YHNA 2VLKB 1T89C 3VI4E 3VRLE 2JIXA 3RDTC 1PVHA 2ZCHL 4JREB 3LKRB 5DQJB 3TH4T 5ESVB 3IDMB 3QXAB 1HQRA 1YPZF 1FLRL 3RZCC 3DSNA 3QJFB 4GO6B 4HIJB 4X6CF 4LKXA 4GKNA 5EOQL 1RK1B 4G43B 3C6LD 1NFDB 3QCUH 2IAMA 4HUUA 3ZMRA 2EYRB 5SWSB 2PYEE 5IBLD 3PL6A 3F62A 1OM3L 1DLHA 3OTTA 4XNZB 1BAFL 3ARSA 2BXZA 4WI7A 3B9KD 4YWGH 2DDQL 1J0HA 3N0PB 3ORJA 2B4CH 4XB7A 3RGVC 5MENB 2V6HA 1LO0L 1JHTA 5EZOH 4UIMB 5ITBH 4EN3B 5T1KB 1JGDA 1FL5A 1WBZB 5GRWA 4NDMA 2OTWA 4N9GB 5DJCB 3TPUB 3SGEI 4G8EB 3KYOB 4MA3A 1QR4A 5IMOA 1VEPA 1OAZH 3DVGA 5INCA 3GBLA 4NHCH 2X40A 3MACH 2J6EA 3RU8L 4CADA 3E6HA 5IESL 3MV9A 4DAGH 4F7PA 4GG6B 1AQKH 1VHPA 2YPLD 3ERYA 4ODVL 1CE6A 3CFCH 1KTDA 1A21A 5BW7C 5DMIL 2CSPA 1J8HE 3RVWD 3K4ZA 2KQMA 3O3AB 1DEEB 5DTFA 2Y1VA 2OTUA 5HI3D 4DKFL 3OR6A 3PP4L 5FYKE 4WW2C 2YK1L 1PX4A 5JHDB 4AT6B 2A83A 2XZAL 4G8GA 3DHJA 4JKLA 5CMAA 5I8EB 2RBLA 3DRTB 2DJSA 3E0GA 3F7RA 3T2PA 3QIUA 4FQIL 5IVZA 1BHGA 3J7HA 5KSAA 2H41A 4KQ4H 5DRZB 1FC2D 4K7FB 4JFQA 1HQ4A 3FHQA 5JW4N 3W5MA 2DAVA 4P2QD 4NT6A 3VWKD 5JW5B 3ZLQC 4JDZB 3SKUD 5KG9A 5KVFH 4LIQL 3V6FB 1F3JB 2R2HA 4LKCA 3V7AG 1BGXL 5SX4H 5C0IA 3UX9B 1CFVH 4KJYA 3MBXH 4K3GA 4KI5E 8CGTA 1KFAH 3FT3B 3DUSA 4PJEB 3VWJA 1Z5LB 2OM5A 1CICA 2WWKO 4WV1C 3SO3C 4JVUA 2VUYA 4QY8B 3O6ML 4R96A 4J6RH 5F6HJ 1KJ3H 3SPVA 2HVJA 1M05A 4ORGA 4PY8J 5B8CB 2W59A 1D5ZB 4X7CC 2B0SH 3FONA 4O58H 3GIZH 4OM1H 1CR9H 1QZ1A 1SVCP 5E8NA 4OGYH 3S35X 5GJTL 4DOHB 4FTVD 5CJOL 4WWID 5J06A 1GL4B 2XYCA 3BPOB 3HC4L 2QQNH 2K1MA 1DE4B 1GVIA 1FVCB 1MCJA 2P8MA 3ES6A 2AGJH 2AV7A 1J12A 2HFFA 4H20H 4P9ML 3BPOC 3KPPA 3IFLL 1SY6L 3GBNL 1BFOA 4P23B 4R0LC 2BVOB 3QI9B 2XACC 4IRJD 1KCLA 4XNMA 3NFNB 4S1QH 4NKMB 4KQ3H 3QUZD 4OB5H 3VFUA 4L9LC 2FIKB 4XXCA 4ZAKD 3PJSB 3EDEA 5F9OH 5HYJE 4AEEA 2VDQL 4QO1A 2IANE 4F8TA 2P5WE 5FFLA 3KPTA 3A6CH 3TT1H 1DBBL 5E4EB 2XA8H 3FQNA 3BKCL 3EYFB 4PJ5B 4HKBB 2I24N 3GHEH 1EEUA 1OF2A 1QFHA 1QYGL 2LAGB 1EFXD 5L9DL 4QOKD 4F3FB 5ALBH 1IAKA 4Z7UB 3ZYIA 3VXSE 3X14A 2V2XB 3MA7A 3L9RB 35C8L 1ZHKA 4OLVL 4Z7VF 3W2DH 3DGCR 1J0YA 4J23A 3G08B 3ARGB 3TBTA 2Z91A 4JPIA 3LKQB 2R8SH 3IETA 2M2DA 1TCRB 5GRUL 5DVKA 3PQYB 4X5LA 1OSZB 4APQA 5LGJA 1BIIA 3GJFH 1ZS8B 9CGTA 1NCCL 2UYLA 1I3GH 3IKCB 3GSXA 3T1WA 4IM8A 5H37G 4OLEA 2Z8WC 5I71B 1E6OL 3DGGA 2EICA 4NO0A 2X9YA 3EDKA 5I1GL 1TZGL 4WFEE 2D31A 3FB8A 5I71C 2SEBA 1UKQA 2WBJA 2FBJH 3DX7B 4WUUD 4U1JB 1IVLA 4Z7WB 5HHXH 4HFWB 2X1XR 5T1LA 1YMMB 1J1PH 2QSCH 5TH2B 4WHTB 2OP4H 1EAJA 4QRPB 1MHEA 1TPXC 2GY5A 4FQCL 4ENEC 5MP6H 3V4PL 1PLGH 1YNTA 3WFEL 4A6YB 3U6RB 1SBBA 1OSPL 5HSFA 1JP5A 2LU7A 4ODSH 4XPBL 4AK1A 1NCWL 3O4LB 4PR5B 1QUNA 2VLRA 4R7DA 1OP9A 3CUPB 5F7FA 5E56A 4U6YA 5E5UB 2I27N 5MEQB 1U2CA 2ARJQ 4F37K 1RVFL 3WN5B 3TFKA 4FQJL 4H8WL 3RIFK 2ZJSH 4K23L 4H1LB 5TE6H 4FQLH 3DUHA 3ZZ1A 1MCQA 3F5WA 5IBTH 3GRWL 5HI4D 4D9RD 1MWAL 3QIWD 2NMSA 3RA7L 1KLGB 2FGWL 3OJ2C 4ZOEA 4N0UB 3OGCB 5B38G 2GTZB 3ZT5A 3VXMA 2YBRA 3CX5J 4UILL 4XMLH 2YPKB 4LBEA 2DQEH 3ARXA 1T20A 3TA3C 4X6DF 2MMXA 1INDH 1DL7L 3P0VL 4OI7A 2MHAA 5DT1L 2ZUQC 1D5IH 1QFWH 4OZGA 5F9AC 3O41A 4GXVH 4JM2F 5FV2A 3P4NA 2YPLE 3QNZA 3ZKQD 3B83A 2D9QB 1Z0NA 3BP5A 5FDWB 1FE8H 4YHYC 3X3FH 5HXMA 1XCTA 1L8JA 2IWGA 4XVJH 1FORL 4X9GA 2X89A 2HG5B 1A9EA 2GCYA 2DLFH 1UM5H 3QBTB 5C0DA 2Z93A 3CLFL 4PGZA 1PEZA 5HVWA 1HILB 4I0PB 1P4IH 3U0TA 4CN4A 2NX5A 2BNUA 3SJVA 1OAXH 4NOFA 4QNPF 4KJQC 2ZOKB 3GSRA 2F5BH 5IMKB 4RFEA 4JZOB 1RUAL 3WFZA 4P2QE 5LGKA 4YR6A 4JPVL 3RWFA 2P8PB 4OCMC 1HNFA 5EU6B 4NP4L 3RWCA 1CLYL 15C8L 2BY2A 3RWDB 5MI0B 4CVWA 1ZGLM 2N1KA 4Z7OE 3K74B 4FFYH 1QOKA 1TDQA 4A6YH 4KU1A 4L4VA 4G7YH 3V4VH 2XT1B 3LN5A 4N8VB 5L2KB 4D9LH 4ODWB 4U1GB 1VGEH 3TN0B 3S98A 3SKOA 4U0RB 5C1MB 4P57A 1XIWA 4JRXB 1TETL 4QRQB 1JZ4A 1P2CB 4L5FL 4WW1A 3REWB 3QO0A 1OPGH 3D39A 4QCIA 3CNKA 4LRNH 1RIVH 5KS9B 4LRIA 1U8JA 3F7YA 5DGRA 3GB7A 4KHXH 1AXSB 1K6QL 4E41A 2X2YA 1AXTH 4LSUH 3O2WH 4Z9KB 1W0VA 2WUCH 3TT3L 4YPJA 5D2NA 1FNGB 2FO4B 2WINA 1CGVA 2VDMH 3GSOB 4WGWB 2IAMC 3OKDB 4X4XA 2C3VB 2PW1A 4WJ5B 1HINH 2EDRA 3PL6C 1SJEA 3Q6FA 4PJAE 1NBZA 3O11B 2VIRB 2NW3A 3QFDB 1D6EB 5T1MA 3VXNB 1BBDL 5EU7E 2ICEA 4QXTA 5HHMD 2X4OA 1A6ZB 2V17H 1J5OH 2OTWB 3LPGA 5FM5O 1NCNA 3GRWA 3EFFB 1MWAA 3D0VA 5GS0L 5IFJA 4JGJA 2A6IA 4QOKE 5DK0B 1OTTD 2GT9A 2J8OA 1WFOA 1QBLH 1UACL 3L1OH 4NQCB 1QA9B 2Q8BL 5CBAB 4G7VH 4HCRL 5DJAA 5DO2C 3DVNA 4XNYH 1AFVL 2VERN 3GSUA 4IJ3C 4G9DA 3IU3A 4Y7MA 3QPQD 2IFGA 1MOEA 5BQ7A 4M4RA 1YY8A 1JWSB 3E3QA 2ESVE 3LKSA 2DQCL 1PY4A 2W0FB 4TUKH 5FA4A 5JOFB 1JTOA 1BOGA 3EBAA 3OAYK 4ZD3L 4JM4H 4A2MA 4YAQA 4RSVA 3HMXH 2C3XA 5H94A 5D2LE 3AS2A 3QIUB 2EZ0D 2F58H 4WUUE 1O7SA 5E2TL 5GISH 2YOCA 3VRJB 5CAYB 4M61B 5KSBA 1I3UA 2YD2A 1IMHC 1T1XA 3QIUC 3RWJA 3IFPA 1GZQA 4NT6B 5KBNC 4PJIA 3WD5H 2KQNA 1IM9B 1YECH 3C5JA 3MRDB 1T5WB 3DIFA 4MDJB 3VXRB 5DJXA 2D7NA 5C0IB 1EHXA 1F90H 3L5XL 2RCSH 3OJVC 2HH0H 4E42B 1U9KA 3R1GL 4R96B 1DFBL 5C07A 3VWJC 1CICC 5TE7L 5CP7A 4JY4A 2B1AL 4LSTL 4PJBA 2XTLA 2WQRA 1SYSA 5DD0H 1LEKA 1HYSD 3UC0H 5E94B 1LNUA 3JTTB 3W0WB 2B7DT 4KFZC 1WWBX 5CEYA 3NVQA 4OCRH 4Y5XB 3ZL4H 4YHLH 3NFPA 4G80A 4K7PY 4RFNC 4PGEA 3C9NA 4K3DL 3KPPB 4IRZL 2MTPA 1N3NB 3SGEH 4Y5XC 1KN2L 2VITA 2WLZA 4LSDA 3WS6A 5HGHA 2D7TL 2N56A 4PS4L 5EU4B 1NFDF 1PQZB 1FRGL 3BKMH 3E2HB 5IIEB 4K3HA 5EBLA 3QP3A 4P59H 4PLKD 2X70B 2OL3B 4K7PH 2VXQH 2BY0A 1QNZH 4MSWA 4R7NB 4HXBL 1C8PA 1AD9A 3JV4A 1FNSL 3RVTD 5BJTA 3HE6D 4XXCC 4ISVA 4ZSOA 3TCXA 1L9MA 2Q20A 4Y2DB 2XFXB 3VE0B 4Y16D 2V9RA 3DV4A 4Y2DC 1JVKA 3I3EA 3V0VA 4QHUB 1G7QA 5F7KC 3RVVD 1C12B 4V1DA 4NBXB 5DD5H 3IDYC 4UBDC 4ERSH 1YQVH 1NEZG 1OGTA 2AJYH 4GG6F 4LEXH 1DVFA 2H1PH 4MD5A 3N85H 1JHKH 1G7IA 4HCRA 3X12A 1RZKC 1P1ZA 4APQC 1LDPL 5AG9A 2DMCA 1A4JB 3W81A 3LRSB 1HH6B 4L3CB 1UYWH 3JWNC 2BNRE 5GGUA 4U3HA 2F19H 4XC1L 3VXOA 2VUOA 3OPZH 4HX1A 5BVJA 3BH8B 4Y4FB 5LGHH 1CGXA 1F4AA 5A1AA 3NFSH 2WBJC 3IVKA 3SDYL 2BC4B 2FO1A 3RPKA 3RQ3A 4Y4FC 1CD1A 4GRLD 4ESKA 1FP5A 4HAFA 2X4PB 4D0CA 1EX0A 3IDXH 2OMNA 3UZEA 2H45A 4P4KD 5C0GB 5CFHA 4NZRH 4ZNEA 4R7DB 1YC7A 5EB9A 3CMGA 4PUBH 5T3XH 4PJEF 5DI8A 4U6YB 1KCRL 2W92A 4MXVF 2XZCL 1IL1B 4LQ1A 1A6WH 1OQXA 1H9VA 4F57L 3LB6C 3SDXE 2I07B 2IPUG 5D1XB 3GK8H 5IB1A 2EH8L 3HNSL 1RMFL 2EDQA 3TFKC 1AKJD 3H42H 4PTUB 2DQJL 3VCLB 3CU7A 3BAEH 4HK0A 5HDQL 5SV3A 4HC1L 5EOQH 2A38A 2VDRH 5F1IB 3KGRA 5HHME 3UEZA 3CSYA 3DURB 5HVHB 1DUZB 5HI5D 3S97C 2X4TA 1BAFH 4WY7H 1NANH 2P7TA 3O6KL 4I3RH 3DWTA 4WDIA 3W39B 4YH6A 1J0JA 1AR1C 2P48B 1LO0H 5IT2H 3U9UB 5J9PA 4U2YA 3ZDZE 1MCPL 2GJZB 1A47A 2PKDA 2WANA 3UTTD 3AAZA 4PD4K 5GGSY 4HUMB 4QWWC 5IK3B 5IVXE 3MLTB 1FLTX 1RZKH 3MRCA 5I1DB 1U3HA 2XA3A 4K9EC 4N0FA 4NC2B 5IESH 3NGBC 4LARL 2IFFH 5D7JD 4M03A 1Y0LA 5DC4B 4F80A 2P5EA 4Z7UF 1K85A 5EOCH 2X4SA 3GMMA 4MLIA 3U0TB 4X6BB 4Y4KA 1M7IB 5DD3H 1X5KA 3KXFA 2L4OA 3W82A 5C0CA 4JJHA 4UTBL 4OTXL 4RGNC 2Z8SA 3LMJL 2YK1H 5D7LB 1LD9A 2XZAH 3I50H 4ZDHB 1TZIB 4J3OC 2OS7A 2HJKA 4PG9A 4XAWL 5TFSL 3W9DA 4QHLA 3VGAC 4DGVL 1U3JA 4NQDB 4OFIA 1U92A 1VFMA 5J6GB 1JTPA 3UTPD 4DUWA 3FRPA 1T7VA 2XG5A 4F37F 3K2MC 4NUGL 2UWEB 4O2EB 3CXDL 4Z7WF 3WFDH 2WWKT 5EU3B 1WGOA 3QUXD 2WMPA 1AE6L 1S7QA 3QEQA 3HZVA 4ZFFA 1IAOB 3L6FB 1CXIA 4KK6C 4M1DH 5J3HC 4P2RD 3PDDA 3FCTA 4GBXB 2BCKA 4XI5C 1U8JB 4Q6YA 5F1NA 1RU9H 3Q3GA 4QNPE 3T09A 4UT7L 5TDOB 4C56B 4GBXC 5I30H 4H5SB 4EDWL 3IKKA 1G9NC 5CJOH 5TJWK 3Q2CA 3QDJD 2R23B 2PO6A 1G7JA 4GKOA 3FHAA 3MR9A 2X7LA 5D2NC 3TM6A 1AJ7H 1XCQB 4HZAA 1A22B 4NNYB 2MKWA 3IFLH 2UUDK 2BY3A 3U79A 3LH2L 4JFOB 3VGHA 1P7KB 4PJGE 4H8WC 3NBNA 2X4OB 4KUZL 3TV3L 1A1OB 2NXYC 4LU5H 1EA9C 3MLZL 4KUCD 4JO4L 1YEKH 5F1SA 1FG9C 1KN4L 1Q0YL 1FZMA 4K9EH 5C0ND 3UBXI 2VDQH 3TLRA 2X09A 5DJ8B 4YGAB 2WIIB 5FOJA 1R5WA 2KZ1B 1M71A 1DBBH 1MRFH 2QKIB 3ZYOA 1NLDL 1KB9J 5DHVB 3CX2A 3UAJC 4NQED 2WBWB 5IMMA 4CDHA 3SDDA 4ZUWB 4FXKA 1B6DA 4I3SH 5GQBA 5KVEH 4ELKA 5I1LB 3ULVC 4WRLA 2YD5A 4KHTL 5FO7A 3E3QC 5GRUH 1NBVH 4WI6A 4L4TD 1P5UA 4RNRA 2PUQT 3UJIL 3GMRA 4JVWA 2GSIA 5JIHA 3SY0B 5KSBB 4P2OB 4UQ2B 3LY6A 4PJXE 4XNXL 3FZUC 2AQ3A 3MBED 1D3CA 1QO3B 1E6OH 3JWDC 4P2OC 3H3BC 3VH8A 3FO9B 2E7LA 1HSBA 1MIML 2APBA 3N50A 4JPKL 4ZFOA 4HJ0D 4D9QD 1ULVA 4DFIA 5MEPA 2X1PA 3LZFL 4FQ2H 4FMFA 3PP3H 5E08H 3PWPB 1DLFL 4N5UA 3O6LL 4RBPH 5ICYB 5KTEL 1S7WA 3AVEA 3EW3B 4CVUA 4FQCH 3LEVH 4NC0B 1FFOA 3WFEH 4PY7B 2G5BB 1G9NH 4OLZL 1TJHL 5FGCB 2EDFA 1S5HB 3PWLB 2OSLA 3P9LA 2CUHA 3DMMD 8FABB 1LNUB 1SEQL 5D72L 1XZ0B 1TNM