3W0WA

The complex between t36-5 tcr and hla-a24 bound to hiv-1 nef134-10(2f) peptide in space group p212121
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
279
structure length
279
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWGSLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 76
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w0wA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3w0wA01
2IBZY 4NQDE 3RVVC 4YHMH 3MUGB 1EO7A 3FN0L 5IBUB 2Y36H 3OJDB 2K9UA 1LO2L 2FLRT 1CGXA 1OGAD 5DRZA 4DAGL 4B53A 2D7NA 2ITCB 4PJ5A 1U8HA 2EE9A 2JB6B 5ITBH 2A6IA 3RGVB 2DYPD 4JFDB 5TH2A 2LAAA 5IHBA 4H8WH 3A67L 3EO1A 4DW2L 2SEBA 3HNVL 2A74A 5DI8A 3U7YL 2NXZD 2PYFA 1RHFA 3MRKB 3LN4A 4AIOA 1SJVA 4RAVB 5I15L 4BELD 5T3ZD 2H2PC 3U79A 4Q9QH 1F3RB 3V7AE 5T3XL 1EJOH 4PGCB 5D1QB 3L3IB 4CNIB 1VPOH 2VE6A 2Z91A 4JM4L 4TUOB 1RK0B 4R8WH 1K4CA 5FOJA 5J11C 1MI5A 2HJLA 2IMMA 3F7QA 3K4AA 5F7KC 2J7LA 4JR9H 1DQLL 1BBDL 1FFPA 1MWAB 5F6HJ 2XPGA 1YEKH 4P46A 2VC2H 1NCTA 4OUUA 5AEAA 2FHFA 3V4VL 1UXSB 3ALPA 1LEIB 3NH7L 3PWUA 2NR6D 1SEQL 4OCSH 4ERSL 5HYQB 4X6EA 4MCYA 4C56E 3MV9B 5F21B 1Q0XL 1NL0H 3OB8A 3RVXC 5DQJB 3OAYK 5EU5B 1ZVSB 5HHXH 5KSVA 4Z7QE 3UTSA 2BVTA 4KZDL 3OKNA 4JHWH 1AFVH 1EEUA 5I1CL 4RWHA 4FFZL 2X4NB 3GMPB 1JVKA 2VNCA 3EOAB 2R2EA 2DM7A 3T3PF 4UBDD 5DUML 4XTRD 4OZFH 3O3BA 4CVWA 1GL4B 2HRPL 3GBNH 2VL5B 5I8KH 5J8OA 2NY2C 4NYLB 2RAMA 5ALCH 1NC4B 1K8DB 1X5FA 1BX2A 3QR2A 4JPKL 1NUDA 1K3ZA 4NDMA 3RFZC 3Q5OA 1C16B 1XGPA 4MAUH 4NNXA 1UFUA 3ABZA 1KUMA 1N0XL 4YHKH 2FB4L 2DQTH 5E1AA 1TNNA 4KRNA 1CT8A 4R96B 5KANI 4F7PA 4C83B 4HUXA 5KN5A 1XGQB 2GI7A 3F65A 2I60H 3NIDF 1AY1L 1MRCL 2QQLH 1GOGA 2EIDA 4OFDA 2HN7B 1HYSD 4FA8A 3BIKA 1T1WA 3T2QA 4HZLB 1I7UA 3HPJA 2XZCH 1DDHB 3MCLL 4OZIE 4KY1L 2OZ4L 3RWCA 3RVTC 1ZHKA 1FC1A 2CDGB 3GSNB 3NBNA 1ZK9A 3JVGA 2VXVL 3UBXB 5KVEL 4M1DL 4F3FB 3O2WH 1T7WA 3D87B 4OUOA 1NC2B 3KYNB 4WV1C 4OLWL 2WAHA 2B0SL 3C6LC 4JAMB 1F2QA 4C54A 3S97C 4ODTL 1IGTB 4R2GC 3C2AH 2H3NA 3L3JB 4NQEA 4OZGB 4DKFL 1CGWA 1K4DA 4CADA 1H3XA 4KRPD 5T33L 3LPGA 3MZTA 1CE1H 1CXIA 2FD6L 3DI2B 3FQUB 5DZOA 1N64L 1HHGA 5D9SA 4F33B 4G42A 1GGBH 1EA9C 2EO1A 1MY7A 3P77A 2Q86B 1KJ3L 3O4LB 2AP2A 1BD2A 4RISL 4K7PY 4LL9A 3T3PE 3T04D 1IQDA 5D96B 5GRVK 1X6LA 1MJ8H 3PNWA 3QAZB 1RJYA 1OWRM 4PLJC 2WWKT 5HHPB 3ZTJH 4N90D 4IS6B 1FO0L 5CGTA 3QDJB 4POUB 4NRXB 4X9HA 3DPBA 1NCAH 2OMNA 5EUOF 1AGFA 3BQUB 1HHKA 3MJ9A 4X6FB 1UENA 2HVJA 2R56L 5JIIA 5HDBE 3GB7B 5F71A 4KH2A 2CIIA 4PRDB 4BZ1H 4M43L 3CFBA 1BVLA 2C1PA 3UJTL 4IJ3B 3QXDB 3DRTB 2UY6A 3DSNA 5H2BB 5KS9A 4MZ2A 3RI5F 1GSMA 3S7GA 4JVUA 1AXTL 3OTTA 3F7YB 2DWDA 3SE3A 3UO1L 3UBXI 4ZYKA 4F80A 1FE8H 1NJ9A 3L7FA 2DQCH 3X3FH 1RZGB 5T3ZE 4HUVB 1RUMH 3QFJB 1KB9J 4MD0A 3O3AB 4LCUA 3GJFB 2HG5B 4L1HA 2GITB 2VABB 4KXZH 4XNYL 3TJHC 43CAB 3FN3A 4YBLC 3SDAD 4PDCE 3TBTA 5IHUL 1S3KH 2R2HB 1T6VN 1CDYA 3HMXL 4HDIB 4EUPH 4F7TB 3RWDB 1HNFA 4HWZB 3DLQR 2VB5A 1S7WA 4ZAKB 4POZC 2WINA 4P48A 3ARQA 4YZFF 3QNXB 2MNUA 1TJHL 5DS8A 1FC2D 1EXUB 4MDIA 4UNTA 1CFSB 2GY7B 4HS3A 3DMMD 3MRDA 5F72S 3LMJL 4I1NB 4JZNA 5DUBA 4FQIL 4R4FL 1CD8A 1K6QH 4PP2A 4RQQB 1A1OA 5I1DB 5EOCH 3DV6A 2FATH 2EICA 5EUOE 3PHOA 5KW9H 2DBJA 3KHQA 4F7MA 5DJ0B 4M7KL 2KZWA 2VLKA 3F6LA 5CEYB 3HS0A 4GKSB 3EO0A 1Z9LA 4NBYB 3RBSA 3VH8A 1TNMA 5CJ5A 4KUCD 3BPNC 1DP0A 3NGBB 2UZIH 5A16B 5E2JA 4NZUL 3F5WB 3ZT5A 1I9RH 4PJCA 4PJXF 5DQDH 4K3JH 2FX7L 4JRYB 3KPPB 4XGZA 5TQ0L 4DN3L 1L9MA 4P3CL 1FZKB 4NJAH 3HKFA 2XWBB 3FT2A 1SYVB 3FQTA 3L6FB 2BSRB 1CFVH 2P4AB 4MNQA 3VDBA 4X0KA 3MA9H 1KB9K 2HLFC 5HYEA 4I3SH 2XV6B 2AJZA 4JFOB 3V52L 4JZOA 3RGVD 1KT2B 1UM5L 3PQYA 5C86A 1JWUA 4PG9A 1JPGA 1N7ML 5T5NF 5KSBB 1F4YH 2ARJQ 1MOEA 1A9BB 3O6LH 1IC4L 5GGSY 4J4PC 1HILB 3I85A 2B20A 3ARFD 4JJHA 5DJ8B 5DQ9A 3WEXB 3I2CH 3KPSE 4OF5A 2FR4A 2PTVA 3QNYB 4DZBA 3TVMB 4YZFE 1YEHH 1VEMA 4DEPB 2VJXA 3MC0A 4QRRB 3VFOB 5IUSA 2X41A 4U6VH 5E9DB 2DLFH 2CDFB 1YNKH 4OI7A 1X5HA 2F19L 5I17A 1G7LB 4J3UA 5JORB 2X9YA 4G6KL 2F54E 3BMWA 2NY6B 4FFWD 3QH3B 5I8CA 3QDAA 2H9GB 1AR1C 3TJEL 3CD4A 2ILLA 3H2WA 3BT2H 4U1JB 1YEFL 4ZUSB 5FK9A 5BS0D 3EKCA 5C0NC 1I8KB 3BGFB 4GW4A 3TYGH 5BZDA 5KBNC 4WY7H 4MMXC 1LEKB 3QXAA 4DCQB 4U1MB 3ME0A 5KSAB 3RIAK 1SBBA 4JM2B 4N90E 4F7CA 1U8QB 25C8H 5E5RB 3MLTB 5TDOA 4E41E 1EGJH 4AEFA 2AK4A 1V3JA 1R3IL 4O9HH 3P0VL 3FQWB 3E2HA 3JTSA 3QUMH 1RV6X 5HHMB 4MXVF 1PEWA 3Q6FB 5ESAB 5BO1H 2DI9A 5HI3D 1F5WA 4DQOL 2X4OA 1LMKA 3FO1A 2NY3D 4K7PH 4KUCF 3T0BA 5J89A 2DQFA 1HCVA 4JFQB 1DQJA 1FL3B 1BFTA 1I7ZA 3RUGB 1ZTXH 4NNPL 4TVPD 2F5BL 3PDGA 3BO8A 3PL6D 4OGAC 4Z0BH 4P23A 2OI9C 1KXVC 2P43B 4KV5E 2IG2L 3W11D 5ESQB 1B4JH 3RNQB 3LPWA 2DWEB 4HFWB 4BQ8A 4X4YA 3U0WL 1GGYA 1T21B 1VEPA 1U0QA 2B2XL 4H88L 4P2QA 5DJCA 2PKDA 5CINH 5B4MC 4P46D 1YPZB 1QA9A 3KR3L 5C6PB 5KG9A 2W0FB 4HXBH 1S8DB 2P45B 5D1ZA 4HS8L 5D2LB 1X7QB 2AEQL 2VDQL 1NC2D 5DURB 4V3DB 3QIBB 5TDNA 1DQDH 4WI2A 4WO4D 3OJVC 4IHOB 4IRJD 3JV4A 1NANH 4HKBB 1N0LA 3TV3H 3ORJA 1U8KA 3ES6B 1DBKH 2BVYA 2PXYC 4ODWB 1MFBH 1Z9MA 4K71B 4RFNC 3QDGB 5GXBB 4L8BA 2H45A 3ZT6A 4YHOH 3VXTB 5E56A 1H0DA 2N56A 4GAJL 1G7PA 4MXVE 1V7NL 1RIHL 3MOAL 4ZXBB 1MCPL 2BRRH 4LP5A 1X5AA 2PN5A 4L9DA 1U91B 3S88L 1T2QH 2IEPA 2HFTA 3QDMA 3MMEA 3LKSB 5F8QC 5I1HL 1T89C 4OV6F 3QDJD 2G2RA 1RU9L 3SDDA 2FX9L 5HYSG 4P3DB 3RL2A 4G5ZH 1JHLH 4M6NL 1QKZH 5EU4A 1TENA 3FAWA 3WYRA 5ICXA 2XQYG 1MIML 2AGJH 5JW4M 3EYVB 5BVJA 3C5JB 5IG7B 5BRZE 1HIML 5DD3L 3KXFA 4MQ7B 3VXSB 4XCCL 4KRMB 4QXUL 2IH3A 1OSZA 1I8IA 2D7TL 1MAMH 4FTVE 1Q9LA 3G6DL 3F58L 4YC2C 1EMTL 2X1QA 3VFNA 4J6RH 4QRUA 1ZWIA 1R3KA 3SO3C 3GUTB 4AIXA 4BFEA 2R0KH 1U93B 4N8PA 3MLSH 5B39A 5CHNB 5JPMB 5K9OA 2GUOB 1MPAL 2HFGL 4RGMC 3BRDA 4WRLA 5ACLA 3HZYA 3GM0A 1UB5B 1WC7B 2OL3B 2XRAL 1ZT1B 3WIHL 4CL7A 1HXMA 3D1MC 4JDTH 3VFGL 1I1FB 1WFOA 1N6QH 1KJ2L 3KYOB 5CEXB 1BP3B 1YN6A 3Q6GL 3OZ9H 1QLFA 3EFFB 4OD1L 2C7UB 4ONOA 1EAPB 3K1DA 5H37G 3MODH 1Z5LB 1I8MA 4PJDB 1OD7A 4NKOA 1FGNL 1IGCH 3LB6D 5BS0E 1IVLA 1A7NL 5GS1C 5F7NC 5CD5D 3BRGC 5TE6L 4G6JH 1QRNA 3PDDA 3N0PB 3B2UD 3UMTA 3BVNA 4ZO7A 3EDKA 5C0BB 4ZFGH 4QHUB 5I66A 5L9DL 4DZ8B 2EC8A 4Z7NE 2G9HA 2OJEB 4G6AC 3WL9B 1Z9OA 2R1XB 4Y88A 1G7QA 4HLZG 1JPSL 4LSSL 1G9ML 3TPKA 3OBAA 1IAIM 3GMOA 1S7RB 5I1IL 3UTTA 1NLDL 1MEXH 1XIWC 4HGKC 1AP2B 4G59A 4PJ5E 2XG4A 2EH7L 2E8YA 1MNUH 4LCCC 2GCYB 1BQLH 4K8RC 5DFTA 1NAMA 1RJLB 4YPGA 3WFHA 3TBYB 3VFWB 3IXTA 5JXAL 1KEML 1OWWA 4LSVH 1Q0YL 5IB3B 4OM1H 1LO3L 1UKTA 2VDPH 3MRCA 1HSBA 2NYYD 1K2DA 1WJ3A 4H1LB 4GH7B 2RGSA 3FT3A 2IPTH 3U30C 1NEUA 5C0EA 1CZ8L 2AJXH 1W0YT 2UY7A 1Z0MA 3U2SB 1YMHA 1U42A 1VADB 4GRLD 3SQBA 2WUCH 5E2TL 5DYOA 3QEHA 1JBJA 3MJ8A 2VKWA 3UPRA 4XNXL 3BUTA 3H9SA 1M7XA 1CWVA 5JMRA 1QR1B 4OQTL 1SVZA 3OKDA 3D2UA 1RJZA 3QUKB 3HNSL 3TBSA 2F74B 2J6EL 3LRHA 4NCC1 1TLKA 4I2XA 3IAPA 4XBEH 1ORQA 3HUJB 3TVMD 5E9DD 4M62L 2VLJB 3UTSE 1D7FA 2P7TA 3S5LG 2NY4B 1F6AA 2OM5A 4WI3A 3U7AA 1OLLA 3QA3B 4RFOL 4UV7L 5HHOA 3BPOC 3MZGB 3QO1A 4MYWB 2DB8A 1JI1A 1I3GL 2DQUH 3S4SB 1CE6B 4CU6A 3O11A 3VXQB 2RHEA 3SBWC 2ICWJ 2OS7A 4OGXL 5IROC 1TQCC 2CLRB 2UV3A 3CLFL 3HCVB 2W59A 3OKKB 4WV1A 3QEQA 3QG7L 3VFVB 1WBZB 3UYOD 3PXJA 3AU1A 1CICB 5LBSH 1CL7I 3O3EA 5E8NA 1R5IA 5KSAD 3L3HB 1NBYA 4JM2D 4QRTB 4HUWB 5MEQB 5DR5H 1MRFH 1FNLA 3RU8H 4LSTL 5D7JC 2C26A 4OFIA 2BMKB 1DUZA 2VDMH 1K8IA 2OTUA 2DIAA 4HJJH 4MNQD 3P9LA 4UMGA 2VO5A 1MWAH 1DL7H 2B1HH 2XZQL 1A7PL 5D7IA 4XNZC 5KS9F 4LMQE 4PRPD 4U1NB 3T77A 5F3HA 3UJJH 2DM2A 5L2JB 4R3SA 2Y7QA 5CBAA 3MREB 2NTFA 2C3VB 1O0VA 5E24E 5E8EA 4LKXA 1NCCH 3TO4B 1GZPA 3CLEL 1JP5A 1A0QL 3LZFL 1I4FA 4JFYB 2F58L 3GKWH 4ACPA 4NGHL 4ZS6D 1WQVT 3G5YB 1KCRH 2P5WD 3MRIA 2VDKL 2EDEA 4MCZB 4O58H 1P4IH 2E3VA 2BY2A 2WBJC 5ECJE 3VA6A 3WSQH 4LPUA 1F3JB 2ERJB 4HIHA 5IFHL 4NQEE 1S9WA 3L3DA 1IM9A 2YD9A 1F8TL 5IJKA 4U7MA 3O2VH 4UT6H 1ZV5A 4Z7WA 3FOLA 4PJ8D 5EBWA 3NN8B 4X5LA 1VFAB 1WV7T 5EU6B 1BD2E 4FZ8L 3QFDA 2BY3A 3V5HB 4WUUA 1MHPH 5TDPA 2BNQB 1FL6B 1A2YB 4KTYA 3UAJC 4UIKL 4U6HA 1UT9A 3LCYA 5J7CC 1OAKL 1TZIB 5CJQH 3AY4C 1UQSB 3HE6C 3IDJB 1HSAA 3TJHA 3EYUL 3QYCA 1UA6H 1JFQL 3P9MB 4FQ1H 5B38B 3GK8H 1J0YA 1FLTX 3K4ZA 5C3LD 4JVPA 2FX8L 3ARGD 1NDMB 3NZHL 2J5LC 4KJQC 4U1GC 3QDGD 3KYAA 1RIVH 1A3LH 4OLUH 3CFJA 4L8DB 1MLCB 3PGFL 4YX2L 5F1NA 5HI5D 5D72H 1NEZG 5TQ2L 4ZXBD 4K23H 5KS9E 2MTPA 4P23D 4KHXL 4Z95L 1KV3A 1JGVH 1PX3A 2QEJA 4JPWL 4ODHH 1SEBA 4D9QD 1KN2H 1NCBL 3NFPA 2OXHA 3LRSB 3MLYL 4M7LT 5IB4B 2ZCLL 2VDRL 4RGNC 3IJSB 1S9YB 3QWRD 3DJ9A 4JPIA 4XB7A 3IJHA 1OAQL 2W9EL 1NCWH 4IOIB 4HIJB 5MENA 2Y9RT 1NLBL 1J05B 1T0MA 2QLVB 4Y19D 3PWNA 2EDOA 3NCJL 5I1LA 5HD8C 1S9XA 3QIWC 5JDJA 3RUGF 5FA3B 5EU3B 4GXUM 1MFEH 4PJ9D 3WO3B 1UJ3B 4CW1A 2Z8VC 4FXGA 2FJFA 5DJAA 5C0AA 5EZOL 4JZJC 4UB0L 5GGUB 4P4KC 3RRQA 2H32B 4PJAB 2ICEB 3FRPA 2Q3AA 3U36A 3LS4H 1BIIA 2JTDA 4WW1B 4OCLC 1KN4L 3BWUC 2APTA 2OSLB 1YNTB 4U6YA 3FQRA 3TPUA 5LWYL 3BN9C 2UYLB 1JRHL 3O8XC 4KROC 4LEOA 1U92B 1MFDL 4O51A 3LHPH 5DEZA 2P44B 3FRPG 4HK3J 5SX4H 5C08A 1HQRB 4MJ6A 1IBGH 3STLA 3MJ9L 5F1IB 5KAQG 4J1UB 3G9VA 3UXFA 5I16A 3BAEL 4UV4L 3DIFB 1O7VA 3FT4A 5C6TL 5CSZA 4J4PA 4XPHL 2V2TB 5D2LF 3B5TA 4LLUA 1T4KA 4KKCD 1JZ4A 2X4TA 3QDMD 2VDLH 3OX8B 4ONFL 3HLAA 1QRKA 4OFVA 4PJCE 5C0BD 1FNSH 4YFDB 1MUJB 2Y5EA 2H8PA 5I73C 4YQXL 4X6BB 4XNMA 2I5YL 4NN6C 5HDQH 1AE6H 5GS0H 4DKEL 2FHBA 5L0QB 5DJDA 4K3HA 1JNHA 3ZKSD 1Y18B 2KBGA 4MNQE 2IAND 1LO4H 3C8KB 3LV3A 3KXFD 3SE8L 2AJ3B 1FAKT 4JPVL 3HTLX 4QRQA 4FNLL 5F7WC 5GQBA 1FVEA 2C9AA 4BSJA 5BVPL 2HJFA 4PV8A 5BQ7B 3KPSB 3PQYE 2E8ZA 2OR9L 4WHTA 5JA9A 3OGCA 5A2LH 5IB5A 2Z4QB 3P3YA 5C0JB 1Z9SA 4UAOB 3SDXA 1H15B 1NGQL 1XGYH 4KMTL 2XXCB 3S36L 1EDQA 4YE4H 5F6HI 5GJTL 1XCTA 4DN4H 4NWTH 5JPNA 2YPVH 4FXKB 4APQC 4ELMB 3ULUE 2GSIB 1HINH 4LCYB 1RFDL 3WE6A 4L3EB 3CC5B 4ZTPL 4S1DD 2BX5A 5TJWK 4EQ2A 4ZMAT 3RNKB 1WZKA 2GHWB 4XX1G 2OQJB 1RUKL 2W9LA 2XQYK 2OI9A 1ZLSH 2AEIT 3AXLB 1WEJL 3LOWA 4LSPH 4YBQD 1WTGT 2BNUB 2VUOA 5TGBA 2GK0A 1Q8MA 1AHWC 1RMFH 5DHVA 1XF3A 4E41B 4M8QB 4P2RD 1P9MA 1UWGH 3ARDC 5D70L 4HKJA 3RWFB 3R0MA 2NX5A 4O2EA 5DZNA 2X70B 2AK4E 4X80H 1YEGH 5EA0L 3DOSA 4WI5A 4HD9A 3ULVC 4XHJD 4RIRA 3TA3C 5BMFL 2V2XB 4NWUH 2W9DH 3IVKA 1AC0A 4HGWA 5IHZA 5KJRL 4JQIL 1BOYA 4LSDA 1JPTH 2Q1EA 5J9PB 3P0YH 4YNYB 4NHUA 1CXFA 3OR7A 4NO2B 1DQQA 4D9QE 5IVXA 1KIUA 5LG1A 1T1XA 1D6EB 4WUKL 3TO2A 5HVFB 4ZFZB 4YFLI 2PXYA 3U46B 3IKKA 5EOTB 2VRAA 1E4JA 5E8OB 1UYWL 4Z0XB 2ZSWA 4G8GB 5DFWH 1FSKB 5J13C 4L8SB 3VFTB 4P2QE 1EBAA 3TN0C 3H9SD 3LS5L 4GMTL 4P9HH 5F97E 2V17L 4WW2C 3VG0H 3DURB 3ULUL 2V7NB 3KHOA 4PJGB 2QL1A 5IEKB 5F6IC 3D2UD 3MXVH 5I6XC 5HY9B 4GG8B 3KPOB 3TO4D 3GO1L 2D9CA 3IDYB 4U7SA 5IVZB 4HUUB 3MFFB 35C8H 1KTDA 3U9PH 2OR7A 3D3VD 1KIPB 1NFIB 3FB6A 3QWQB 3EJYC 1MREH 1IAII 4OZFG 4TRPL 4WU7A 2OJZL 1KIQA 4OM0L 4NFCA 2X4PB 2N1KA 5C0CD 1CLCA 4KZEH 2FHCA 4LCWD 1ZA6A 4HWNA 5HHOD 3CMOL 2AEPH 1TETH 5BJTB 5JTWA 4RNRB 1BGXH 4LBEA 2Z8WC 4NQXA 3IDGA 4LAQH 1OSPL 1BPVA 2JJTC 1DFBH 1XF4A 4A6YH 5FB8A 3MJ7A 2CKBB 1D3CA 1HWGB 4H5SA 4M7JH 4R26H 5F89A 1XR9B 1KTRL 4FXLA 1FFOB 4WEUD 2WY3A 1N5AB 3QDME 5FO7A 2VZOA 3TYFA 3BP5B 3T0ED 4OI8A 5M94B 4BSWA 3P73B 3LKRA 3NFSL 1KXQE 1JWSB 5JO5B 3C5ZC 4PBWD 5GGRB 1XCQB 3LKOA 2YWYA 3FB7A 4I5BB 4M3KB 2PETA 1FG2B 2D0HA 4RGOH 3VCLA 1JNNH 4OI9A 5L7XH 5CEZE 2P8MB 5J12B 3SGKA 3A6CL 1W0WB 5FKAA 2AV1A 4FTVB 2IANE 4JEGB 2I25N 4WHCA 3KXFE 2V5RA 5GS1A 4XRCA 5KOMC 2DQIL 4NO5A 1RULH 3PP3H 1Z3GL 1Q1JH 1QBBA 1I1AB 5E00A 1P53A 5LVEA 5HGBA 1AGDA 1KFAL 4YXLL 4N8CL 4HAGA 3GIVA 1CTNA 2FH8A 2ZSVA 4ZOCA 4XXDA 4MWFA 3I84A 2V9QA 4LRNH 5F9OH 5CAYB 2AJUL 1V7ML 3GMMB 4MLSA 1X5KA 3DETC 2ESVA 2YPKB 2GTZB 5EZIL 4HWUA 2V9RA 1VEOA 3WCYA 1CLYL 4HH9B 3EYQC 3FN0H 4YHYC 1J10A 3ZTJG 4P4RB 1DEEB 1LO2H 1T6WA 1TVHB 4D0BB 1BQSA 3UEZA 3HI1B 4BYHA 5B8CA 3M1BB 2NY5C 5ENWB 2IFGA 3WFZA 1QRNE 5HHQA 5AUMA 3A67H 4DW2H 3HNVH 4P2RE 3MLXL 2UWEB 5I15H 1ZT7A 4WNQB 5DRZB 3MYZA 2JKXA 4OLXH 1IM3A 3ZHKA 4HJGB 4PJ5B 4RAUA 3GNMH 5L8KB 3UTTE 1YN7A 4JM4H 1ACZA 1D5ZB 1YQ2A 4R7NA 5E8PA 2SEBB 2XT1B 5DI8B 1MQKH 4OLZL 4D0DB 3LN4B 4K07A 1ES0A 5CEZL 3LAFA 1S7SB 4EOWL 4AEHH 4EUPA 5F1KC 1BBDH 4MA8L 4G8EB 3T1FB 5LCVL 5AD0B 4XCNB 4QHNA 4N1EA 4TTDD 1QZ1A 4LPXA 3WN5C 4FQLH 2QQNH 3QUYC 1YEEH 4ISVA 1MI5B 4NRZA 9CGTA 1FFQA 1ACYL 1KEGL 3V4VH 3NH7H 4XMKH 4ZO9A 1SEQH 4DKAA 4N0UA 1UM6L 4CMMB 2Z92A 4ERSH 3T65A 3VRJB 5I76A 3EOTL 4Y4KC 4ZPTA 3L5WB 2XPGB 2WUBH 4Q7DA 1FVCB 1A6VL 3SBWA 1U58A 5IROA 4N1HB 4KZDH 3H9SE 1HH9A 3V4UH 4N0FA 1QO3B 2R0LL 4OUUB 5I1CH 3TT1L 3PWUB 4YBHA 5C0AD 4WU5B 4X6EB 1FCGA 5MI0C 3PHQA 5DUMH 4YGVA 4EI6B 3OMZA 4XWOC 2RR3A 4MS8A 4AY0A 4ZUWB 4I2XE 2A0LC 2CRYA 2HRPH 5KSVB 3UTSB 1JGLL 3NCCB 5FCUL 3UZQA 5F7HA 5CZXC 3DRQA 4L9LC 3FRUA 1P7HL 3UTZA 2B5IB 4JN1L 2HLFD 4K2UH 4LPTA 2FRGP 4Z7WF 4JPKH 2R2EB 5HHVH 4BH7A 2BK8A 3KPRB 1DLHB 1WFNA 1RJCA 3O3BB 2X05A 4Y5XB 5ERWA 5C0DA 1M7DB 3VI4F 1N0XH 2FB4H 2VOTA 5HHOE 5DHXB 3TWCL 1VA9A 1AY1H 2YD5A 1BX2B 1FN4B 3GM8A 4NDMB 3QEQE 3I6LE 3MCLH 1XGPB 4KY1H 4NNXB 1PKQB 2IQ9L 2CUHA 2OZ4H 2WBJA 1NAML 4S0UC 1UZ6F 4LFHD 4AG4H 2ICCA 1TVBA 2VXVH 4HUXB 4YEEA 2E7MA 2B1AL 4KK8D 5KVEH 1A4KA 3HG1B 4M1DH 4LVHB 4EEEA 4PR5A 3C8HA 3RVUD 1T1WB 3LQMA 4KI5D 4OLWH 4NHCH 4R0LC 3HPJB 2FBJH 1BM3L 2B0SH 2EYSB 3OL2A 1ETZB 4GSDL 4CJ1A 3RWCB 3S37X 4NKIL 1LQSR 4ODTH 3V0VA 5ETUB 4U0RC 5HTSA 3TFKC 4DKFH 2D7PA 3RVWD 5EPMA 4NNYA 5T33H 3UCRA 2XWTA 4KQ3L 2G5RA 1PG7W 5FEBA 1LO0L 1YA5A 2CQVA 2NW2A 3HE6A 4V1DB 4GAGL 5GHWL 1NGYA 4UNUA 5EBLA 5IIEB 3O45A 2XWJB 4F15C 4HPYL 3WDIA 1K4DB 3QQ9C 3D25B 2HTKD 4RMQA 4RBPH 1FO0H 1N3NA 5L2KA 4ZDHA 3P77B 1EGJA 1BD2B 1I1CA 4RX4A 4Z7WE 5I1JL 3VWJB 5FHBH 3KYMA 5CGYD 3Q2CA 1BZ7A 4NQTA 1K5NB 3ESVF 1RJYB 3VI4E 2BSED 4WUUE 5DEGA 1RHHB 1T0PB 4M43H 2YKLL 3H9YA 4IBLT 3GSUB 1HHKB 1GJIA 2YD8A 4YHPA 2HVJB 3MLUL 2FH6A 3BZFB 1S5IL 3BHBA 2CDEA 1R5WA 3DI3B 4N0CD 2A77H 1UZ6E 3QIWA 5DC9B 2FECL 3OGOE 1S5HB 3CFBB 1BVLB 1EEYB 2C1PB 1T7ZA 5EORH 4DUXA 1N6UA 3BUYB 1X5JA 2DAVA 1CD1A 1G7HA 2HVKB 4XNYH 1I75A 5F7UA 2DWDB 4JZJA 1P1ZA 4P4KA 1NJ9B 3L7FB 2R2BA 5IW6A 4Z7UF 5JUEH 1Q9KB 2C3HA 3GSVA 1KGCE 3RWHB 1YDPA 5JW5A 3EOBA 4N8VG 5F7LB 3QCUL 4LGSB 3O8XA 5ADOH 5FHAL 5AZ2H 4KI5F 3JTTB 1T83A 4LVNB 1BEYL 5EU7E 3BZDA 4PGEB 1TJHH 1CD0A 4B7LA 4C57C 1TTFA 1KLUA 2BVOA 3AGVA 5MENE 3EDJA 2AAVA 4TSBL 4H20L 3UZVB 4M6AA 1S7WB 2RBLA 4FQIH 4Y16C 3QCTL 1NKOA 2WINB 3TBWA 4Y2DB 1MJJA 3I75A 2CO6B 4K7FB 4WTXA 4TN9A 3OPZL 3U7WL 3V6OC 1FFRA 2NY7H 3KS0H 1I1AD 3UROR 4HS3B 5C0AE 1FP5A 1LK3H 1T22A 1GVIA 5KTEH 4QHKJ 1I1RA 1LEGB 4JZNB 4Z76B 1YNLL 4OV5A 1IGFL 1AIFA 1I7TA 1N4XH 1U36A 1MCRA 4JN2A 4MDJB 1W0VA 3DV6B 4PRNA 3SE9L 3TPUE 1DCLA 1NBZA 1E4XL 2FX7H 4OCXL 5GGVY 2VLKB 2P46B 3HS0B 4LDEB 3WHE1 4X7SH 2ADJB 3EO0B 4DN3H 2QHRL 4MA3A 4P3CH 1ZE3C 1BWWA 5C08E 2YS4A 2VISA 1LQVA 3ZDZE 5T3ZH 1PSKH 3BH8B 3O2DH 1RK1A 4KFZC 5I75C 2QSCH 1CK0L 3EHBC 5C2UB 3QHFL 5DSCA 3REVA 5FDYA 2ITDB 3OG6B 4XGZB 3V52H 3FAXA 5FM5O 1U8IB 2FBOJ 4I18C 1UM5H 4APQA 3MGAA 1N7MH 3FT2B 2A38A 2ICWB 3FQTB 1DBAH 4NCC2 4JY5L 4Y8AA 4NSKA 4X0KB 1Q38A 2ZNWA 4EDWL 3EDEA 4R97B 4HF5L 3BP4A 4M61A 3ZHLA 3H6JA 4JZOB 1HHHA 3VFRA 4FABL 3HC3L 3SKJL 1AO7B 4U1IA 2F19H 4FZEL 3V6FA 1JPGB 3C87A 4MB5A 4X9GA 1ZHLA 3JSSA 4G6KH 5T1MA 2ZWLT 4MB4A 2DQEL 1C08A 1AHWA 2CJUL 5IVXF 1RZ7L 4LDLB 2FR4B 1LK2A 4TUKL 4DZBB 1ODAA 3ARDA 4DGYL 3WD5L 2YC1A 3TJEH 5GGQL 3S8WA 1YEFH 5F9WC 5GGSA 3RIAF 2NZ9D 1NMBL 4FQQA 5I17B 2VZVA 2V5YA 1A4JA 1XF1A 4R4NC 5DMIL 4NBZB 2OYPA 2HLAA 5CLTA 2ZPKL 4YHNA 2EE2A 3TA3A 4XMPH 3EYSL 2VLME 3RDTA 4HJ0D 1AXIB 5CP3H 3C60C 1MCOL 1ZOXA 5DA0B 1U3HA 1R3IH 3T2NL 3P0VH 1L7TL 5ESVB 2FO1A 4GW4B 3QQ4A 3MQIA 5BZDB 1IAKA 3ALXA 4HG4J 4LLWB 1D9KC 5ANMA 4DQOH 2J8UF 5CBEA 2J88L 2EKSA 1QLEH 1DE4A 4FFEX 2OTWB 1VFMA 3N1FC 3VG9C 4ODUA 1T2JA 1IGYA 2WSKA 3HN3A 5D7LA 3NCFB 2F5BH 1INQA 2VWEC 3JTSB 1GZQB 2NX5E 4F9PC 2ICWI 3VD5A 3RTQC 1J1PL 3E3QE 2VUYA 2IG2H 2ZJSL 4LRIC 3TN0A 1EAJA 2H1PL 3HMWL 4WW2A 1B0RA 3GSQB 1CDUA 3U0WH 2R15A 4P5TB 1L7IH 2DQFB 4LLQB 1I3VA 1DJSA 2LQRA 5IB2A 2VXTL 5AZEL 2B2XH 1MAJA 3H8NA 5DMYA 3D85B 4L1DA 4I0PA 3GMRB 3CPLA 1JZ5A 1JGUH 1MIEH 1F58L 3IFNL 4NHUE 3H7BB 4QY8A 4M5ZH 5M95B 2IQAA 5IVXE 3ZYIA 4HS8H 3QUZD 2VDQH 1INDH 3FOMA 3MA7A 2JJTA 5JQHC 4NM4L 1QA9B 1QFWM 4XI5C 4L4VA 2CKNA 4X99A 5MHSD 5KG9B 5GGTH 1G1YA 3TT3H 2IAMB 2XTJC 4WDIA 3MRBA 5D1ZB 4S0TD 5E4EC 3OKLA 4IDJH 4YHML 1R3JA 4MS8D 4GAJH 4IRSC 1L0YA 1MHHA 4V1DD 1V7NH 2OMBA 3E0GA 4D9LH 1RIHH 4QOKA 2BOBA 3VRIB 3C5ZA 4HG4K 3ARBB 2Z8SA 2R23A 5GISL 2J8UE 3TH3T 3DX6A 1GCFA 2LU7A 3LN5A 4I0KA 1G84A 4L8BB 2H26A 1ZT4A 3S34H 5I1HH 1H0DB 1RU9H 2FX9H 4PJBA 4RMSA 2XFXA 1RPQA 4JANA 2D4DA 4MNGA 1EERB 4M6NH 1L4IA 4LCIL 4JQVC 1MCWM 1A14H 1EPFA 1EJOL 1OP5K 5FGRA 5IW3A 4AH2A 4WVRA 1CF8L 1VPOL 1MIMH 3MMEB 3B3IA 4EBQH 1HIMH 1QSEA 1UWXH 1QVOA 2W65B 4YXKL 3SDDB 4QXUH 5HYJA 1JHTA 2WBJD 2ZG1A 4LU5L 3RBGA 2FO4A 4M8VA 4PJFB 2QADD 3LQZA 5EU4B 2X6MA 3QI9C 4WTZG 1S9VB 5ELIA 3G6DH 3F58H 2PO6A 1BFVH 5GGVH 3AAZA 3RWGB 5BVJB 2HFGH 1MPAH 3L5HA 1KIRA 3FMGL 4YAQA 1I3UA 1PZUB 4NC1E 1I8IB 3AB0B 3JBG7 4OCSL 4WGVB 2XRAH 1II4E 4UQ3A 5KZCD 3WIHH 1RZ8B 1MCJA 3RWEB 4OJFL 1ZWIB 2D31A 2AJSL 3QPXL 4LNVA 1KJ2H 4EI5A 1AFVL 3HE6D 3RZWA 3Q6GH 3F7RA 1XH3B 2BVPB 5ADPL 4OD1H 4QF1B 3ZKMD 5FOBA 4P5KB 1EJ6A 1OQXA 1A7NH 3GSOB 5TE6H 3QWOA 1HWHB 5I8KL 1U9KA 4KMLB 5L9DH 1GYAA 5GSRB 3WIFA 4WI4A 1H8SA 1ZLVH 3BEVB 1QLFB 4WTWA 1CLOL 1JPSH 4LSSH 1G9MH 3BP7A 1I8MB 1PD6A 2VZ1A 4NKOB 1E4WH 3CNKA 1F4XL 5I1IH 1NLDH 1QRNB 3HZVA 2G75A 3MV8A 2DQJL 2DQTL 3BVNB 3MRRA 5CJXC 3V79C 3WN5A 4H0IA 3QUYA 5DD1L 1H3PL 4DTGH 2I60L 2QQLL 5DMKB 1WZMA 2V5TA 4LSRL 4M93B 1UZ8A 1Q0YH 2ARJA 3GMOB 4Y4KA 1H3TA 1LO3H 3NPSC 3HPLB 3ECBB 1W2KT 3WO4C 4XH2B 3GJEB 4WWKC 2GTWB 1RIUL 1VGKA 1J8HA 4JRWA 3O2WL 4K9EC 4XVSL 3UPCA 3RKDC 1M6OA 1CZ8H 2X09A 1GRWA 4OLVL 5C9JA 2HT4D 1OLZA 3TEUA 4X6CB 3BFOA 5E2TH 1HK6A 5F44A 5JLZA 4XNXH 3T4YA 4U3CA 5DMGC 2FYYB 3JWOC 4OQTH 4L9LA 5C0EB 1BJ1H 1LP9F 5F9JA 1GGBL 3P40A 4LLDA 4M1CC 4E0RB 5J6HB 2J6EH 1YMHB 2OK0L 1DUYB 4NKDA 4JY4A 3V5DA 4LHUA 4XMLL 3UPRB 2DMKA 1CVSC 1Q9OA 4E5XB 3OKDB 5DK2B 5DEFB 4ZOBA 5ISZB 3SKMA 3D39A 4QRSA 2XN9A 2FIKB 5MHSE 1WF5A 5C0GB 4PJEA 4K8RL 3T3MF 4RFOH 2DOCA 3KWWA 1I3GH 3RX5A 3IDMB 1N5YL 3CLFH 4PB9H 4G6ML 5IMLA 4GBXB 3NIGF 1MJ7L 5JIKA 1F6AB 4KJYB 3W81A 4YGAB 1EEZA 8FABA 2EDXA 4M6OL 4TNVF 1G6RB 4ONGL 4L3CA 3QO1B 4C4KO 2QJDA 4FG6D 3WUWA 2BFVL 4F58H 3TFKA 3VD7A 4TVPH 3I6KB 3V5KB 5K93A 4LSTH 2MHAA 6CGTA 2CUIA 4MJ5B 3C6LB 3PF2A 3HZKA 4XAWL 2XZQH 2CO7B 1A7PH 3O3EB 4PS4L 2Y06H 4KPHL 1AKJA 2NXZC 1BFOA 4NO3A 1DUZB 3CLEH 4AJ0A 1A0QH 3KPMB 5TE7L 1YYLH 5D7IB 5E5MA 4NGHH 5MEOA 1LP9E 3T77B 4O4YH 1NMAL 3S35H 1TJIL 3JV6A 2Y07L 1DN2A 4P5TD 1OTSD 3AM8A 3MUZ1 4FQ2L 5CBAB 3IU3A 5D93B 1VACA 4LKXB 5IFHH 4I13B 4JJ5B 3MV7A 4WFHD 5FYKE 1GZPB 3RIFF 1BF8A 1UEYA 4HCRH 1FIGH 1OAXL 1I4FB 1FVDA 4R7DA 1TFHA 2CLVA 1AD9A 5EOCL 3ULSA 3MRIB 3WIIH 3QNZB 4ZS7L 2FIRT 1JZ2A 1CR9L 2NR6C 4FZ8H 3T3ME 2ICES 4ONHA 3C09C 3L3DB 1IM9B 1TQBC 3MOQA 4UIKH 5SWSD 4H26B 3MRHA 3MR9A 4PJ7A 1TMCA 3RDTD 4XAKE 3FOLB 4MJID 5JR1L 1LHZA 3NIGE 4U3HA 5JW3L 1FYTA 4OZ4A 1U3HD 2OBGA 4J3TA 2EYTB 1KCVL 4UBDC 2AXFB 4XTRC 3I6GA 2FX8H 2IAMD 5IW1A 2PTTB 4NJAL 2J8HA 1ULVA 4JFFB 1BLNA 5D5MB 5JXEA 3PGFH 4YX2H 1CFVL 3UTQB 1BECA 1HKFA 1JUFB 4YBLB 5TQ2H 4U2ZA 3MA9L 3CVHB 4I3SL 2MFNA 1NEZB 4KHXH 4NUGH 1OAZL 3FB5B 4HMCA 2FSEB 3DUSA 4JPWH 1KF9B 1WCQA 1JYWA 3MLYH 4OZHA 4LLAA 2ZCLH 2CIKA 2C1OA 4Y16A 2PYEA 5MERA 1INEL 2PNDA 4XCEB 2UVFA 5HVHC 5F1NB 4YDJA 3C6SB 3QRFM 1OAQH 1HYSC 2W9EH 4EVNA 4I0PD 1MVUA 3V6OA 1NLBH 4B41A 4HK3N 3CSBA 1PGRB 3NCJH 4NOFA 3WFBL 2XOTA 3N06B 5FYKL 2ZOKB 2ZUQC 1P2CB 3VU2A 3BZ4B 3Q48A 3B9KD 5MENB 4IEFB 5CIPB 3NMEA 5EZOH 3CVIL 3G6AB 3PWNB 4D8PB 4UB0H 4HWEH 5I1LB 1V05A 2C3WA 2QHLA 1H5BB 3BPNB 5DHYB 3TYGL 1WAAA 3U1SH 1KCGC 4L4VD 4KRPC 4NO0A 4PTUA 3MNZB 1JRHH 1X5IA 3BH9A 4X7CC 3RA7L 5JHDB 4Z7VA 1YJDC 5JNYB 4NQCA 1EGJL 4I18A 4O9HL 5DRNB 2I9TA 3MJ9H 2Q7YB 2W38A 5C0RH 3BAEH 4UV4H 1A6ZB 1B90A 4QOKD 5ALBL 4AENA 1NFDB 3DXAB 3FQRB 4P57A 3TPUB 1QLRA 4XPHH 1E6JH 3QUXD 4LEOB 5CJ8A 1PEZA 1H9VA 1LE5B 4M1GL 1ND0B 1P7QD 4ONFH 3PWPB 4G8IB 3WBDA 5KVGL 1QSVA 4Z6AT 5T1LB 4YQXH 3MRMB 2I5YH 5CSZB 3D0LB 15C8L 2D0FA 4PTTA 1B4JL 5DVNA 1XGUA 1QHOA 1IEHA 4UU9B 3ZE1F 1T4KB 5JIHA 2WP3O 2X4TB 3UC0H 1U3JA 5IMOB 5GZOC 3MX0A 4BQ9A 3SE8H 3BD5A 4JPVH 4OLYH 5J06A 3P4OA 4H25B 2OR9H 4JFXB 2PO6D 5DD0L 3L3KA 1MAKA 5ICZB 5DJDB 3CUPB 4CU8A 1F42A 5CSBA 1T3FB 5BXFA 2O26U 3C60A 3PE9A 4TSAH 4KMTH 3PWLA 4HXBL 1FZOA 1QFWI 5GJTH 2FWOB 2JIXA 1FVEB 2X7LA 2DQDL 1QYGL 1CXKA 2MQCA 3SDAC 3N50A 4PV8B 1D9KA 3QEGH 5GS2D 3L1OH 4WHYH 5GIRB 1RFDH 1DQDL 3ZKQD 5I1EL 3PGCB 1KLFA 4EI5D 3SDXB 5LGJB 4LGPB 1FL5B 3TV3L 1H8OA 2A83B 4YHIA 1IRAY 1RUKH 5DZLA 5T1KD 1XCTB 5EIIB 5JPNB 4F9PA 3OF6D 3IDIA 4NUJB 3L3OA 4LRIA 5ID1A 1RY7B 1ZANL 4BJLA 5GSVB 1R0AL 3DMMC 3ULVE 4TULL 1X44A 4LLMB 4X5XB 3BP6B 3L5IA 3WFDL 5IT2H 2AVGA 1RVFL 5D70H 5C0FA 1T2QL 1HHJB 1M7IB 1FNEA 2YPLB 2Y72A 2YRLA 3MGTA 1A6AA 1NBVL 5EA0H 4ORGA 4Y1AA 4PRHA 4G80A 3SGDH 5TGBB 1KB5A 2FJGA 2GK0B 1JHLL 4G5ZL 4UQ2B 1EBPA 1MLBA 5D1XA 2NLJA 3L95B 5BMFH 1A8JH 5ANME 1IGIH 3CJJA 2QR0A 1IL1A 5C0IA 1WFUA 3GSRB 2NX5B 4O2EB 4XC3L 3W0WB 5IP4A 3CDGB 3QBTB 3VFMA 2EXYD 2GJ6B 5D7LE 2F53A 3SKUD 4PJBF 3V9FA 2EDWA 3VXMA 4RIRB 3MCKB 4ZTOL 5FF6A 3FO2A 3DX8B 4WUKH 3IVKB 4ETQB 4G9FD 1OT1A 4BQCA 3MLSL 4M6MH 4OD2A 1UYWH 3ARZA 3FQNA 3QRGL 1L0QA 3OKOA 4IRSA 4NHUB 3F62A 3NCYS 4U1LB 2FJHA 3OR7B 4XZUA 3RGVC 5IFJB 3MLZH 1DQQB 3LS5H 2V17H 3FFCA 4NKMA 3ULUH 3LQAC 4JDTL 5IFAH 1ZVHA 1ZA3B 2PXYB 3QP3A 2E7BA 4JFED 3I50H 5E94A 3HRZA 5IMMA 2ZKHL 3GO1H 4QRPA 5EZJB 4LHUD 1IZJA 4OSUH 4JQVA 4RDQG 1IGCL 4PJIA 4N5UA 1DBML 4G6JL 3ULVL 1B6DA 4FFWC 2Y6SD 1B0WA 4ZFGL 4TRPH 5K9KA 1U8NA 3STZA 4L4VE 4OM0H 4OZFB 2KUTA 3CMGA 3GMLB 4NQVB 4PGDB 2JE8A 3CMOH 5DVMA 5SX5H 5GPRA 3QI9A 3RWJA 4P2OA 1VFBB 4G6FB 1GH7A 4XPFL 4QOKE 1QSFD 4WU7B 4E42B 1G7IA 5DK3A 3BGMA 5EFIA 5J3HD 3FONA 3G6JA 5D2NC 2F8XC 3QHZH 1ZA6B 3HE7B 4KKLD 3V7AG 3LIZL 3BWAB 3MOBL 3DVNB 4LBEB 2AXGB 1P7KB 4OM1L 4PJBE 3SGJC 3NFSH 3T4AA 3OR6A 5AWNL 1C5DB 4MNGE 2IPUG 4H1LG 3MJ7B 2A6KB 1LDPL 1SY6A 3CIQA 5IM7B 5F89B 3PWJB 2NY3C 1S9KC 2X4RB 4RGMB 2CGRH 3SKOB 1JPFA 2YA1A 3X11A 3TZVB 5EWIL 2AJXL 1AKJD 4BFIA 1QSEE 3MLWL 4PRAA 3SQOL 3PL6C 5HYJE 2E9IA 2DQIH 2BOCA 2ORBH 1Z3GH 3LKOB 2F5AL 1MCHA 1NGXB 3B8YA 3C5SB 3VCLB 1JZ3A 1KFAH 1D6VL 4M5YL 4YXLH 3ZDXE 1GXEA 2PW2A 4N8CH 2AV1B 3MJ6A 1EFQA 5D6DC 3R06B 4GT7A 5GS1B 4XRCB 2AJUH 1V7MH 4XBEL 4HXAL 4ZUUA 4U0QB 1RUAL 3RZCA 4O02L 5EZIH 2RFXB 3MV7D 3GMQA 3MRPA 2A6DA 1LDSA 2VXSL 3CSGA 3KPNB 3WNOA 3GIVB 2X9XA 4Y2OA 1AGCB 3ZLQC 1VKXB 3VFPA 1UC6A 1CTOA 4M48L 2F9BT 4ZOAA 5C1MB 2ESVB 1XIWB 3SJVD 3EDDA 4WWKA 4LCCB 1E0OB 4WO4C 1JTOA 4IRJC 4TSCH 2YSSB 4L4TB 4YO0B 3QG6A 4ZFOB 1P4BL 4QHKI 1FYTD 1CFTA 5HYIA 3MLXH 3VWKD 4FRWA 4PJEF 3U9UA 3GFUA 1OHQA 2L7JA 4LSQL 5JHDD 3VFUA 1WSST 4YPJA 3BSZL 5DR5L 3GIZL 5CWSA 3H42H 1YUHB 5JXED 4GUPA 1RURL 5HPMA 3KLHD 4U49A 4OLZH 4KRLB 1I8LC 2B1HL 4YHLL 5CEZH 4EOWH 3REWA 5F3BB 5ACZA 1G0YR 4MA8H 5LCVH 1IZKA 1YN7B 2ZCKH 3PWPD 1D5XB 5IWLC 5EN2A 2A1WH 1QFHA 1N59B 1KEGH 1XGRA 2QKIB 2BY1A 4G9FE 4EUPB 1UM6H 1KCRL 1CL7H 4O2CA 3SDCD 4G9DA 3EOTH 1DQML 5D5MF 4FHBD 1FV1A 1G7JB 3WSQL 3VJ6A 4IJ3C 3JVGC 4W6YB 4NRZB 3PJSA 2R0LH 4GKOA 4RMTA 2NY5L 3TT1H 3BW9A 5IBTL 3ELAT 1VESA 4N0UB 5HSFA 3BPOB 3T65B 2XTLA 3CSYB 4N9GB 2DD8L 4PP1D 3C9NA 4YDVA 1MELA 1OGAA 3HAEH 1TDQA 1R5VA 1JGLH 5FCUH 1YC7A 5IGXH 4EN3B 3SPVB 3FFDB 4N0FB 2IALA 4NO0D 2BNRB 2DYPA 4JN1H 4ZUTB 3GSWB 1IEBB 3IFPA 5D6CA 3D39E 1FNGA 1HOCA 2ATKB 2XN9E 3NACL 5EC1B 2AQ1A 1CFQA 4PJEE 4ZAKC 4RRPG 1VHPA 3O2DA 3LD8B 1CGTA 1MFAL 5D7JB 3TWCH 3LB6C 1DVFD 3P30L 2P42B 3B2UC 4MAYA 3QJHA 4OLUL 4OIIL 4XNZB 1F3DH 3GRWA 1QSFE 1OW0A 4F2MA 2IQ9H 5I0ZA 5ERWB 1NAMH 1JK8B 2Z35B 1JGVL 4ODHL 4KXZI 3E6HB 4RWYH 3IFOA 2B1AH 3VGAC 2YPLD 1ZS8B 2QQKL 4ESKA 4RAHA 1LE9A 2R4RL 4H0HB 1J1XL 1BM3H 3MBED 1U3YA 3MFGB 4OF6A 3CX5J 1VCAA 3MRJA 5I71B 3CU7A 4Z7OE 1OAUL 4NRYA 5I0DA 5JW4R 4OZHF 4PR5B 2GJ6D 1LO0H 2NYYC 5JOFA 3K3QA 1A6WL 5J6GA 3MRLA 4TUJB 4GAGH 5D7KE 5BOZG 3G04B 2JIXD 1BZ9B 1CDGA 3UJIH 1T20A 4OKDA 2YK1L 3I02A 2HT3D 4GRLC 4HPYH 1N8ZA 5EIQA 2BDNH 3LKQA 2XWTB 2P24A 4GOSA 5BV7H 4MD4A 4QTHB 1NUNB 3MV7E 1BF2A 4MD5A 4D94A 3K2UL 4KKBD 3AREB 2A73B 4KVCL 3RL1A 2XA8L 3GSXB 3QQ3A 3LHPL 5I1JH 1OY3B 2WLZA 4GO6B 3O45B 4U1GB 2J5LB 4DVBA 2AV7B 3SCMA 2JCCA 2M8XA 4NJ9L 2PW1A 2EIZB 3VGHA 2JLLA 4YK4B 2Z9TA 3TVMC 3GKZA 5L2KB 1WAAF 4GQPH 2EEAA 3DROA 2YKLH 4DEPC 4RA3A 1VSCA 4PJ7E 3QUMB 3MLUH 5I1AA 4XNUL 4Z7VF 1S5IH 4UILH 2ADFL 3O3DA 3IF1B 3KYMB 1FYTE 3PV6B 4HMEA 4Q2ZA 1PQZA 3FZUD 1AGEB 4PD4J 3U4EB 4RGNB 5DEGB 1Z0NA 2UZYB 5HDQL 5D1XD 3ROOB 4GKZA 3NCYP 4RMVA 1NAKH 2A6JA 5IF0A 3K46A 4C4KT 3U6RB 3VD9A 2V5MA 2Y5TA 5KSAC 4KU1A 4Q9RH 3SKNA 4JM2C 2MCPL 3TIEB 3QCUH 3HE7D 4OZHE 4JRXD 2PYEE 1QQDB 5FHAH 5IBLD 5KSUA 4X5WA 1CD1B 1BEYH 1G7HB 1I7RB 3VXRD 2PCPA 4JZJB 2LVCA 1P1ZB 1XGYL 4P4KB 3DYPA 3BEWA 3V6OE 4DN4L 4TSBH 4H20H 4NWTL 1T0NA 2YPVL 2WMPA 3V0WL 4MVBD 3FFCD 4ALAL 2NY1B 3QCTH 4X8JA 2YZ1A 3TZVD 1P69B 4JO1L 1QBAA 3O8XB 5GGTA 4KROB 4FOMA 4QXTA 5CP7B 2WLYA 1EO5A 4DGIH 3D69B 3IKCA 1P84J 1KLUB 4PJXA 2Z31A 1YY9D 2Y25A 4ZPVA 4ZS6C 1MRDL 3LH2L 1RI8A 4I9WD 1YNLH 5INDA 5L88L 1FPTL 1IGFH 4ZG1A 4GMSL 3G08A 1WAAE 5DJZB 1EFXA 1MJJB 1AR2A 4UINL 2HP4A 1UWGL 1Q9WB 1E4XH 4OCXH 4PJ8C 4Z7VE 5I73B 1T22B 3NAAL 3X14A 3QB7C 2QHRH 1BQHA 1E28B 4NQCE 4OV5B 5FV2A 3FO9A 4P2OD 4PD4K 4JN2B 1W0VB 4M4RA 1CK0H 2GT9A 3QHFH 5GGRY 5TPWL 2VN4A 4LVOC 2Z8RA 3HRPA 2AI0H 2EKJA 4KK9D 3SDAA 3HZMA 3EYOA 1F4HA 3AROA 4L4TD 3M07A 4EKXA 3ZTNL 3K74B 4QEGA 1RK1B 1J18A 1E27A 1LNUB 3ARGC 1KG0B 4JY5H 1HDMA 4UOW0 4ZSOA 1X4ZA 3NFNA 4IDLA 4EDWH 3REVB 3LKPA 2BVQA 4GFTB 3B2VH 4HF5H 5JOEA 1M05A 4PREB 4GAFB 4KVNH 5HI5C 2FEEL 3SKJH 3M17B 4Y4HD 3FCTA 4ZXBC 4FZEH 1BWMA 1QBML 3MNWA 4P23C 3DMMA 2DQEH 3IB4A 3VG0L 3IFLL 4MZ3A 4TUKH 3VGDA 5FO8A 3WD5H 2VDNL 4CN6A 3G5ZB 1HHHB 5DK0A 2DDQL 1JMXA 2EZ0D 3G5VB 1UB6A 1P84K 5ABDE 3V6FB 3FB8B 3IGAA 5DMIH 3MRFB 3OAZK 1P5UA 3RZCD 1PG7L 4PJHA 3WFEH 2XY2A 2WQRA 5E0QA 1H3WM 1X3DA 2ADGB 3CK0L 3ARDB 4MNHB 2Y1VA 2YC1B 3W39B 4HFUL 1IGJB 2IPUK 4PJ9C 5GGSB 1XGTB 3VXUB 1KPVB 1MCOH 2DIJA 4CN1A 3Q5TA 2XI9A 2VLRD 3L7EA 2BXZA 4FQQB 3BDBA 2VWEE 5INCB 3O6FD 4IMKC 3C8DA 2Q6WB 1SJEB 4E9LA 2DL9A 3QEUB 4GRWF 2J88H 1QBLL 4PJIF 1DFBL 1YMMB 3O41A 3OKYA 4FQXD 1U8PA 4YEFA 4NC0B 4BKLB 3QIUD 3DX9B 2J4WH 2ITCA 3WFCL 3JWDH 4EN3D 3QQ4B 5DUPL 2WIMA 4OAWA 3RGVA 2ZJSH 2H1PH 5DMGD 5CBEB 3HMWH 3ISWA 1M71A 2VYRE 1MJUL 1DE4B 4PRHE 4XP4H 4S1RL 3MRKA 4DOHE 1HH6A 2VSCA 2VXTH 3HC4L 3DV4A 2VZTA 4ODUB 5AZEH 4RGOL 5J13B 4XBGA 1INQB 4KKCC 1JNNL 4CNIA 5E70A 3IFNH 3S3PA 4GW1B 4TUOA 4WW2B 1B0RB 1RK0A 2F53E 3QCVL 1ZSDB 3IXAA 3VE0B 3VXME 1RULL 5F6IB 4YLQT 1QSZA 1XT5A 1RUPL 1JHKL 5FYJE 2YUZA 2EE6A 2DI8A 4JRXE 4XPGH 3KS0J 2XTJE 3VXRE 1NGWA 3BGAA 5IK3B 5SWZB 3MXWH 4EXKA 3UTPD 3FO0H 2NTSP 4NM4H 1UXSA 3AVEA 1LEIA 5DJYB 5E1HB 2CLZA 3FFCE 3WJJC 1J5OH 3DECA 3MV9A 4WEMB 5D2NA 5EU5A 3FOMB 5C07D 2DQGL 4QRPE 3FL7A 3SGJA 4L5FL 5DO2D 2X4NA 3GMPA 4I9WE 2EEBA 5GISH 3QXUA 4X99B 3EOAA 4GRWE 5DFVD 4JDVB 4PJIE 3MCG1 4WDIB 3MRBB 4S1DC 4LOUD 5DHVH 3ZZ1A 1T04A 3RWIA 2E5EA 2FCBA 3NZ8A 2VL5A 3BD4A 2ATPB 3PL6A 5I1GL 4NYLA 3WLBA 4U3XA 1NC4A 1K8DA 1G7MA 4LCIH 4OLXL 3ARED 2R23B 3CFEB 1CLZL 5E8DL 3INUH 5IKCA 1LWRA 2EDKA 4YBQC 4GG6B 3EJZD 3GNML 3LN5B 4PV9B 4MAYD 1CF8H 2APBA 4XPAL 1KB5L 5J1AB 2H26B 1ZT4B 4Y5YC 1WWWX 1MQKL 4N0YH 4R96A 5D6DA 4YXKH 3G6JE 4LU5H 2HTLD 1XGQA 4JANB 1IKNC 2NXYD 4MNGB 3R4DA 4JO3L 4AEHL 5HYFA 2HN7A 3W2DH 5A3ID 1IKFL 1BBJA 1DDHA 4XHJC 1OB1B 4FQLL 2QQNL 3B3IB 3D0VB 1YEEL 2K7PA 5FYJL 1QSEB 1AI1L 3GSNA 1C12B 4RMWA 3TLRA 2I27N 1JHTB 3FMGH 4XMKL 3UBXA 5LAXB 4F3FA 1NC2A 2FL5B 4P2CG 5TFSL 3KYNA 4HCRA 4OJFH 1U95B 2WUBL 4JAMA 2AJSH 3QPXH 4WO4A 5H94A 1FIEA 2DLTA 4IRJA 5CFHA 1IGTA 3V4UL 3L3JA 4S2SB 5ADPH 2C3GA 3O9WB 3FQUA 4U1SA 3HFMH 1PLGL 2EDYA 1X5ZA 5F7EH 3MRGB 1S78D 3CFDB 3UYRH 1WWAX 1YEJH 3T1WA 3EBAA 3VRLF 1I8LA 1CLOH 3W5MA 1CI5A 4K2UL 4EDXB 5HHVL 5ICYA 2VLRE 4IS6A 1V8HA 3QDJA 4ZQKA 3TO4C 3OG4B 1F4XH 3QWOB 3SCMD 2H6PB 5BV7C 2DQJH 5IEHB 3GI8H 4JG1H 5IWLA 1LVEA 4X6FA 5DD1H 3UTOA 1H3PH 2LVEA 1MCFA 1L6ZA 3S3JA 3GB7A 4GLRH 2XYCA 3BD3A 2JK5B 4LSRH 2ADIB 2ERJC 1KNOA 4HIIB 4X83A 3CH1B 1E6OL 4PRDA 4K3DL 5AG9A 3HZVB 4RMRA 2R69L 4JB9H 3MV8B 5JZ7D 2FGZA 3MRRB 4AG4L 3DRTA 5H2BA 1YEDA 3LRGA 3WN5B 3QUYB 1RIUH 3WS6C 3KLDA 4CN4A 4XVSH 4NHCL 2FBJL 4OLVH 1SY6L 1RZGA 3FTGB 4Y4FD 4HUVA 4Y4KB 2CXGA 4PRIB 3QFJA 2YUXA 2YN5A 3T0EC 1SJHB 3O3AA 3GJFA 4V2CB 2HG5A 2GITA 2VABA 1VGKB 1J8HB 43CAA 1T66D 1B0GB 4PUBL 2AK1L 5MI0B 2R2HA 1OTUD 4Q74A 1ZLWK 3JXAA 5I8EB 4HKXA 4F7TA 5C9JB 3RWDA 2OK0H 4HWZA 2AABL 2E7LC 4ODXB 4ZAKA 1A1MB 4XMLH 4DFIA 3EJJX 4UI2A 3T4YB 5FFLA 1QACA 2J8OA 4L9LB 3ARWA 1MQ8A 1KSRA 5ACMA 1EXUA 1VFUA 1CFSA 4X7EC 4LLDB 3JUYA 4UDTB 5DJ6B 3VRLE 4JY4B 2Z31D 4AIZB 2J3SA 4K8RH 5EUKA 4RQQA 5KVFH 1XZ0B 2W07A 5FHBL 4OT1H 2CMRH 1N5YH 1Q9OB 2ZOLB 1OGAE 4G6MH 3RPKA 2YD6A 3DGGB 1EFXD 3D39B 1MJ7H 5IJKC 5GZOD 4IMLB 3NIDE 4JLRB 1CD9B 1I85C 4YUEH 2NY0B 5C09D 5CEYA 4EZMA 3SOBL 4GKSA 4M6OH 4CDHA 4K9EL 4ONGH 3ARTA 2BFVH 5IJVB 1CGVA 5A2IH 2JCCF 2A77L 2CPCA 1T5WA 3F5WA 1MFNA 4R0LB 2RJMA 4JRYA 4XAWH 1X5GA 5DDHB 3JWOL 5EORL 8FABB 3BISA 4NT6B 1I9IL 3IDUA 4WJ5B 4L3CB 1FZKA 4PS4H 1JPST 4KPHH 4U0RB 3U83A 1YMMD 3L6FA 4GRLA 5JUEL 4ZUVA 4MXQC 2MHAB 3K8MA 3HZKB 5TE7H 1QNZH 1KT2A 2X9WA 5ADOL 5AZ2L 1NMAH 1PYWB 1TJIH 3ERYA 2Y07H 1FJ1B 5E99L 3CSPA 2LFGA 1ZGLA 4FQ2H 1A9BA 1UH4A 2XNAB 5DJ8A 4NO3B 1NBQA 3QNYA 1OTTD 3TVMA 1IQWL 4X4XB 5DTFB 1IC7L 2VAJA 1OAXH 4HK0B 5E9DA 4TTDC 1PY9A 1BVKB 2R1YA 4PY7B 1QEWB 1G7LA 5EU7C 3JV6B 1R3LB 4WHYG 4ZS7H 4HULB 1CR9H 1MCIA 1ZMYA 2NY7L 3QH3A 5JOPD 5L0QC 1LK3L 5KTEL 1BAFL 3WNKA 1VGEH 3MGOB 3O4OC 3SDYL 4KDVA 1XAUA 4U1JA 5FAAA 3WNNA 4ZUSA 1N4XL 3NOIA 2CLVB 4X6DF 3TCLB 5SWZD 5JR1H 3CCHB 1X5YA 5JW3H 4X4MA 2DJUA 4X7DC 2GYSA 3VGBA 1J8KA 2EYRB 1KCVH 1LEKA 4DCQA 4U1MA 5KSAA 1CYGA 1A1NB 4X7SL 4JM2A 4L29A 3VH8G 1U8QA 3MRHB 5C7XL 1J0IA 2JCCE 3MLTA 4PJ7B 1PSKL 1TMCB 3O2DL 5T3ZL 4BUHA 4YHZH 2QSCL 1MCDA 3FQWA 2D7OA 1JI2A 3Q6FA 5ESAA 3ARSA 1F90H 4FFYL 3GRWL 4PRPA 1OAZH 3E6FB 4YXHH 3PGDA 4JFDD 5IW1B 2IADA 4JFQA 5DD6B 1BJ1J 3RUGA 1INEH 1DBAL 3DUHA 2O61B 4U1KB 2IGFL 1CDJA 3V6BR 3P4NB 3JWDC 5ESQA 3RNQA 2DWEA 4HFWA 2P5WA 5FKPB 1MCEA 5D1QD 2O93L 3MRQB 5IMKA 3WFBH 4WI6A 1F4WH 2PYEB 5MERB 5FYKH 2XICA 3QDHA 4KK8C 2F8OA 1ZLVK 3OXSB 1KJVB 3RVUC 1MVUB 4KI5C 1AGBB 4PJ8A 3CVIH 4C58B 1JGDB 1YPZA 3ILPB 3PV7A 3DBXB 3NCMA 1A6TA 4OIAA 3RVWC 5EZLB 3ZSTA 1S8DA 4WENB 4XMPL 5D2LA 1X7QA 3LEVL 4JKMA 3RA7H 3MV9D 4LDOB 1WCBA 1HXYB 4Y0GA 4QO1A 4W4NA 4LF3B 2K3TA 4PJXE 1WWCA 1KCKA 4HKBA 3FJTA 3BDYH 1T7YA 5I75B 3ES6A 5ALBH 4ZFFA 4ODWA 3ARGA 3W9DB 5EG6C 4PJHF 1F4AA 3QDGA 3BJ91 2XY1A 3VXNB 2HTKC 1W72H 4I48B 1QLEL 3BH9B 2AKRB 1FSKC 3VXTA 4L8SC 3TBVA 2JELH 4M1GH 1RZIB 4PP8C 4I18B 2I9TB 4G7YH 2R1WB 4ZXBA 3BN3B 5KVGH 3WV0A 4KMQA 3BXNA 3CGTA 4A6YB 1NC4D 3WJLC 4P57B 4RA0C 5CGYC 3RX8A 1QLRB 15C8H 3LKSA 3KDMB 5DVLA 2VR4A 1L7IL 3WHXB 3K80A 1FFNA 3QWRA 3MLVL 4LPCA 4P3DA 1P9MC 3E3QC 4Y19A 3WS3B 1JGUL 1MIEL 4PTTB 4N0CC 1XGUB 5DD0H 1OGTB 5HGHA 3EYVA 3F7VB 3W9EB 3ROLA 5F7FA 1MFCL 2VL4A 4MQ7A 3VXSA 1TJGL 1UVQB 3FQXB 2P5EB 3TNNB 4M5ZL 4PJ9A 4ZSOE 5F9WB 4I4WB 4OLEA 4XP1H 4KK5D 1F11B 2OCFD 1F97A 4GG6F 2DQDH 1DBJL 1QYGH 1YJDL 2CK2A 4IMKA 3P4OB 1INDL 4XVUD 5EIVA 3U4BH 3GUTA 3TF7C 1U93A 5I1EH 5CHNA 2YR3A 5JPMA 2GUOA 4JG0L 5EO0B 5BXFB 3C60B 2GSGA 4PRID 3A0OA 3VFSA 4X98A 1WC7A 2OL3A 3PWLB 1ZT1A 1SYSB 3M8OL 5GGTL 3TT3L 5CMAB 1KLGB 1I1FA 5F7DA 4IDJL 1D9KB 1ZANH 1ZEAL 3KYOA 5CEXA 1WWBX 1R0AH 2VQUA 4CAGA 4TULH 3CAFA 4QTIL 2VITB 3O4LD 4D9LL 3WFDH 3EFFA 5J12C 2C7UA 4PJHE 3Q5YA 3VG9B 1RVFH 4YHIB 1Z5LA 3QPQD 3BZEB 4PJDA 1J11A 1TZHB 3CZFB 3RTQB 3IDIB 2R0ZL 2VLLB 3L3OB 3S34L 1NBVH 5ID1B 1JF1B 5C0BA 3MROA 4QHUA 1I1AC 4DZ8A 1TPXC 2OJEA 2B39A 1NQBA 3WL9A 2R1XA 5JHLH 3BQUD 1RZKH 5K59F 5TF1L 1A14L 4K3EH 2AS5M 4XC3H 1OVZA 1A47A 4YFEA 1OP9A 4EBQL 2V7HB 4F9LA 2IANA 2UUDH 1WGOA 1U8MB 3RHWK 4S11A 5SV3A 4Y1AB 4G80B 2DKUA 1JV5B 1EVUA 2NY0D 2GCYA 4DOHB 1MLBB 4JFDE 1RJLA 1SBSL 4ZTOH 4W4OC 3BPCB 3SY0A 2QR0B 4NM8L 1BFVL 5C0IB 2EDFA 5AAMA 1KENH 3WJJA 5GGVL 5FECB 3N1GC 2Z93B 4MMZC 3DO3A 1HHIA 3B83A 4TOYL 1URLA 5FGBA 1U8LB 2F53B 3QRGH 4BSVB 2ZUWA 5FGCB 3VXMB 2EH8L 3EDFA 3QFJD 2P49B 3HI5L 1OPGH 3ZSSA 5HVGB 3FO2B 5GS0D 3U2SA 1VADA 2XTJB 1Q94B 5B39G 3T0AA 2DQHL 5E4EB 1PAMA 4OD2B 2ZKHH 2YUVA 4ZAKD 3SGKC 1A21A 4NC1C 4IRSB 4OBRA 3TNMA 3HAEA 1KPRB 2FJHB 4PYHA 2M2DA 2XKSA 1P6AB 3QUKA 1DBMH 1YC8A 3ULVH 1KBGH 4NN5C 2F8VA 4NQDB 4Y5YA 5FCSH 1G0XA 2W0KA 2QV2A 4P2RA 3HRZB 3LKNB 3HAEG 1UH2A 2WWKO 3MV9E 3D18A 4OZGF 5D2NE 1IKNA 4XCFH 2NZ9C 2VLJA 1OF2B 1E4WL 3RPIA 4QGYA 3VDAA 3WDHA 3DHJA 4XPFH 5HHNA 1IEAA 5I74C 5K9KB 3QA3A 2R9HD 4DTGL 4MB3A 3OAUL 4JKKA 4HJ0C 3S4SA 3K81A 1CE6A 4HUKB 3LIZH 3MOBH 3HCVA 3OKKA 4TVPE 3GMNA 2DTMH 1WBZA 3VFVA 5AWNH 1D5MB 3S96B 5IQ9B 1LDPH 3HHRB 1CICA 4JRYD 5B8CC 3H3PH 3LQAL 4M7LH 2MPAL 3CXDH 4QRTA 3SGEH 2XQBH 5H35B 5EWIH 5GJSL 1A6PA 1G9EA 5C70A 3B9AA 4NP4H 3MLWH 3SQOH 5HGAA 2D03L 2AXJA 1QD0A 1NCDH 2F5AH 2DKSA 2JB5L 1C7SA 2ZUSA 4M5YH 1D6VH 4Y5XC 1J7VR 3OQ3B 1A9EB 4C56B 4PRAB 4NC2B 5FUCC 3TO4A 1FNAA 4R90L 1GHFL 2BOCB 4HXAH 1RUAH 4JHZA 1ONQA 3AS1A 4JFYA 1RZJH 3D3VA 4O02H 4YR6A 2HKFL 3G5YA 4QRRD 1IE5A 2EC9U 2VXSH 4CVXB 1FBIL 1F3JA 1DLFH 2C4FT 4UOJA 2NY6D 5C0CA 3BDXA 4JFPA 2B8OT 1LO5B 4LCWA 4M48H 2Z0BA 3QUZC 1FO0B 5DWUH 3K4DA 1ZLUK 5LQBH 3Q1SL 3NN8A 1HN1A 3WS6A 4Q58C 4PB9L 5KVDL 5EU6A 3B5GA 3O4LE 4LHJB 1P4BH 4LQ1A 3V5HA 4K94H 4WFGD 3LVEA 4J7RA 3QZWA 2OLDA 1A2YA 3DHMA 3W82A 4R4BB 5HDOA 4QHLA 1TTUA 4LSQH 3T0EA 3VI3F 4F58L 3BSZH 2X4UB 4TVPL 4MQTB 3QDJE 4MS8C 1JMZA 1Y0LB 1UQSA 4WWKB 2BVEA 3GIZH 3IDJA 4Q6IC 1C1EL 3KPLA 3VGEA 4F7EA 1FG9C 5B38A 1RURH 5HHMD 4OZIB 1B2WH 4HLZH 5LGHL 4YHLH 3U9UB 4OFPA 2E7LA 3BE1L 3Q3GB 1WIOA 1GPOL 2Y06L 1UADC 3QT2A 4L8DA 1MLCA 4GKNB 2P47B 5E2WL 3G9AB 4GUPB 1A3QA 5HPMB 1GGCL 5CILL 3GEWB 1YYLL 5EDXA 3LRSA 4JGUA 4JY6A 3REWB 4LP4A 2CR6A 4O4YL 3F12B 5IB4A 3S35L 4C59B 1DQMH 3GSNL 3KJ4C 3IJSA 1S9YA 1AJ7L 3S9DB 3N1PC 2QADC 3QFJE 3OSKA 4IOIA 4HIJA 4KGJA 4JFHD 5GS2H 1J05A 4HCRL 2CD0A 1FIGL 1I85A 2NY5H 2PUQT 3C08L 3VGFA 5IBTH 4WFFD 5EBMA 5D7SH 3WIIL 4O2CB 1NCNA 5KSBF 2DD8H 4AT6B 5A2JH 4WI9A 4CU7A 2P5ED 1OCWL 1A3RH 2HH0L 5CZVL 1XMWA 3S98A 3PJSB 4JCLA 4XCYB 3BW9B 5DURD 1PY4A 4PJAA 3QIBD 1YZZA 3R0NA 4BZYA 2HA1A 4OGYL 1MH5B 4WW1A 1B88A 3NACH 2OSLA 3OB0K 4DGVL 3C9NB 3ZKMC 2ARWA 1OGAB 5IB1B 2YD3A 1MFAH 1R5VB 4HIEA 4MXQA 3VI3E 4I3RH 1J0KA 5DLML 3P30H 2IALB 2DYPB 1BJ8A 4XHQA 4KDTC 1HQRA 4OIIH 5D6CB 5F1IA 4J1UA 1HOCB 2NXZB 3DIFA 1VERA 1A7RL 2IPKB 1MHEB 2XACC 1G9NC 4NUGL 2V2TA 1FCCA 5C6WH 4GRMA 1YECL 4Y2DC 4JM2F 3IDNA 2QQKH 5CCKL 4OF8A 2R4RH 1J1XH 1MUJA 3OXRB 4JRYE 4JDZB 4UIMB 1FH5L 4X6BA 4QHMB 3VMPA 5A40E 3AS3A 1OAUH 1JCKA 1Y18A 1EUUA 4MX7A 3C8KA 3UDWC 1HZHL 1GC1C 5DJXA 3DO7B 3VXSD 5T3XD 2AJ3A 1A6WH 1U3ZA 3P4MB 1R24B 3V7MA 3CDYA 3MRJB 5BQ7A 3QULB 5ITFA 1JL8A 1G1CA 2HT4C 3C09B 2YK1H 4LQFL 4NRYB 2Z4QA 1TQBB 4HWEL 1U8JB 5C0JA 2H2SD 4AQOA 1H15A 1UG9A 1KELH 1LGVA 5EOQL 3U1SL 2GFBA 4J3WA 4XXCC 3LEXB 1BJMA 5EUOB 3MRLB 3SHSA 3K2UH 1DBBL 5E9DE 4FXKA 1JZ6A 4KVCH 1T83C 4ELMA 2XA8H 1EIBA 2GSIA 5ID0B 2GJZA 4L3EA 3CC5A 1YPZF 3X17A 4NJ9H 1E4KC 5C0RL 3RNKA 1S7VB 3ILQD 3H0TA 2OQJA 2AQ3A 4I8DA 4UT7L 3VXPB 1KCLA 2P8PB 4MD5B 5KVMC 4D9RD 1JIBA 2LV4A 1E6JL 3RL1B 3AXLA 4XNUH 3QQ3B 2ADFH 5GZND 2BNUA 4X4ME 1VB9A 2YEZB 3KNBA 4Y5VB 3MYJA 1U8OA 4WFGE 4FMKA 1MCSA 4Z7UA 2IMNA 4M8QA 4CGTA 3RWFA 5BZWA 4AZ8A 5E6ZA 3DYOA 2AQ2A 2X70A 4U6XA 3UC0L 3O3DB 5HHME 2OP4H 4LFHG 2V2XA 4PRPE 4FG6C 4OLYL 2DICA 1RZKC 2MCPH 1WTLA 1XR8B 4GKZB 2ZUQB 2I07A 4ELKA 1AD0A 4JKWA 4GS7B 2A6JB 4NN7C 4HHAB 3RUGE 4RFEA 1QOKA 2D3VA 5J9PA 2BSSB 4TSAL 3MLRL 2NQCA 4NO2A 4CMHC 2Y5TB 1UH3A 2F54B 2XKNA 3OHXA 2P5WE 1D6EA 3V0WH 4ZFZA 3V6ZB 3QEGL 4ALAH 3L1OL 3QXVA 4JO1H 2R8SL 4Z0XA 4G8GA 1UCTA 1CGUA 1CIUA 1KTLB 4HX1B 4L8SA 3VFTA 1MHCB 1EK3A 2WM0A 1MRDH 4WFFE 3DURA 2V7NA 4PJGA 3LH2H 3HNTL 4P5TC 5IEKA 1OTSC 3WJLA 1YPZE 5L88H 2ZCHL 4QCIB 3BESR 1FPTH 4I0CC 4C56D 2DMBA 4GG8A 4GMSH 1F3DJ 1T1ZB 1OOAA 5DXWA 5IVZA 5IT2L 4UINH 4HUUA 4BH8B 5D2LE 1K3IA 3S36X 1KIPA 5FM4A 3E3QA 4UNVA 3NAAH 3MV01 2VLJD 5INDB 2NW3A 1S7UA 5DT1H 4N0CA 2NY4D 2X4PA 2L4OA 5FDWB 3TH2T 4GW5B 3L9RA 3QDGE 1IGIL 2DJSA 5TPWH 3DYMA 5BJTA 4NCDA 3RDTC 4BUGA 1OARH 4PJDF 2APVA 3X14B 2YBRB 1SMOA 1U3HC 4RDQF 3KPTA 2CKBA 4J23A 3VW3L 3ZTNH 3TF7A 1XR9A 2IAMC 3VD3A 5CZKA 3Q0HA 1MCBA 1CICD 1FFOA 1L0XA 1N5AA 2P8LB 2WZPD 3MLPA 2E9BA 3BP5A 4O2FA 2KDGA 4XBPB 2MKWA 4MJ2A 3DX7B 3A6BH 3RAJL 3SDAB 4M6ML 3HZMB 3EYOB 5JO5A 5C8JB 4BZ2L 3ARBC 5GGRA 1XCQA 1QBMH 2WWMC 3H3BC 4I5BA 2B4CC 1E27B 4Y19E 3MLZL 4FS0A 3IFLH 2D7QA 5IFAL 1PJ9A 2BVQB 2G60H 2VDNH 5DRXB 3IU4L 2BSTA 4LVEA 3VXSE 3I50L 5T3XE 1DANT 4R9HA 2DDQH 5EC2A 5AG8A 3FCTB 4I0PC 3ZMRA 2A9NL 1I1AA 3QXTA 2VN7A 2RCSL 1AQDB 1KJ2B 4OSUL 1DQTA 1PG7H 2J8UA 1I3RA 3CK0H 5FO8B 3U0TB 5I9QC 4HFUH 4N5EA 3GBLA 3EO9L 5DK0B 4U4BA 3GMMA 4X7TB 4XPBH 2YPKA 3B9KC 2QSTA 3IGAB 1RZJC 5FA4B 2AEWA 4HH9A 4XNQB 4W4OA 1QBLH 4MSWB 5EU6D 1DEEA 2YXMA 1QFUH 1RUQH 1TVHA 3V8OA 3D5OF 3L7EB 4D9RE 2HFEB 4M7ZC 2BNQD 3HUJF 4U33A 3HI1A 5IV2B 4PJDE 3WFCH 3QHZL 5DUPH 1KC5H 3M1BA 3TIDA 2WIIA 2MKLC 3JV5A 4V2BA 1L9NA 5C0BE 5FYLD 2VDOL 4FP8H 3NVQA 1MJUH 1ZHBA 2W60B 4S1RH 3O41B 4HPOH 3DTXA 1U8PB 4DUVA 2UWEA 1UKQA 4KKAD 3HC4H 4WNQA 5BRZB 3O6ML 4K94C 3VXOA 3QUXC 4NPYA 4DVRL 4HJGA 2CGRL 4Z78A 1FZJB 3CZJA 2VH5L 4OAWB 1D5ZA 1M71B 3QCVH 1A64A 2DLEA 2ORBL 4D0DA 1P4LB 3ARFB 1HH6B 1S7SA 1RUPH 1JHKH 3DV4B 3PABB 3PDOA 5DA4A 1CU4L 4XBGB 5E6IB 2VIRB 4G8EA 5E2VL 3T1FA 5AD0A 4XCNA 1PZ5A 5C3TA 4HC1A 4KHTL 3IXAB 2JJVA 3WNLA 4B7IA 4OZIF 4LARL 2PO6C 3T8XB 2FZ3B 4M93C 4CMMA 3KYKL 3VRJA 3DVGA 3EW3B 3L5WA 4IIQB 1NGWB 5IQ7L 1FVCA 2C5DC 3ZHDA 5BS0B 2OL3L 2DQGH 1A7OL 2ZNXA 4L5FH 1QO3A 5CUSL 1Z6JT 1OP3H 3ALWA 2CLZB 4FN0A 4KJWD 3NCEB 4UUJB 4WU5A 4EI6A 5D2NB 4LPVA 5EO1B 4EI5C 4TSCL 4ZUWA 5HPOA 3HUJE 5I1GH 3ARUA 3O0RL 4MXQD 1U8HB 2VLJE 1CLZH 2VXUL 5E8DH 2A6IB 4HT1H 3KPRA 2NY3B 1DLHA 5TH2B 1FAIL 4XPAH 1KB5H 2IFFL 3EO1B 3H42L 4Y5XA 3SEPA 1T04B 1M7DA 3RWIB 2A74B 4G8FA 2X44D 3NZ8B 5FM8A 3BPLC 2PYFB 1AQKH 4PLOB 3PL6B 3WLBB 4JO3H 1EH9A 1G7MB 3BJLA 1SVCP 1FN4A 5IKCB 3MNVA 1IKFH 4LLYA 2VE6B 2Z91B 2ZCKL 1FLRH 5HDBF 3UYPA 1PKQA 2X4QA 1K4CB 5JW4N 2A1WL 5FYJH 2HJLB 1AI1H 1T2XA 4EUPG 2RQ8A 3T2PA 2VZUA 2YXFA 3HG1A 3QUZA 2MWCA 1CL7L 2EXYC 2GAZA 5TFSH 1FFPB 4GBXC 2X1XR 1BBJB 3SE4C 5J4MA 2EYSA 1ETZA 4P46B 5ETUA 4GXVL 2O5YL 2Y4SA 4M4PA 1UCBL 3KPSD 1C5BL 1SJXA 4MCYB 3QO0A 4XC1L 1PLGH 1H3GA 2X40A 4V1DA 4WO4B 5H94B 4Q6IA 4IRJB 3WNPA 3OKNB 5IGXL 3D3VE 2HMID 4GRWH 2FEDD 2F54D 1L8JA 5IIEA 1NMCB 2XWJA 1VENA 5FIEA 4Z18A 4UTAL 3D25A 1RZFL 4U1SB 1FZMA 4L3ED 4PBVC 5C0CE 2DI7A 1JGEA 4LCWE 5DD5L 1CXLA 3UX9B 5AYUL 3VWJA 2Y6SC 1SM3L 5EU6E 4PJAF 1K5NA 5ICYB 5D93C 3CH8A 1E6OH 4ZQKB 4K3DH 4LNRA 1RHHA 2BNQE 1MCWW 2R69H 2BJML 4E41D 5E1AB 3GSUA 3MBXH 1CT8B 2X5PA 2Q8AL 3T0EE 4F7PB 4RWYL 5KN5B 3AS0A 3ZKND 3BZFA 4A2MA 5FYLE 5I18L 1EHLH 3BIKB 2R0WL 1LP9A 1I7UB 1KNOB 1C8PA 1SY6H 5D4QA 5J3HC 1GIGH 4D0CA 4L4JA 4TNWK 1S5HA 2E7LE 1EEYA 4P3WA 1ZHKB 4KKLC 4MHHG 1YEDB 3BUYA 1GAFH 3EGSA 2HVKA 2N7AA 4PUBH 2AK1H 1Q9KA 3JUZA 4B50A 2AABH 2EO9A 3RWHA 2LE9A 2A9MH 2H3NB 3UJIL 4NQEB 4CADB 3JTTA 2BDNL 4PGEA 5I2IA 1IGMH 4KDTA 5BV7L 1HHGB 4G8GD 2E7CA 5D9SB 5EBGA 4HKZA 4JHAL 4G42B 4HKXB 1OP5H 1IQDB 3WNMA 4P2YA 3UPAA 3AM8C 4Y2DA 3PNWB 1UM4L 1W72A 4K7FA 5FXCH 1WISA 4MA1C 1NGPL 2JJSC 2BERA 3JTCA 4YFLF 4M3JA 1AGFB 3SOBH 4KWUA 3MUHL 1LEGA 4V3EB 4Z76A 4K9EH 2L7UA 2YWZA 4PJAE 2DMCA 5EUKB 4ELMF 4UILL 2ED8A 4MDJA 4XP5H 3VGAB 4GJTB 4LMQI 2CIIB 3UDWA 4HV8A 5FYLL 4MA7L 3JWOH 1GOFA 4AM0A 5D8JL 1I9IH 2ADJA 2EDNA 5KS9B 1NAKL 1F13A 3EUUA 1H5BC 3BH8A 3VWKC 4OF7A 4ZYKB 3D9AL 1T5WB 3UZEA 4Q9RL 1UXWA 2OXGA 1EZVX 2ITDA 4XXCA 2DM3A 4MD0B 1U8IA 3R1GL 4LCUB 5JXEC 5MEPA 1OQOA 6FABL 1UJTA 3KLHC 5E99H 2ICWA 4GRLB 3OJ2C 4P9MH 3ZO0A 1W8OA 3TBTB 4ZUVB 5BRZD 1E4KA 2CH8A 1IQWH 5E95B 1IC7H 4KV5F 4FTVD 1AO7A 5IVNA 3CU1A 1CBVH 4DGIL 1ZGLB 4WFED 5DS8B 2HAZA 5T1DL 4MDIB 1JRHI 1B4RA 3MRDB 1BAFH 1QP1A 3SDCC 5E6ID 2DTSA 3GI9H 5DUBB 2M26A 3SDYH 3DUUA 3PHSA 4F57H 4PP2B 4X9IA 1A1OB 2R1YB 4AL8H 3JZ7A 4N5ED 1NSNL 2FGWL 3PHOB 1IC1A 4F7MB 4LASH 4UT9H 4ELME 4PJGF 2J12B 4PP1C 4W81A 4L3EE 5C7XH 3VH8B 3ZL4H 4PB0H 5ESVA 3RGHA 2NNAA 3HB3D 1L6XA 2XG5A 4PJCB 4LLWA 7CGTA 1AXSA 5J56B 4FFYH 3GRWH 1OD9A 5D71L 1V5JA 2AI0L 4L29B 2OTWA 1JNLL 5DJ2A 4Z7UE 1YQVH 2AJYL 1GZQA 2IGFH 1DVFC 4MNQB 3X3GL 3I3DA 1FQ9C 4PJ5D 5GRVL 1GGIH 2AJZB 2BCKA 3B2VL 3NCBB 4PRPB 4KI5E 3RY6C 3GSQA