4D0BA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
276
structure length
276
Chain Sequence
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
molecule keywords MHC CLASS I ANTIGEN
molecule tags Immune system
source organism Gallus gallus
total genus 56
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d0bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4d0bA01
1FL5B 4R96A 4DZBB 3NABL 1TJIH 4GKSB 1CR9L 3S3PA 4P23D 1I3RB 3LEYH 4PJFB 5CFHA 1DBAL 4Y2DB 4FNLH 1UADC 3MV9E 4O2EB 1B4JL 2XWBB 3EYSH 5F7HA 2Z92A 4TVPD 5JMOC 2R0LL 4XVSH 4LGSB 4R96B 4L29B 3VFPB 3RIAF 2V5TA 4OM0H 2YD7A 4LNRA 3QDJD 1WZKA 2FB4H 2X7LA 2ZKHL 3LKSA 3MRCB 1IQWL 4J6RL 1X6NA 1YN6A 2E9BA 1IGIL 1EEZA 4HDIA 1CDJA 1Y6NR 1A7PH 2IMMA 1KGCD 4EI5C 1UACH 5KOMC 3MJ6A 1EMTH 4KKNA 4LHUG 4LNRB 5AAMA 4GW1A 2X7LB 3LKSB 1RZGA 3BE1H 4FXLA 1YNKL 1YN6B 3JBG7 3SDCA 4XC3L 4YC2C 5JA8B 4HDIB 5FCSH 1V3LA 1T89C 1M7DA 1NBYA 4U1IB 3OX8A 4OZHB 5CLTA 2YD6A 5HDBF 5D7JA 5A3ID 3K2UH 2EXYD 1OTSC 3NA4A 1CDIA 5E6ID 4GW1B 4DN3L 1RZGB 1KF9B 5ACZA 4U6HA 5HY9B 3SDCB 1TJGL 1J0YA 3ZMRA 5CEZL 5F7UA 1NBYB 8FABA 4X4ME 3OX8B 4OLEA 1NUDA 1AJ7L 1RVFH 4E41E 5ACZB 3U2SA 2ZOLA 3GKWL 4MNHA 2PR4H 1MVFA 2YPLE 4TOYH 4JY4A 1G7PA 1SYSA 1T2JA 4NRZA 3NH7L 5LGKA 3ZHKA 4NZRH 2XZCL 3RI5F 3MLXL 3RVWD 1CLYL 4PRDA 1FDLL 1KENL 2EYTA 2ED8A 3U2SB 3PE9A 3MLUH 2IH1A 2ZOLB 2DS4A 3VGEA 2BVUA 1JNHA 4JKWA 1F4WL 5DJXA 2NZ9D 3QYCA 4JY4B 4L5FH 1G7PB 1CWVA 4N5UA 4NRZB 3TJEH 2ZCLL 4DVBA 4IJ3B 2AJUH 2GJJA 1PZUB 5F21B 3O4LA 3MBEC 4PRDB 4ZAKD 3MUY1 1J87A 2EYTB 2BVQA 3MFFA 4AL8L 2IH1B 4M7ZC 1TETL 1JNHB 4LK4A 5DJXB 2IAMA 3BGMA 4G8IA 5DVMA 2VXUL 4JDVA 5JR1H 1U93A 4F9LC 4DVBB 2DQTH 5HXMA 1B2WH 3PGFH 3ZT6A 5GRUH 5HVHB 1N0XH 3O4LB 2BVQB 3S4SA 1F11A 3LH2H 3GSVB 4C56D 3HE7A 4DAGL 2BVOA 2IAMB 3BGMB 4G8IB 2ZCHH 4ELKA 4JDVB 4ODVL 1AO7D 3BO8A 4OCWH 1Z3GL 3QUZD 1M05A 3AAZA 3VJ6A 3S4SB 3B9VA 2VLKB 5JPMA 2FECL 3TVMD 3L3HA 3HE7B 2VIRA 4JLRA 4P59H 3C60C 4OV5A 4ELMA 5CZXD 3DPBA 2PYEA 5FKPB 4NQTA 1V3KA 3FAXA 2G60H 4TULH 4XP5H 2MQ3A 3S35X 2QADD 4HWEL 3BO8B 1WAAA 2FX9H 2EH8L 5IF0A 4AQOA 1M05B 3AAZB 3VJ6B 5LQBH 2AK4D 5KOVC 5JPMB 5L2KD 1UZ6E 2VIRB 4JLRB 4JQXA 4OV5B 4Q0XH 4ELMB 4U7MA 2PYEB 4UT6H 1RV6X 3B9KB 5IHUH 3V6FA 4LL9A 3M17A 1KJMA 1YYMH 3QIUD 3S36L 5IF0B 4LGRB 1OAYL 2Q87A 5T5FH 3SDXF 3UXFA 4YBQC 3N1PC 2D31A 1I9RH 5ADPH 5AYUL 3V6FB 5GRJL 2BRQA 2Q1EA 3M17B 1NMAH 1CFTA 1KJMB 4FZ8L 4NWTH 1X9QA 5E94A 1BJ1J 5C08D 2YUXA 1UCBL 5LWYL 1I1AD 3HZYA 1MEXL 2CKBA 4JO1H 2D31B 4S1SH 8CGTA 1A6TA 4P2RA 4XP4L 1QYGH 2HA1A 3FRUA 1CFTB 3ZYZA 3SGEI 4HCRL 5IQ9A 4IMKC 2ADFH 3IU4L 5E94B 2EDDA 5JW3L 1KULA 3HZYB 4HF5H 2H26A 3KLDA 4Y16A 2OTUA 2CKBB 3KAAA 2R0WH 2AK1L 2DQUL 1A6TB 3VXRD 5K33A 3BPOC 5L7XL 1KIQA 4MMXC 1MCQA 5IQ9B 2MPAH 1LO3L 5IBLC 2MKLC 2OP4H 3BIAX 1KB5A 1UVQB 4D9LH 2H26B 4Y16B 2OTUB 3EDJA 1Q94B 1IL1A 5FA3A 1IC4H 4KROC 2PYFA 1BQSA 4M1GL 2CUMA 5CZKA 1FVEA 3SY0A 4JKPH 4K7PL 4UOJA 2NNAA 1AGFA 4R26L 1CD1A 5FA3B 1IL1B 1E4JA 3O4OC 2PYFB 3AREA 5IGXH 1FVEB 3SY0B 2FGWH 3V6ZA 3FL7A 1QBML 2K9UA 2AABH 2NNAB 1VPOH 4RGMB 1JTOA 2DWEA 3EFDH 4JANB 4J23A 1KCVH 3S6CA 4FQJL 1FNAA 3KPTA 2GEEA 4ZD3L 3AREB 2GW5A 4NN7C 4Z7OF 1JVKA 1F45A 3V6ZB 4QRUA 1KCRL 3O81A 4M00A 4XPBH 2FLRT 2DWEB 5GS3A 3DUSA 4KY1L 5C1MB 3RX8A 2VRAA 1Z9OA 3MUHL 4KKBD 4U6YB 4QRUB 5FHBH 4NBYB 3SO3B 4WVRA 3IFLL 3ILPA 2J8UA 4Y88A 1A6VH 5K93A 2M26A 3DUSB 3IYLW 3M8OH 4JZJC 1YEJH 5F9OL 4ONOA 5HI5C 4HK0A 4L8SC 2WLYA 4AEHH 1JL8A 5GGQL 5D7SL 4TUKH 3ILPB 3NCJH 4XP9H 2J8UB 3LDBC 4AEFA 4J4PA 2AGJL 3CPLA 3QHTC 1RI8A 1F3DH 1DVFA 4PJFE 4Z7VF 4DW2H 3EIFA 1QEWA 4TTDD 2H6PB 3ALXA 3PWUA 5EZIH 2CRYA 3ZE0E 5AAWA 4M6MH 4O5LH 4D0CA 1ED3A 4LPCA 4WW2F 5EZOH 3CPLB 1R5VA 4BSJA 5IMMA 2HYMA 3PNWA 4MAYD 5HHOD 2Q8AL 1DVFB 1FO0H 5CZVH 1D5IH 1QEWB 4WTZG 4PLNC 3PWUB 4LEOA 3BKCL 2RCSL 2FL5A 4QRPA 4KVCL 2DMKA 4ENED 4BFEA 1GXEA 3S37L 3V0AC 1TNMA 1ED3B 2DYPA 3W39A 1II4E 3RUGA 3KPRA 1R5VB 1YDPA 5IMMB 3PNWB 2GK0B 3FFCD 1BBJB 1B88A 2DLEA 5FK9A 1EAJA 3V7AG 1AP2A 2BY2A 4OLVH 4K3DL 2UZIL 3TESA 1DQDL 2G5RA 3EFFA 2FL5B 4QRPB 3WFHA 3X3GH 4OZHE 1MCKA 2XNAA 2DYPB 3W39B 5D7IF 3KPRB 5J7CC 1YDPB 3F12A 4MD5A 3ZDYE 1MHPL 3MA9L 4MXQC 2NZIA 3HTLX 4XBGA 2Y1VA 1N3NA 2JCCF 1AP2B 3REWA 2VDMH 1TDQA 4M9PA 2HRLA 3EFFB 1GOFA 5FUCE 1B6DA 3KLSA 4HJGA 2DOCA 2XNAB 3F6IA 3P9MA 1IKFH 4YGAB 1E4WH 4GAJH 2VZ1A 3F12B 4HEME 4MD5B 3ARTA 3SDCC 1CDYA 1MY7A 1UYWL 3WS6A 5BO1H 3HUJE 4OIBA 4XBGB 1N3NB 5FUCC 3REWB 4UTAH 3GBMH 4HBCL 4PRIE 4HT1L 3U4AA 3RTQD 4KHXH 1OP9A 5TQ2H 4HJGB 4F3FA 3P9MB 1BFTA 4JPKL 4R2GB 1CD8A 2FRGP 1IGYA 2EO1A 2YKLL 4M7LL 1A6WH 4Z76A 5EIIA 4WGWB 3SDYH 1G7IA 1LEKA 1IC1A 5MEOA 1LWRA 1YQ2A 3MNVB 4N8VG 4M48H 1RURL 3RVTD 2Q7YA 4FQQA 3KS0J 5C9KA 4PRHA 5D4QA 2EIBA 4F3FB 2IH3A 3U46B 2ZG1A 4KJWD 2CMRL 2JELH 3JV0A 4Y4HC 1IGYB 4X9FA 4JPVH 1DBML 1LO4H 5EIIB 3T0VA 4UINL 5KTEL 1G7IB 1LEKB 4ODHL 5MEOB 4F7EB 4HCRA 4U7SA 1TVHA 4IRSB 1HILA 4IJ3C 4FQQB 5DRXA 4JG1H 3H7BA 2IH3B 3DURA 4Z7QE 3F7QA 1ZVYA 3L1OH 4PY7A 4JKLA 3O4LE 4LCCA 3G6JF 2OYPA 1INDH 3OXRA 1TVHB 1HILB 3R06A 1S7XA 3EDKA 4S1DC 5DRXB 4OZIB 5HVHC 1LE9A 4HGKC 4S1RH 5IFJB 2WAHA 3DURB 3WLWD 4PJXB 2NY0D 4FABL 3F62A 4PY7B 4M6OH 4LCCB 4EOWL 3EYUH 1AY1H 2IAMC 2VLKE 4NKOA 5LG1A 2B7DT 3OXRB 4HV8A 1KN2L 1CYGA 3R06B 1S7XB 1LE9B 4KUCD 2GUOA 5C0AE 5A40E 1YMMD 2CK2A 2HT3C 3QRGL 1IAOA 1MJ8L 4JM2F 1A8JH 4ZUSA 1S7WA 3HE7C 3BAEH 1IM3A 3K81A 3PHSA 3HS0A 2AXHA 4NKOB 5EN2A 5FA4A 1I3GH 4HV8B 4X7SL 3CXHK 5HYEA 2B4CH 4ELME 4Z7WF 2PYEE 2J88H 2DN7A 2QQKL 2V2XA 2YSSA 5F88A 1IAOB 4OCMC 4ZUSB 5GIRA 1FJ1A 1IM3B 3HS0B 4E5XA 2IBGA 4WUUA 1NMBL 5FA4B 3CNKA 3B9KC 5F7LB 1FN4B 4JG0L 3ULUF 4NFBA 5T1LD 3VWKA 2X6MA 3JWNC 4MWFA 2V2XB 2YSSB 5F88B 3X17A 1XIWD 1KIPA 3GMPA 3OB0K 3LHPH 4NGHH 1YC8A 3E6HA 5GIRB 1FJ1B 2D7PA 3F65A 4WUUB 4CMHC 4EIZC 2EEAA 2B39A 4JVUA 1N2RA 1W8NA 2CRMA 2DQGH 3WV0A 1VACA 3VWKB 2Y06H 4MWFB 3O3UN 2IG2L 5LGJA 1KIPB 2FECI 3GMPB 5B4MC 2P8PA 3E6HB 1U42A 3ZTNH 2CKBH 1A6UL 1N2RB 5I8KL 1EVTC 4D0DA 5HYJA 1VACB 3QCTH 4MA3A 2D7MA 1KOAA 3FMGH 5J89A 3O6KH 2P8LA 5LGJB 1AR1D 1P5VA 3PGCA 1I75A 1AFVH 2C4XA 2P8PB 5DO2D 4ONGL 5KANG 4UT7H 1MAKA 1FPTL 3AXLA 4QHMA 4GO6B 1OTTD 3I2CH 5H94A 3UCRA 3NFSL 1UM5L 1PGRB 4D0DB 3H42L 5HYJB 3NABH 1V3MA 3BPLB 4MA3B 4NRYA 1CR9H 1QSED 5MHSE 1NCUA 3PGCB 3DECA 1RK1A 1BD2A 1DBAH 4HUMB 4Y16C 2YN5A 4Z78A 3AM8A 4ZTPL 4QHMB 1B4JH 5H94B 3X14A 1YEFL 2R0LH 1CFBA 4PJ9C 4NRYB 3ARFA 4JR9L 2D9QB 3HRPA 4C59B 4FFYL 1ZEAL 4PD4K 4UTBL 2ZKHH 4OSUL 1RK1B 5F7WC 1IQWH 3ARWA 4J6RH 4Z78B 4GXUN 5C0FA 3UEZA 5JPNB 3AY4A 1IGIH 1KTKE 3X14B 5A2KH 1WCBA 5CINL 3ARFB 2YWYA 4QRTA 1NGQL 4DTGL 5DTFB 1ES0A 1AXSA 2IBZY 3WJJC 5T1KA 2VWEE 1K8IA 1YNKH 1A47A 3M07A 5E2JA 4XC3H 5HVGB 4UDTA 1BZQK 5EA0L 1FNLA 4OFYD 3AREC 2W1NA 4HEPG 1SM3L 5IB1B 5B39A 4NQDE 3MLYL 3MMEB 3VXUD 4PJEB 2AS5M 3Q5YA 2VWEC 3IDMB 4DN3H 1ES0B 1RHHA 1AXSB 1PW3A 1NQBA 4IRJC 5T1KB 1K8IB 4UBDD 4I0KA 5J6HB 1TJGH 4W4OC 3IJSA 3NCCB 5TDOA 1ZV5A 5CEZH 1INEL 2R4RL 2F74B 3B6SA 4I4WB 5CEZE 5F44A 3SO3C 5DF0A 1H3PL 1AJ7H 1RHHB 2YA2A 3KPOA 4KUZL 3GKWH 3SCMA 4MQXD 2G5BA 3IJSB 4P23C 1N6VA 1KJ2L 3B6SB 5I1DA 1S9KC 3LRHA 3NH7H 3SGKC 3QDJE 3ZTJH 3GK8L 2XZCH 1NGXA 4LKXA 1MCWW 3JSSA 4WNQA 3RX5A 3MLXH 4RBPK 1CLYH 4PFEA 1FDLH 1KENH 3KPOB 3SCMB 2GTZA 2I60L 1F4WH 1C12A 5I1DB 5DJDA 2ZCLH 1A4JA 4MXVE 4P9ML 1ZHLA 1NGXB 4LKXB 2ZG2A 1Y18B 1C5DA 4WNQB 1W0WA 2QL1A 4GBXC 2N1KA 5KJRL 4AL8H 4ZFGL 1X5FA 3S35L 3A6CL 4J4PC 1TETH 3N1GC 2GTZB 1EHLL 2J12B 3D1MC 3HNVL 3MXVL 1C12B 3BP4A 2VXUH 4X8XA 1DVFC 5DJDB 1P53A 4B7IA 5ESAA 1A4JB 1ZHLB 1U58A 1C5DB 3TBVB 4OZFA 1W0WB 5C09A 3H2WA 1NC4A 5CS7A 1QBLL 3EJZD 1M7XA 4O00A 3MRBA 4KGLA 2CRIA 3QEHB 4P4KD 4DAGH 4UV7L 3MRKA 3BP4B 1C7SA 3P73A 2NY3D 5GGSY 2UV3A 4LLAA 1U58B 4ODVH 5E9DB 3HZMA 4G7YL 1Z3GH 1KN4L 3S8WA 5CLWA 1NC4B 5CJXC 2XA3A 3MRBB 4PUBL 4X5XA 3GMMA 3RIAK 3MRKB 4P9HL 1QFOA 3KDMA 2P44B 4YBLB 1UM6L 4KMQA 4HWEH 3HZMB 1OAXL 2EH8H 4MSWA 5FM4A 3GUTA 5DC0A 5C6PB 1FZMB 2LABA 5J3HC 3FO2A 1BZ9B 4P48A 4X5XB 1FRGL 4HZLA 4JHWL 4KHTL 1JNNL 3KDMB 2XT1B 1T80A 3GSQB 5DURD 1F6FB 1I85A 2NZ9C 3S36H 4MSWB 1M1SA 3GUTB 4WWKD 3RWIB 4K3GA 1OAYH 3QWQB 4NT6B 4BZ2L 3UTOA 3V5KA 2IADA 4R2GC 5D6CA 4KJYA 4HZLB 3WS6C 5GS1A 4K07A 5T5NG 1T66C 4A2LA 3DRTA 5AYUH 3ESVF 1OL0A 5GRJH 2GSIA 4KH2A 4ETYA 5FUOL 1SY6A 4FZ8H 1T3FA 5F7DA 1BZ7A 5F8RC 3DMMD 3CFJA 5LWYH 1UCBH 3V5KB 2IADB 1MEXH 5D6CB 4PRNA 4KJYB 5FYJU 4OQTL 1MRDL 2X05A 2E9IA 4CMMB 5B3NA 5GS1B 2R1XA 3S96A 3VMOA 2VOTA 4X7EC 4XP4H 3NA9L 1AO7E 2GSIB 5FEBA 4IRSC 4K3HA 5JOPD 5BCAA 4HCRH 4BH7A 1T3FB 5F7DB 1BZ7B 4LHJB 3CFJB 3IU4H 3WO3B 4W6XB 3QO0A 5F6HJ 1RUKL 3FQXB 3OV6A 2VLLA 5JW3H 1SJHA 1ZSDA 4PRNB 3C8KA 4OZIE 3MC0A 3HG1D 2AK1H 2DQUH 5EBWA 2R1XB 3S96B 1IGML 1S78D 3D85D 4PJXE 5L7XH 1BGXL 3V4PL 4OV6F 1EFXD 3FB8B 5CZXC 4WEBL 2AK4E 5IEKB 4LLQA 1LO3H 3QO0B 2VLLB 1SJHB 3X11A 1BREA 1ZSDB 3C8KB 3VI4F 4H25A 3DJ9A 2F15A 4KDTC 1Y6KR 5EBWB 4QOKA 3KPQA 2DL9A 3X12A 1H3GA 4M1GH 2YHGA 4EBQL 5DLML 4ALAL 4K7PH 3WO4B 3MGTA 4LLQB 4MQ7B 3X11B 3WIHL 2NCMA 4G8GA 4R26H 3F8UB 4H25B 2BHUA 5HJ3A 4P2QA 3CFEA 3KPQB 4CNIA 2P1YA 4P46A 4F8QA 4PYGA 3MLVL 2FJGB 4KI5E 4RMTA 1A6ZA 3MGTB 1QBMH 5EUOA 3V8CA 4FQJH 4U1MA 5ENWA 5HJ3B 3OB0H 4KI5C 4P2QB 3CFEB 5D2LA 4ZD3H 3VGGA 4CNIB 3VCLB 4P46B 1C1EL 2NYYC 1NSNL 4MA1B 1A6ZB 4ZOBA 1YA5A 1KCRH 1EFQA 2LAGB 3GGWA 2ZUUA 5TPWL 3KXFA 3PGDA 2IBBA 2PO6D 1MCSA 4KY1H 4U1MB 4L4VD 3VXRE 2HH0L 1QFWL 1EHNA 5D2LB 4XVUD 2HN7A 4G6AD 1J11A 3X3FL 1SVZA 1GGBL 3GGWB 3IFLH 1YMHA 1BX2A 2XOTA 3OHXA 3KGRA 4EJ1C 3KXFB 3PGDB 1XF3A 4LPTA 5F9OH 1KJ2A 5IFAH 4HJ0C 3CU7A 5GGQH 1JGVL 4RNRA 2NMSA 4XHJC 4G6MH 5D7SH 5DT1L 1YMHB 1BX2B 4YPGA 2O5XL 3MYZA 3BQUA 5EO9A 4HUUB 1P6FA 4JQIL 2AGJH 1XF3B 5C6WH 1OTUC 1KJ2B 2Y6SD 1I9IL 3ZKXC 1ZLVK 1SYVA 4RFNB 4RNRB 3ZDXE 5EOTA 1Q9LB 2DLFL 1I3VA 2FIKA 3BPLC 3SDDB 2ICWJ 5HPMA 1EEYA 3BQUB 5EO9B 1KBGL 5E95B 4NNXA 1F8TL 3VGAB 3EDEA 2Q8AH 1SYVB 2X89D 3ILQD 3QQNA 3I84A 4MLSA 3BKCH 2HMID 3RL1A 3KHOA 4S10A 1EEYB 2RCSH 4LKCA 1KB9K 5HPMB 5ICYA 2NY4B 3U1SL 3S37H 2P49B 4NNXB 4B41A 3ARZA 1QTYT 5BZDA 2Z8VC 3LQMA 3R1GL 4U1GB 1DANT 1IRAY 1ZTXL 2ZG3A 1H3WM 2X2YA 1LGVA 1VENA 1BOGA 3ZYOA 1HWGB 4KK5D 3I6KA 3RNKA 3ARFC 3MNZA 2UZIH 4K3DH 1DQDH 1FV1B 3RL1B 5ICYB 4QHKJ 4LKCB 4NO5A 1WT5A 1JV5A 2AJVL 3DYOA 1K4DA 3CH8A 3L3KA 4PJEE 5SWSD 5BZDB 1T1WA 4EDWL 5JORB 1MHPH 3AY4C 3MA9H 2R23A 5F8QC 1BEYL 2NR6C 2G9HA 1BOGB 5F1IA 4GRLA 3RNKB 3MNZB 4MZ2A 4UAOB 2ADJA 4NCC2 2V5SA 4NO5B 3SN6N 1JV5B 1K4DB 3L3KB 4KJPC 2RAMA 1UA6L 5IB3B 1T1WB 2ILLA 2BNQA 1H8SA 2Z31A 4GQ9L 3G04A 1UYWH 2R23B 3ULUL 2G9HB 5F1IB 4HBCH 4GRLB 4HT1H 1ACZA 3WXVL 5TQ0L 2ADJB 3BD4A 4RBPH 4JPKH 3JV4B 2GSGA 2BNQB 3GM0A 2Z31B 2YKLH 3G04B 4M7LH 3ES6A 2EDKA 4PJDF 5HGGS 3TA3A 1RURH 3HC4L 4ODXB 3TNMA 1UQSA 3C5JB 2GJ6B 4OQTA 3RWHA 2CMRH 2GSGB 1N6UA 1LQVA 4WU5A 3SCMC 2APWA 1DBMH 1YEDA 4UINH 5KTEH 4ODHH 4BK5A 1R5WA 3M45A 2DBLL 3TA3B 4NUJA 4X5WA 1A7RL 1UQSB 3O6FA 4HUNB 2MNUA 4LCYA 3TH3T 3RWHB 3OWEA 1A0QL 1NANI 4WU5B 2ITDA 3BOVA 4NC2B 3QFJD 1MWAA 2DQHL 3GSUA 4TTGA 1LO5A 1T7WA 1MCWM 5E4EB 1R5WB 4I3SL 3NIFF 4XVTL 4X5WB 2P5WB 3F7PC 3QUXA 3O6FB 2BSTA 4OCLC 4LCYB 1LK2A 3LV3A 2ITDB 5E9DE 4EOWH 3UTSA 3HE6D 3GSUB 3RGHA 1LO5B 2P42B 3NZHL 3K46A 1A3LL 4LEXL 3MLZL 4TN9A 1KN2H 1LHZA 1DSFL 3VW3L 3BEWB 1LK2B 3QRGH 1MJ8H 3LV3B 4P99A 1IAKA 3UTSB 3GHBL 4X83A 3T0ED 1MCRA 4X7SH 4YBLC 1WZLA 2X1QA 1IAIL 5FYJD 2YRZA 3TZVD 3V0VA 4NM8L 4WJ5A 4OIAA 2QQKH 3RAJL 3U48A 5T1MB 5FECA 1IAKB 4FQXA 4JY6B 5DEZA 4J3XA 2YC1A 5ILTL 1NMBH 5HDBE 4JG0H 4HIEA 5DRWA 3V0VB 1IZJA 1IAMA 1OT1A 3QR2A 4TVSa 5JHDD 3E2HA 1EJOL 5FECB 2NX5E 1GGCL 2W0FB 1QPPA 4H0HB 4Q9CA 4FQXB 2YC1B 4JJHA 3CFDA 1FHGA 3U9UB 2C3HA 4HIEB 1S9YA 2CPCA 5DRWB 3L6FB 5IBUB 1NCWL 2EDOA 3D87B 4KRMB 3HPJA 3E2HB 1IGCL 2IG2H 5DMJB 4G59A 1OAQL 5GS1C 3CFDB 1A7BA 1KJ3L 1YPZF 5DJYA 1Z9MA 4RA3A 2VZSA 4OFDA 1J9CT 1A6UH 1J8HA 5CJQH 5I8KH 1ZS8A 1S9YB 3BH9A 3O2VL 4HG4K 1WFUA 2W91A 2A6JA 3HPJB 5C07D 2BVPA 2WUBL 5KSUA 4ONGH 4XBEL 1FPTH 5D9SA 5DJYB 5KZCD 2EIDA 1IZKA 2YMXL 3SGJC 1J8HB 3NFSH 1UM5H 1ZS8B 3H42H 3BH9B 5JIHA 1MY5A 1J88A 2A6JB 5D96B 1VKXA 2BVPB 4K3JL 5CBAA 5KSUB 5GGUA 4HK3J 4BUGA 5D9SB 4ZTPH 4ODUA 5IW6A 1HCFX 2BY3A 1K9TA 2Z8SA 4W70A 3VH8A 1YEFH 2FJHA 4QRRB 4JR9H 1LQSR 3G6JB 3WO4C 2FZ3A 2YD9A 1VKXB 4FFYH 1ZEAH 4UTBH 3ETBF 4OSUH 3MOAL 5GGUB 1LMKA 4M8VA 5F97E 4JFDB 2JJTC 5DVOA 4JFPA 5C0GA 4RA0C 4ODUB 5IW6B 1GVIA 3CSGA 5FYLD 1H9VA 3VH8B 2FJHB 4XPTL 4YXHL 4GJTB 5C0JB 5CINH 4JM2A 4P2QE 1RQ5A 3IAQA 4FFWC 1NGQH 1UXWA 2FZ3B 3U0PA 2EECA 4DTGH 4M1CD 1KFAL 2APBA 2UZYB 4JFPB 2KQNA 1T7XA 5C0GB 3D3VA 5EA0H 1JJUA 5D8JL 2W0KA 5GRYA 1JPSL 1C16A 1SM3H 1BIIB 4P46C 1GHFL 5HI3C 3MLYH 1LD9A 4JM2B 3MROA 2D4FA 3T0DA 4TUOA 3U0PB 2UZXB 1S3KL 4I9WD 1PG7X 3BZFA 1YEIL 3N85L 3D3VB 4LDOB 1NANH 3ZKND 4NKIL 3KXFE 5EBMA 2VDPL 5T3ZD 4HWUA 3V8OA 1C16B 4Y5XB 1J18A 3UROR 1INEH 2R4RH 3QEGL 5AD0B 1LD9B 3MV11 5DS8B 1BLNA 5D2NA 3EOTL 3O45B 4TUOB 3QXUA 4AH2B 4DKDC 1H3PH 5HGAA 1OTTC 4KK8D 3TN0D 4TSAL 3SDXE 5I8CB 4KUZH 1P9MA 4LHUA 2HJKA 1KXTB 4YHZH 1CVSC 4WU7A 5EBMB 5GSRA 4WWID 4MCZA 4P0DA 1KJ2H 3IVKA 1ZLVH 4NDMA 1BLNB 5D2NB 1XGPA 3GK8H 3G5XA 2B5IB 4XXDA 2QJDA 1TZIA 3QDGA 2HTLD 1KACB 2HJKB 4M7KL 2I60H 4LCWE 4ZS6C 5GSRB 1NFDA 4MCZB 3HI6L 3TBTA 4RFNC 1QR1A 3IVKB 2QHRL 3MGAA 4NNYA 1XGPB 5F3HB 5TDNB 2HFEA 3QHZL 4NIKB 4N5EC 3SDDC 4Y19A 3G5XB 3MACL 4IOSD 1U8LA 4XXDB 5E8PA 4M3KB 5T3XL 1TZIB 3QDGB 4EKXA 5KJRH 4ZFGH 4RQQA 1VGKA 3S35H 2OMBA 3HMXL 3A6CH 1QFWI 1EHLH 3HNVH 3MXVH 1NFDB 3VGAC 4HLZG 3N1FC 4LQ1A 3VXUE 4IS6A 3A67L 1RULL 4NNYB 1MSPA 1MLCA 3UC0L 2VSCA 2HFEB 1IGJB 4Y19B 1OSZA 1U8LB 2NY4C 4AIOA 5E8PB 1QBLH 4RQQB 1VGKB 3EYFA 1MI5A 3UAJC 1EV2E 2XRAL 4U1GC 3L3IA 4UV7H 1P84J 1E4XL 1AGBA 3LN9A 3CDFA 3IFOA 3WNOA 1MLCB 3MRNA 1RPQA 3ARBD 3OKLA 5EIQA 4G7YH 1OSZB 3TLRA 1KN4H 4M1DL 7FABL 5EORL 4WV1C 3EYFB 1MI5B 2EEDA 4PUBH 3L3IB 4P9HH 2Z93A 1JYNA 1AGBB 2H3NA 4XCYA 5L8LB 3MRFA 2X70A 3MJ9L 3ZYJA 3IFOB 1UM6H 1PEWA 3MRNB 4OCXL 4WHTA 5F1NA 1F4XL 4UAOC 4JFOB 3OKLB 1OAXH 3FOMB 3X13A 4NQUA 1A02N 5F96L 1HH9A 5JMRA 1IGFL 3WHE0 2OJZL 1ORQA 2IANA 1FRGH 2Z93B 4HWBA 4JHWH 4KHTH 3SE4C 4EZMA 1JNNH 2H3NB 1HQ4A 4XCYB 3MRFB 2WBJB 5EOCJ 2PKDA 2X70B 2HVJA 4GRLC 3I02A 1HOCB 3UBXG 2X42A 4XWOD 2FWOA 5F1NB 2J8HA 3DTXB 4LF3B 5D1ZC 5I1EL 1TTFA 4MJID 1HH9B 4ZNEE 5KS9F 1NEUA 4BZ2H 1ORQB 4UZGA 2IANB 3RVVD 4PY8I 2GYSA 2Z31C 1XGYL 2DICA 2GJ6E 1HQ4B 2EIEA 2HVJB 3I02B 2FWOB 4JQVA 5FUOH 4YO0A 5EB9A 5TJWK 1TVBB 5KVMC 3C6LC 1L6ZA 1NEZG 2X4RA 3EW3B 4I8DA 3BP7A 1EX0A 3FQRA 4OZGA 1J1OL 3ORJA 3HNTL 4OQTH 1MRDH 3B5TA 3W11C 3VXSA 3ZT5A 5FHAL 3HHRB 4JFEA 3NA9H 5DFWH 4XXCA 3BP7B 1RUKH 3FQRB 4JO4L 4OZGB 1W2KT 2P5WE 4G43A 3MQIA 3FQUA 3VXSB 2VDRL 2BCKA 1IGMH 4PP8C 4NWUL 4YDLB 4JFEB 5E4EC 1BGXH 3V4PH 1NUNB 4MNGE 1WWWX 4WEBH 4C56A 3O9WD 2DKSA 4F7PA 3C5SA 3O6FC 4DKFL 1YY9C 1HHGB 1T5WA 4G43B 5E24E 5E6ZA 4ZSOA 1LEIA 2BCKB 1T04A 5HDLA 4EBQH 5DLMH 3VFGL 1N64L 4ALAH 5EG6C 3UTSE 4WW2C 5HTSA 3T3PF 4JHAL 4ZUUA 1CGYA 2AJZA 4F7PB 3C5SB 3CAFA 3L95A 3QP3A 3WIHH 3ESUF 1T5WB 4XI5C 3P40A 4DEPB 2VZUA 1AD0A 4ZSOB 1LEIB 3BPCA 1T04B 2WM0A 3NCMA 1QZ1A 5DJ6A 2XPGA 1AGEA 2IFGA 3MLVH 3BD3A 1CXLA 4ZUUB 2AJZB 4XVJL 3L95B 1MVUB 4JKMA 3GSNL 3NACL 1F13A 5D7IE 4LLDA 2NY5L 4L4TA 2D03L 2Z35A 2QADB 3BPCB 3QIUA 5DJ6B 2AV7A 4DGVL 5BVJA 2XPGB 1C1EH 3DROA 1NSNH 2CH8A 5ISZD 2NY6D 4YIQA 2A0LC 5TPWH 1XGUA 1NDMA 3VG9C 1NGYA 4LLDB 1G7JA 2OCFD 4G6FB 5BV7C 1KPRA 4HS6A 4MS8A 4L4TB 3HRZA 4FQXC 2HH0H 2Z35B 1V8HA 1QFWH 1AHWA 3BX7C 3H0TA 2AV7B 2ARJA 4HULB 5BVJB 3DROB 2NY1B 4NCC1 1HK6A 2ZOKB 5FUZL 1I1AA 3X3FH 1CVRA 1ZA3A 4YIQB 1GGBH 3QWRA 1XGUB 1NDMB 3E2HC 4EN3C 1G7JB 2R2BA 4HMCA 4HS6B 3HRZB 1AHWB 3H0TB 2ARJB 2ICCA 2R15A 1JGVH 1FYTA 1IAII 4QRQA 1AQDA 4JE4B 5DT1H 1RK0A 1SBBA 4KRPC 2O5XH 1YNTB 4DFHA 2R2BB 3ZLQC 4PP2A 1IC5L 4JQIH 2EDFA 3WUZA 2E7LA 2OS7A 2YBRB 3MRPB 12E8L 1I9IH 4H1LA 4R8WH 4TNVK 2GFBA 2EDJA 4WI3A 1FYTB 1AQDB 4G6JL 2DLFH 1RK0B 4WFGD 5D96C 4LLYA 3HMXA 4QRRE 1KBGH 4PP2B 5JXAL 3G6JE 4LSVL 1S9VA 3F6LA 1F8TH 4H1LB 4KWUA 4YNYA 4PJ5D 5AZ2L 4JFDE 3HFML 4WO4B 3GMQA 3CFKA 1ROWA 2H41A 3J8F7 5BXFA 4Z7UA 3ARPA 4QO1A 4LLYB 3U1SH 4X98A 3GIVB 2OK0L 1T0NA 1S9VB 3R1GH 4AM0B 4YNYB 1ZTXH 3I50L 3GMQB 3UTQA 3CFKB 5C0EA 3V9FA 4GAYA 4QKXB 3LSOA 5KVDL 5BXFB 4Z7UB 1F4HA 2DQEL 3S5LG 4QXGL 5MENA 4RIRA 2AJVH 2XFXA 3C08L 1TXKA 3PQYA 1BEYH 3MJ9A 3FZUC 3UTQB 5LAXB 5C0EB 3VGFA 4JM2C 4GAYB 2PTTA 2ERJB 3LSOB 4N1EA 4UILL 4YHYB 4WTZA 4NHUA 5MENB 2XFXB 3TGXA 3PQYB 1UA6H 4YE4L 2FEDD 4GQ9H 5EBGA 3ULUH 1FVCA 5IT2L 5E8OA 4Y5XC 3ULUE 1H5BA 3TH4T 4HH8A 1XEDA 2PTTB 4GMSL 3AGVA 3WXVH 5TQ0H 2ESVA 3SE9L 4NHUB 5FKAA 4Y2OA 5BQ7A 5D2NE 1IM9D 1QSVA 1R3LA 4M5ZL 5EC1A 3ULUC 1EAPB 1FVCB 5J0BA 3NCBB 5E8OB 1D9KA 1H5BB 5FYKL 5D7KE 3PWVA 1HKLL 4WW1A 5HVFB 3SJVA 5D2NC 2ESVB 3HC4H 3G5YA 4H20L 4OLZL 3FN0L 5FKAB 5BS0A 1EO5A 2B5IC 1R3LB 2UYLA 4PP1C 2D0HA 3BVNA 5EC1B 1P9MC 4FQ2L 5ITFA 4KZEL 1QP1A 1D9KB 5EU6A 2OZ4L 3PWVB 4WW1B 2DBLH 3SJVB 4PRPB 3G5YB 4JFHE 1A7RH 4X6CA 3AC0A 5BS0B 5HHOA 3MSPA 2UYLB 1Q9KA 3BVNB 3MRDA 1A0QH 4DWHA 5ITFB 1AQKL 2DQHH 3U0WL 1J0ZA 3TO4A 5EU6B 4M6NL 3J7HA 2ED9A 4XT1C 4DJMA 1U8MA 4AIZA 4I3SH 1A6PA 4XVTH 4OGAD 3IDGA 3GMRA 4X6CB 3RVXD 1L0YA 4E0RA 3QIBD 2A77L 3TO4B 3NZHH 1A3LH 2Q86A 4LEXH 3MLZH 1EVUA 1U8MB 2F53D 4X9IA 5HYIA 5D1XA 4AIZB 1DSFH 3VW3H 3IDGB 3VXME 3GMRB 5E7BA 4OD2A 1AIFA 3VWJD 3DSFL 3ARXA 4L3ED 2VUOA 4E0RB 4WI7A 5TGBA 3GHBH 3CSBA 3EYOA 1JTPA 2XQYK 4H26A 4JFFD 5D1XB 3GJFA 2B8OT 4OD3L 1IAIH 3IF1A 1NLDL 2JJVA 3GSNA 4NM8H 4OD2B 2NPLX 3K0WA 3C5ZD 3RAJH 4HKBA 3TPUA 2PXYC 1AIFB 3K3QA 4IOFC 5EPMA 3UTTA 2KH2B 2EDWA 2RQ8A 3W0WD 5ILTH 4U6VL 5TGBB 2OMNA 3EYOB 1B4RA 1G0XA 2WBJC 2H2SD 2IANE 4H26B 5IEHB 3F58L 4D9QD 4LCUA 1TQCB 1FGVL 3GSNB 1KPVA 3B3IA 1MLBA 1HDMA 1N59A 4HKBB 5IQ7L 3TPUB 3C2SA 1RIVL 1EJOH 3QFJE 2AQ1A 5EPMB 3UTTB 1GGCH 5GGVL 5KSVB 5D5MF 1E4XI 2PETA 5ALCL 1U8HA 4LCUB 5I76A 3LS5L 1NCWH 2G2RA 1MLBB 1HDMB 1N59B 2GY7B 3QIWD 2CUHA 1IGCH 4F33B 1HSBA 1OPGL 1A22B 3SKMB 1OAQH 3RX7A 1KJ3H 1SMAA 2C3WA 5I76B 2YWZA 4QYOA 3O2VH 3TV3H 2GKIA 2G2RB 3VXSE 2C4FU 4JFEE 2GHWB 4CU8A 1WVZA 4F7MA 3MRLB 1HSBB 2VLJE 2WUBH 4XBEH 2C7UA 2B1HL 1T6WA 2IQ9L 4L9LB 1NAKL 3KYOA 4RDQF 2YMXH 5FYJE 4YDLC 5GS2D 4ZG1A 3OPZL 5B8CA 3RDTC 1FIGL 4QYOB 1CBVL 1NBQA 3BI9X 3S88L 3MV7B 1CQKA 4F7MB 3CLFL 4K3JH 2PUQT 1SBSL 3GBNL 4LRIA 3EOYG 2B1AL 2C7UB 2R1WA 4LLUA 3KYOB 4AG4L 2WUCL 1PG7L 1X5GA 2B0SL 3W9DA 5JDSA 5B8CB 1YMMA 4ZSOE 3V5HA 2VR9A 5D1QA 2W60A 3MOAH 2CDFA 1IILE 2GQHA 4WHCA 2J6EL 1BVKB 4DEPC 3HC3L 2R1WB 4LLUB 2NY2D 1QRND 1T5XA 5GISL 5JDSB 2YUZA 4XPTH 4YXHH 1YMMB 5TE6L 4WRLA 3V5HB 2VO5A 1AR2A 4NQVB 4XMPL 5D1QB 2W60B 3O2WH 2CDFB 1KFAH 3D2UA 4O9HL 1FAIH 5B3JE 1U8PB 2BP3A 3BDBA 2FX7L 5D8JH 2IPUK 1JPSH 1T5XB 1GHFH 1X5XA 4L4TE 3DO3A 2DAVA 1MJJA 1FC1A 1XIWA 3QG7L 1S3KH 3W81A 1H3VA 4OD1L 1YEIH 3N85H 3D2UB 4HPOL 1DLHA 1TMCA 3GMOA 4NKIH 2VDPH 3QEGH 2HLAA 2NY1C 3MV9D 5IKCA 3EOTH 1VFOA 4OLWL 2Q3AA 9CGTA 2C9AA 6CGTA 4MLIA 5I74C 4TSAH 1N8ZB 4EI5D 4MS8C 1DLHB 1TMCB 2ID5A 3GMOB 5GZOC 1AHWC 2D9CA 4LP4A 4S0SD 5I1JL 5IKCB 4RAUA 1E28A 2C1OA 4X7TA 3EDDA 1W0VA 5DD5L 1FYTE 4X6FA 5DGRA 3OAYK 4M7KH 1DZBA 2OZ4A 3HI6H 5I1AA 3N0PB 1OTSD 5FGCB 4ZMAT 4H1LH 2E7LE 2QHRH 4RAUB 1E28B 4FXKA 3MUZ1 2C1OB 4X7TB 43C9A 2E9WA 3QHZH 3MACH 4X6FB 1PZ5A 1KXVC 5T3XH 1F3DJ 1O7SA 3HMXH 4F2MA 2E7LC 5T3XE 5MERA 2R2CA 3TH2T 2MKWA 5I1AB 4Y7MA 3F7YA 3A67H 4V1DA 1RULH 4WO4C 5IWLA 4FXKB 43C9B 5I8OL 3UC0H 4D0BA 2X4SA 4PGBB 5AWNL 1PZ5B 4PDCE 3VI4E 5FIEA 1AD9B 3PL6A 4F2MB 1A7OL 2XRAH 4E41D 3D0VA 5J8OA 1G9ML 1E4XH 4L8CA 3VXOA 3F7YB 4V1DB 2X4SB 1OD7A 1OGAD 2QLVB 5INDA 4M1DH 7FABH 2QKIA 4OFYA 4PB9L 5EORH 3FT4A 3FB7A 3PL6B 2YXMA 4BJLA 5MENE 3D0VB 4L8CB 1DE4A 3O41A 2D7QA 5F7MC 3PQYE 2EYRA 3MBED 3MJ9H 1NC2D 1A1OA 5KBNC 4OCXH 2Y72A 3QXWA 1F4XH 4XMLL 5H2BA 5INDB 4YHYC 1WZ1H 1N5AA 5DJ8A 15C8L 5F96H 2QKIB 1IGFH 3FT4B 3FB7B 2OJZH 3BE1L 2MHAA 4AENA 4I2XA 4J1UB 1BQUA 1WAAF 4RMRA 3O41B 4FG6C 3VFNA 2BNRD 1A1OB 5E8NB 4XTRC 2ICEA 2ZJSL 5H2BB 5I1EH 2XZZA 1P7QA 1N5AB 2DLHA 3QDAA 1DUYA 1EERB 2EDYA 4TUJA 2ESVE 2MHAB 1ZHKA 3G9AB 3S98A 4WUKL 3TNNA 4AENB 3JTCA 1XGYH 4XGZA 4MJ4A 3K7UA 2DWDA 5KANI 3VFNB 5ICZB 2AJSL 2ICEB 4OLUL 4P2YA 4AMKL 1P7QB 3C60D 1DUYB 5JW4M 3SJVE 4YHPA 4TUJB 5SX4I 1J1OH 4PRPE 3GSRA 3HNTH 3VGBA 1HNGA 2VQTA 3KYNA 2EXWC 4D3CL 2DWDB 5FHAH 1Z0NA 2XN9A 1NDGA 3TT3L 1Q9WA 1I1FB 1CI5A 5EU6E 1P4IL 4KDWA 3GMNA 2D0FA 4YHPB 4JO4H 1WWCA 4HKXA 1F90L 4X6CE 3KYNB 4U1NA 2VDRH 1BAFL 2XN9B 1NDGB 4NWUH 2JTDA 1Q9WB 2AJYL 3SE3A 1MCJA 1S7UB 3GMNB 4YBQD 5DMGC 3VRIA 4DKFH 3EOAA 4HKXB 3MXWH 3NGBB 2AXJA 2R56L 4U1NB 1FIEA 1WFTA 1QFPA 4YPJA 3VFGH 4Q9RL 1N64H 2E7CA 1SEBA 5E4IA 1MH5B 4JHAH 4AJ0A 4MYWB 2J6EA 3VRIB 4S1QL 3EOAB 3HN3A 2FD6L 3P9LB 5GGTL 2Q6WA 1HCVA 4KJQC 2VJXA 1QR4A 5D1XC 5E1AB 2BHZA 1KNOA 4CRPA 2BMKA 4XVJH 1A2YA 3GSNH 3NACH 5CP7A 2NY5H 1XF4A 1NUFA 1FBIL 2D03H 4YEEA 1JWMA 1RD6A 4DGVH 4WWKA 3UTTE 5IBLD 2XZQL 2HJFA 2YUVA 1MFAL 5H37H 1KNOB 1XR9A 4H0GA 3PHOA 4HUWA 2BMKB 1TQCC 5CP3A 1A2YB 1DP0A 3FO9A 4UUJA 2NY5C 4URTB 4KROD 3VXTA 5BRZE 3CD4A 5CP7B 1N7ML 1AGCB 3V7MA 3SKOB 1XF4B 1MCLA 1JWMB 4E42A 2D7NA 4WWKB 1YEGL 5KS9A 2HJFB 1BPVA 3DMMA 2GJZA 4OLYL 1XR9B 5FUZH 4HUWB 4N8CL 4FP8L 3FO9B 1KG0A 1EO7A 3VXTB 1BF8A 4KTYA 3QUYA 3WD5L 5C0BD 4E42B 2CQVA 1F3JB 1IVLA 3OG6B 4PJDE 1JUFA 3JVGA 5KS9B 2J8UF 2GJZB 3U6RB 1ZVSA 3IDYB 4PBVC 1KG0B 4ZPVB 4NWTL 3O8XB 3ET9F 3HG1A 3H9ZA 4JRXB 2BNUB 3D85A 1IC5H 3QUYB 3MV7E 5SV4A 12E8H 4L9LC 5FOJA 5H35A 3L7FA 5HDOA 2CLZA 4G6JH 1ZVSB 4O58L 1FLTX 3B9AA 4LLMA 3SPVA 3WNNA 4XNZC 1QRKA 3D85B 3GI9L 1M71A 4RAHA 5JXAH 2BOCA 4LSVH 4Q6IC 4G9FA 4EUPG 2ADIA 3HAEA 5H35B 4X8JA 1BFSA 5AZ2H 3TJHA 3L7FB 3NIFE 3O0RL 1K2DA 3CU1A 5B8CC 1NCAL 3FONA 4LLMB 1F00I 3SPVB 2HKHL 5HI5D 3DWTA 3QDMB 1M71B 5IOPA 2OK0H 1TENA 2AXGB 4G9FB 4NHCL 2ADIB 3QZWG 3AVEA 4C58B 3HAEB 4X8JB 3I50H 3O3BA 5EU4A 4PRAA 3RUGF 5KVDH 1TLKA 2DQEH 2AEPL 4QXGH 4F8TA 2NXZB 1KCKA 2ZUWA 1JHLL 4Y1AA 5D1QC 5IOPB 1UWEL 3C08H 1VEMA 5AUMA 5FCUL 4NQCB 4PJCA 5F93C 3PDDA 1CICB 3O3BB 5EU4B 4M03A 5EH1A 5F9WB 4PRAB 1KTLA 3EYVA 5FDWB 4Y2DD 3IB4A 4UILH 3OKMA 2XV6B 2NW2A 2X4TA 4Y1AB 1MCOL 1UKSA 4GXVL 4YE4H 4NKDA 2AP2A 2DJ4A 4PJCB 5IT2H 3VXPA 3MO1A 5E2WL 2FYYB 2D3VA 4G8EA 1B3JA 2UWEA 4GMSH 1KTLB 3EYVB 4Q9QL 2H9GA 3QQ4A 3SE9H 2NW2B 4WHYH 5GRZA 3RQ3A 2X4TB 3STZA 4M5ZH 4WY7L 1FG2A 3OAYH 4NKDB 4K7PX 3VXPB 3MO1B 3ROLA 4APQA 5FYKH 4G8EB 4I3RL 1HKLH 4LVOB 2UWEB 4XX1E 2N7AA 5FYKE 5FO8A 3QQ4B 4FTVA 5K9OA 4H20H 4OLZH 2CDEA 3FN0H 5FGCE 4MXQD 2J2ZA 3GSOB 1FG2B 1YNLL 4FQ2H 4KZEH 3MOBL 2JIXA 4XZUA 3KJ4B 3ROLB 4KI1A 4APQB 2OZ4H 3KHQA 3IT8D 1DN2A 3WNPA 1QVOA 4NQEA 5DJZA 5FO8B 5K9OB 4FTVB 5IB5A 4ESKA 2CDEB 3SDCD 1JHKL 1YC7A 4UT9L 3ZKMC 5FF6A 2J1KA 3L5JA 2N7BA 3EGSA 4OJFL 1AQKH 2OR8A 3U0WH 2JIXB 5AEAA 4XZUB 4M6NH 3LB6C 3WKML 5IHZA 2OX5A 3WEXA 1FSKB 1PSKL 4NQEB 5DJZB 2Q7NA 1X5YA 5IB5B 3BZDA 2NTFA 4V1DE 3PABB 4P2OB 3EGSB 2X4NA 2A77H 1FZKA 1CG9A 5FV1L 3T1WA 5IHZB 2W07A 3OJVC 3WEXB 3ZDZF 2P48B 2Y9RT 3FO0L 5SWSA 4PJAA 3MRMA 4U4BA 4Y4HD 1ZGLA 2NTFB 5IB4B 4MHHI 3C8DA 3FFDA 4XPFL 3OJMB 1EHAA 3D39A 5GGTA 3DSFH 3PL6C 2X4NB 1V3JA 5JTWA 1FZKB 3S34L 1CG9B 4C83A 4GFTB 3EHBC 4HIHA 4X7DC 4CN4A 1R3JA 1YEHL 4NZDA 4OT1L 4I18B 3U30B 4HFWA 1XCTA 3IKCA 4OD3H 1ZGLB 1NLDH 2Q76A 2EDLA 3FFDB 3DGGA 3D39B 3CDYA 1RJLA 1BVLB 4PG2A 5F7KC 4U6VH 5J4MA 1CFSB 4C83B 2UUDK 4S1DD 1SEQL 1R3JB 4U1HA 3O4LD 1H8OA 3F58H 4LVEA 4HFWB 1XCTB 3IKCB 2I26N 1FGVH 2Q76B 3N50A 2VYRE 2XKUA 3DHJA 1GC1L 4HAFA 4D9RE 5IQ7H 2O93L 2OM5A 2IAMD 1RIVH 3DGGB 1OB1A 1Z2KA 1RJLB 5GGVH 5K9QG 2C4FT 3AS2A 5HHXL 4U1HB 1JFQL 3MJ8A 2R0KL 4RX4D 1T4KA 5ALCH 4EDXB 2HT3D 3LS5H 2MTPA 2VLKD 1JZ3A 3HE7D 3ZE2E 4U0QB 1OB1B 4IMLA 4HXBL 1DEEA 1NCNA 1OPGH 1OHQA 1WITA 3A0OA 1K3IA 4B0MM 1A6WL 4ZO6A 4PJHF 3MJ8B 1MCDA 4KKLC 1T4KB 2CIIB 1QPXA 3THML 4N0CA 4XP1L 1FYHB 1NMCB 2XN9E 3HZVA 4IMLB 2PYED 1DEEB 3K8KA 2LVCA 3RGVA 3B9KD 4YR6A 5GJTL 4CJ1A 4NBXB 2B1HH 2IQ9H 1LO4L 1NAKH 2UY7A 4A2MA 4PTTA 1P1ZA 3OPZH 1FIGH 1CBVH 3ZDXF 5IVXA 3S88H 3BRDA 3CLFH 3HZVB 2EKSA 3MCG1 5KAQG 1SBSH 5J11B 4UQ3A 3RGVB 3GBNH 3DETC 1KCUL 5E6YA 2B1AH 2QTEA 5DFVC 3C5ZC 5DJAB 1NAMA 4XBPA 3KS0H 4PTTB 4AG4H 2WUCH 1PG7H 1P1ZB 2B0SH 3UJTL 2D2OA 2D0GA 3SE3C 5B4MD 4ZFZA 5IVXB 1XZ0A 5FGRA 3FTGB 3QHFL 2VSDA 1I8LA 2EKSB 4Y0GA 1RZ8A 4UQ3B 2J6EH 5CBEA 3L3DA 5HGDB 3HC3H 4GUPA 1FORL 4BKLA 3TZVA 3BWAB 5GISH 2QQNL 2DF3A 5IM7A 5TE6H 4JGMA 4ZFZB 3W5NA 1ZT4B 1XZ0B 3IJYB 2HG5A 3HB3C 1TITA 1KCSL 4XMPH 4NYLA 1RZ8B 2DQDL 5IVZB 3VD3A 4Y4KA 5CBEB 4BSWA 3L3DB 4O9HH 1NUGA 4RMQA 2FX7H 4BKLB 3VDBA 2G75A 4BSVA 5ADOL 5IM7B 1NCCL 4H5SA 1R3KA 3QG7H 2FDBP 2VDOL 4Y16D 3CC5B 1FNEA 3IDXL 1E4KC 5CP3H 4LSQL 4O4YL 3OF6A 4CDHA 4K55A 1OAUL 4Y4KB 4OD1H 4HPOH 3SBWA 4BSWB 1NCBL 1FL3A 1V7ML 2I9TA 5MHSD 4JZNA 2YUWA 2G75B 4BSVB 5EU5A 1R3KB 3HC0A 1T6VN 4JHZA 2CO6B 4OLWH 5JOFA 1FNEB 5DR5L 5KS9E 1AE6L 1INQA 2Z4QA 3OMZA 2I9TB 1FL3B 4KPHL 3BEVA 1DR9A 1O7VA 1FVDA 4JZNB 4W68A 5K9KA 4JRXE 4ERSL 5EU5B 3HC0B 1IEAB 5I1JH 5C07A 4G80A 1I9JL 2NTSP 2GTWA 5JOFB 2WWMC 1INQB 2Z4QB 3O8XC 4HPYL 5DD5H 3ARED 1DBJL 4KC3B 3BEVB 1HQRA 4LDLB 1FVDB 5K9KB 2MCPL 2VXQL 3VD9A 2W65A 1GAFL 2YD5A 3QXTA 3U83A 3QEUA 4XNMA 3HZKA 4G80B 5F9JA 3QSKB 2Y5EA 2GTWB 2VKWA 4KQ4L 3KPSB 3PWPA 4NQDD 3WJLC 5KZCB 2X5PA 5FB8B 3CFIC 3R0NA 4DGIL 3GSWB 4K94L 4WCYL 4R4BA 1HQRB 2FNBA 1FFPA 2W65B 3QDME 2ICES 5SWZA 3QEUB 3HAEH 3HZKB 5F9JB 4MDJA 4PD4J 5I8OH 2YEZA 3PWPB 5E0QA 5AWNH 5CEZD 5J9PA 2BRRL 3STBA 3BW9B 3ZSTA 3UO1L 3RRQA 3RHWF 3MYJA 5MEQA 4R4BB 1A7OH 3ARYA 1MHEA 1FFPB 1KB5L 3OAZK 4KKAD 1CLZL 1G9MH 4WFHE 5SWZB 1X5IA 3T3PE 3VA2C 3T2QA 4MDJB 2YEZB 4NQCE 1UT9A 2VISA 2GCYA 5J9PB 2NXZC 1VCAA 5DMKA 4PB9H 4LSRL 3H9SA 3MYJB 2B20A 3R8BB 2Q20A 4MX7A 1MHEB 4NOFA 4PLKC 4Y1AE 2L7JA 3QUML 3BMWA 2Z92B 5CKAA 5TF0A 1K4CA 1CICC 1GRWA 3B2UC 4GBXD 5F9WC 4X6DA 1CTOA 2XTJE 3JTTA 4PJCE 2VISB 3LY6A 2GCYB 4J4PD 4XMLH 4I0PA 5DMKB 15C8H 1BQHG 4GSDL 3H9SB 1DVFD 4MX7B 1L0XA 2X1WL 3G6AA 5CEXA 2XTJC 3QT2A 3BGAA 1EEZB 1K4CB 3MR9A 1DN0A 4X6DB 3JTTB 4Y5VA 2IQAA 2ZJSH 3QPQC 4I0PB 5GGRY 4Q7DA 1WJ3A 2HT4C 3G6AB 4WUKH 1T1ZA 4M6AA 5CEXB 1R3IL 5EUKA 3OQ3B 5F6HI 1TCRA 1FNSL 2F8OA 3MR9B 2AJSH 2F54A 1M7DB 4QRPD 4LVOC 4JM4H 4Y5VB 4R0LA 4OLUH 1VEOA 2IQAB 5D7JB 2FHCA 3BN9C 4R97C 4AMKH 4DK6A 3VI3F 3LPGA 4ZUWA 1F58L 3QNZA 3B9DA 4U6HB 4FTVE 3R4DA 5GJSL 1T1ZB 3D69A 4D3CH 5EUKB 3IS1X 3KJ4C 1TCRB 4APQC 2F54B 2JK5A 5DVNA 3TT3H 1OGAE 8FABB 4R0LB 5J3HD 1HINL 1I7UA 4KU1A 1P4IH 3UBXA 2A2QT 4ZUWB 3QNZB 4OI9A 4NQEE 1F90H 3D69B 4Y4FA 4MNHB 2DB8A 1BAFH 5IR1A 2NLJA 1DDHA 2JK5B 3P11L 1SYSB 2CGRL 2AJYH 3QFDA 2UY6A 3EOBA 5JIIA 2WY3A 4L8BA 1CXHA 4R2GD 1T66D 3Q6GL 3LQZA 4P2OC 4UNTA 1QKZL 2IGFL 4Y4FB 3SQOL 4G3YL 2R56H 3I6LE 1D5ZA 2BNRE 5IR1B 2NLJB 1DDHB 5IJKC 4QGYA 3L3GA 2AQ3A 4Q9RH 3QFDB 3EOBB 4L8BB 3T2OA 4OFPA 1VHPA 4PJGA 1WTGT 5IVNA 2IPTL 4PJ8A 1AH1A 4AT6A 1UEMA 3LQZB 4S1QH 4LSSL 3MFFB 5I66A 2FD6H 1U41A 1YY8A 5HGHA 1UH2A 5GGTH 4IRSD 5HHMA 4HIIA 1D5ZB 1MF2L 1PX3A 4CVUA 3H6JA 1OAKL 1U95A 2UUDH 3L3GB 1U93B 2N56A 4I18C 3U30C 4DK3A 1QD0A 4OCNC 4PJGB 3GIZL 3V6OA 2E6QA 4WIQA 4PJ8B 4AT6B 3WXWL 1W72L 5BOZG 1F11B 5I66B 1YY8B 5HGHB 3RJQB 1FBIH 2CR6A 4LPWA 5HHMB 2BVOB 3TFKC 4ELKB 2FBOJ 1U95B 3R0MA 2XZQH 5EUOF 5B21A 4O2CA 1MFAH 5IROC 2DMBA 5FGSA 1QUNA 5D2LF 2EYSA 5C6TL 5ALBL 1D6VL 1N7MH 2C1PA 1J7VR 4L3CA 7CGTA 3WN5C 4PG2C 3L3HB 2OL3L 1OLZA 4A6YL 4DN4L 1U3JA 5GXBB 3SKJL 1Z9LA 2X4OA 1YEGH 4MQSB 4O2CB 4OLYH 4KTDL 3B8YA 4N8CH 1BBDL 4FP8H 2EYSB 4NBZB 1PBYA 3WL9A 3WFDL 2C1PB 4YJZL 4L3CB 1WF5A 2HFGH 3WD5H 4JDZA 4M4RA 3MV8A 4IHOA 2ICWI 5I8EA 2X4OB 3P4LA 3UTPE 4RFOL 4NO0A 2OTWA 5I71B 1NMCC 3U7WL 4U49A 4KI5D 1CGSL 1H8NA 3E3QE 2NYYD 4JDZB 2YPKA 3MV8B 5C0CA 1NKOA 4NO0B 3HA0A 5E08L 3BT2L 2OTWB 3CDCA 4N0CC 4O58H 1U8IA 1ODAA 3E3QC 4K8RL 3GI9H 2VN4A 3RGVC 1DFBL 4BH8A 2YPKB 4NJAL 5HYQA 1JTTA 1UJ3A 1ITBB 5C0CB 3WFEL 2QV2A 4P2RB 3O0RH 1DUZA 3FRUB 1NCAH 3HMWL 2YD8A 2HKHH 2VXSL 1OM3L 1H3XA 4HJ0D 1ZANL 4BH8B 1T83C 1J1PL 1ULVA 4NHCH 3U9PL 4XHJD 5HYQB 1UJ3B 2W9LA 1CGTA 3MODL 1LVEA 1KIQB 1DUZB 4BYHA 2AEPH 4RGNB 1OTUD 3P0GB 3UBXI 1JHLH 1SHMA 4OCRL 1GJIA 5KSBF 5C0BE 1VSCA 1UWEH 3L5WA 1KB5B 4MVBA 3IFNL 3QUMA 2F5BL 5HYJD 5FCUH 4J3WA 4AEIL 5BW7C 2X4UA 1A9BA 3L3JA 3BWUC 2JE8A 3QPXL 1AGFB 1MCOH 3L5WB 1WWAX 3L7EA 4GXVH 4Y4KC 1CD1B 3QUMB 4JJ5A 2YPVL 4BM7A 2LFGA 3Q6FA 5E2WH 5IVOA 2X4UB 4Q9QH 5D7LA 1ZGLP 4OI7A 1A9BB 4POZC 2XY2A 3CIQA 3F5WA 3L3JB 2RFXA 3L7EB 4WY7H 2H2PC 5D5ME 3SBWC 3F7VA 4JJ5B 2E3VA 3DLQR 3Q6FB 3PG2A 3ARFD 1FE8L 4UIMA 4I3RH 3P4NA 4Z95L 4HMDA 5D7LB 4OGXL 4XNYL 3CGTA 2MOVA 5JW4Q 5JW5A 3F5WB 4JPIA 1OP5K 5I75C 4LVHB 1WBZA 2RFXB 3LAFA 2NR6D 3I3EA 1NFIA 1YNLH 3KPSE 5LBSL 4D8PA 4UNUA 5FAAA 3FRPA 3MOBH 4JFXA 4I48A 5IFAL 4UIMB 2XTLA 1D6EA 1T2QL 2HTKC 3P4NB 4ACPA 1UM4L 5HPOA 4G6ML 4KJPD 1DCLA 4FFVC 4GG6F 5T1KD 3VFTA 1ND0A 5JW5B 3IGAA 1V05A 1WBZB 1JHKH 4UT9H 4PJ5A 1NFIB 4OJFH 1ZLWK 3PWPE 4D8PB 5F70A 4OB5L 2GITA 4JFXB 4BELD 2WIMA 3MUGA 4HK0B 4I48B 1D6EB 3OAZH 3WKMH 3NCEB 1HHIA 5CEYA 5CGMA 2M8XA 1KB9J 4PREA 4PBWD 1PSKH 3N9GL 3VFTB 2I27N 1ND0B 5E7FA 5SWZE 4LBEA 4CDGC 3LD8B 4Y2DC 2GITB 2EH7L 5C3TA 3BISA 1HHIB 5CEYB 4ETQA 2UVFA 4R7NA 3FO0H 4Z7NF 3SCMD 1JGLL 4LBEB 1MRFL 4XPFH 1F4YL 4MNQA 5ESVA 4D0CB 1NGZA 5JO5A 4KTEL 3S34H 1RZJL 3H9SE 3VMNA 1YEHH 4OT1H 2RBLA 4ETQB 4X6EA 1PFCA 4R7NB 5HI4C 1S5HA 4U1JA 3AROA 4LEOB 1W72A 4X4YA 1U91A 3CVHL 4MNQB 4HC1L 5ESVB 4F37K 2I5YL 1NGZB 5AYQA 3RUGB 1IQDA 1RY7B 1B9ZA 5KN5A 3K74B 2EDQA 1SMOA 2HKFL 2HRPL 4ZS7L 1SEQH 2WBWB 3KPLA 5FK9B 1ORSA 1NJ9A 1X7QA 4X6EB 1IM9A 4U1JB 4PB0L 3H3BC 4NUGH 3UX9B 1W72B 4I0PC 4X4YB 3SGEH 1GC1H 4U6XA 1U91B 3WFHB 2OL3A 4A6YA 4GT7A 1IQDB 1CXKA 1PD6A 1HYSC 4OUOA 4XAKE 1XGRA 5HHXH 1HZHL 3KPLB 1ORSB 1NJ9B 5E9DD 1JFQH 1X7QB 2R0KH 1NC4D 1ZMYA 1IM9B 4Y5VC 5D7JC 4U6XB 5JHLL 2OL3B 4HXBH 4A6YB 3BZEA 3DXAA 3SOBL 5J6GA 4P5MA 1XGRB 4GW4A 4M9OA 1TNNA 4D2NA 4S0UC 1GL4B 4YBHA 4J3TA 5EO0A 2CSPA 3THMH 5JIKA 4N68A 4R0LC 4QTIL 4XP1H 2V6HA 4P5TA 3BZEB 4DOHB 5GJTH 3DXAB 5J6GB 4P5MB 3ALWA 6FABL 4Z76B 3G5VA 1B90A 1MJ7L 4MB3A 3QBTB 4FXGA 2VERN 1FFNA 2VLME 2Q7YB 2P5EA 3OR6A 4PRHB 4P5TB 1Z9SA 2BC4A 2GT9A 3QNXA 4HMEA 1KCUH 2F53A 4OF8A 4Y4FC 2A9ML 1A3RL 2NX5D 3G5VB 3UPAA 1T0MA 3UJTH 5LCVL 1A21A 4WEUD 4FXGB 1ZT1A 1FFNB 5C7XL 2WSKA 4L3EA 2P5EB 3QHFH 3QQ9C 3H7BB 3RWEA 3I3BA 2KL6A 2BC4B 2GT9B 3BJ91 3QNXB 3WFZA 2DM3A 4AZ8A 2HT2C 5J57B 1FORH 1JFMA 5J12B 1T0MB 2F58L 2QQNH 4QNPF 4H88L 5HHME 4XPHL 2E6PA 3WUWG 1OCWL 3W0WA 1CGWA 1KCSH 4PJ8C 2DQDH 2VITA 1PAMA 4C57C 4OI8A 4P2CG 1DL7L 3WNLA 4OQ1A 4LP5A 2P46B 1Q72L 4PLOB 2CDGA 5ADOH 1NCCH 5MP6L 2VDOH 1JGUL 1U2HA 3QNYA 3IDXH 4YX2L 4LSQH 2GUOB 4O4YH 4GKOA 4PGCA 2VITB 1OAUH 5DK2A 5ICXA 1NCBH 1V7MH 1WAAE 1S7WB 5CILL 1GSMA 3MX0A 1QG3A 2CDGB 1WBXA 3QIWA 5EN2B 2B4CC 5DC9B 2JB5L 3QNYB 5DR5H 1AE6H 2QR0A 2NXYB 4PGCB 4UMGA 5DK2B 5ICXB 4KPHH 4NO3A 3CCHA 4AK1A 4JQXC 5J1SC 4FFWD 4E5XB 2IBZX 5JW4R 4ERSH 1RSFA 1WBXB 1FCGA 4RRPA 5EU7E 4HG4J 1FP5A 5DDHA 5A2FA 3MV8E 1ACYL 1I9JH 3NAAL 4LPYA 1EZVY 1A3QA 1KLFA 1ERNA 4HPYH 2QR0B 4P2QD 4ZPTA 1DJSA 1SY6L 1DBKL 4PJHA 1DBJH 3O3EA 3FT2A 4P46D 5HI3D 4LVNB 5EU7C 1FFRA 4NO3B 1KYOJ 3CCHB 5F89A 1HSAA 1NCTA 1WIUA 4KRNA 4CGTA 2MCPH 2VXQH 5DEGA 3SQBA 1GAFH 3KLAA 1FLRL 4JO2H 5DDHB 5CJQL 4XHQA 5C0NC 2A6KA 5C0CE 1N26A 4KQ4H 5SWQA 1A4KA 1NFDF 2FR4A 4ZPTB 4P2RE 2FO4A 1D3CA 4PJHB 2BJML 4DGIH 3HR6A 3T4YA 4K94H 4WCYH 5F89B 1HSAB 5DEGB 4WHDA 4JN1L 2R9HC 4MJ5A 3LKNA 4B50A 3KXFD 2A6KB 2CXGA 5ANMA 1A4KB 2FR4B 2BRRH 3UO1H 4B53A 4OBSA 2P8LB 3ISWA 3T4YB 3RKDC 4RGNE 4GLRI 1KB5H 3AXLB 1JBJA 1CLZH 3OAUL 4N9OB 5DJCA 3LKNB 4YDKL 3GO1L 4HBQA 4LAJH 5ANMB 4ZS6D 4RGNC 2VDQL 4LSRH 3K1KC 1BD2B 4YQXL 1G7QA 3DBXA 2AJXL 3QUMH 5DJCB 4N5ED 3LVEA 3SDDD 3NIGE 4LCWD 3BQUD 2ATPA 3MZGB 1VFAA 2A74A 4OGYL 1QLFA 3CVHA 4LLVA 4HC1A 2V5MA 4RMUA 4U0RB 4GSDH 2JLLA 4RGMC 4MVBC 1G7QB 2DJUA 3MV9A 1JN6A 3CX2A 3DBXB 3RZCA 5C0FB 1A7NL 4OCSL 4JHBA 2ATPB 2NY4D 2BSED 1VFAB 3HI1A 2VABA 1WCBB 1BFOA 1U8NA 1OWRM 4QRTB 1QLFB 3CVHB 3AS1A 3I75A 3UAJD 3ZKSD 4EI5A 3PWLA 4I77L 5IW1A 4GXUM 1OP5H 4I0CC 2H8PA 2GIYA 3BUYA 1JN6B 3RZCB 1LILA 5B38G 4UDTB 3IDNA 1R3IH 1JMXA 4TPRL 2O5ZL 1FNSH 3OKNA 5B39B 5ETUA 3HI1B 3KR3L 2VABB 3IRPX 1BFOB 1U8NB 1U3HA 4JRYA 4N0FA 4EI5B 3I75B 5KSAA 3GDBA 3PWLB 1G9EA 4K7FA 4LVHC 5IW1B 1F58H 4W4NA 3ULVL 3BUYB 5GJSH 4PJBA 1WBYA 5SX5K 2DMCA 1ZLWH 4YHZL 3IDNB 2J8UE 5TDOB 1REIA 4ZXBA 3OKNB 4YC2B 4PV9A 4JRYB 4OZGF 1U3HB 4N0FB 4U31A 1HINH 1WZMA 1D5XA 5KSAB 4KKAC 5JUEL 3MJGX 4K7FB 5HHQA 5GS0L 5HDQL 1IKNA 2FLBT 4PJBB 4GRLD 1WBYB 5DA4A 1U8JA 2G5BB 4ZXBB 4JGJA 5D1ZD 3P11H 4PV9B 4YLQT 2CGRH 4J7RA 1D5XB 4LARH 2A83A 3K4DA 2BNQD 2OLDA 4E41A 2Z31D 2WMPA 5HHQB 3AS0A 3Q6GH 3FKUS 3SE8L 1ZLUK 4OM1L 1QKZH 2YPLA 3LD8C 1U8JB 2IGFH 3SQOH 4G3YH 1I8IA 3C6LD 3I6GA 4PJIF 4QXTA 1WCQA 2GJ6D 2A83B 5DZNA 2WQRA 3BPNB 3W11D 2IPTH 4C4KO 4IOIA 3CDGA 4LSSH 3TIEA 2YPLB 1GGTA 3MBEA 4ZFOA 1CF8H 5C0RL 3O6ML 4QRPE 3TA3D 1MF2H 1NH6A 4M7JL 4MNQE 1OAKH 1HKFA 3I6GB 5IESL 3CMOL 3JV5A 3KPRE 4QXTB 3RHWK 3RUGE 2VC2L 5ESAB 3GRWL 3GIZH 3ROOA 1C5CL 4OZFB 5CSZA 4MGXA 4QWWC 5C09B 5IFHL 4IOIB 3WXWH 1W72H 3CDGB 3TIEB 5DMYA 1NGWA 1I1CA 3EYQD 4M7ZB 2P5WD 3ZYIA 5B3JF 3O6FD 1HXMA 3P73B 5CGYC 5LXGL 1YY9D 1A7QL 3ROOB 5CSZB 1JMZA 2HFFA 1YEEL 4OUUA 5C6TH 5ALBH 1G9NL 1D6VH 3T09A 4XMKL 3UZEA 3JXAA 1NGWB 2OL3H 3ZHDA 3VXQA 4A6YH 4DN4H 3GMMB 2EKJA 3SKJH 3GI8L 5DEFA 4QXUL 5DK0A 1HXMB 5AG8A 3RIFK 5J13B 1XAUA 4KTDH 1EDQA 4XI5D 5DUML 1BBDH 2J3SA 4YWGL 3V95A 2HFFB 4OUUB 3UTSD 1TCMA 3WFDH 2XXMB 2DQFA 3FO2B 2W9EL 2AAVA 4K7PY 3N1MC 3GKZA 3QEQA 5BVPL 4RFOH 5DK0B 2K3TA 4DOHE 4JAMA 3DXAE 3V5DA 3U7WH 4TNVF 1B0GA 1N6QL 1CGSH 1IGTA 1MFNA 4R4NC 2ZUTA 5EOCH 2DQFB 4HHAA 3P9WB 4PRHE 3PDOA 1UENA 3QEQB 5DQDL 2A0LD 2JJSA 3IXAA 4JAMB 3DRTB 3SDAA 5E08H 3BT2H 3V5DB 2W92A 4X0KA 4FQXD 1B0GB 4K2UL 4K8RH 4P5TC 3CZFA 4YFLI 4HHAB 1DFBH 3WE6A 1EEUA 2P5EE 4NJAH 3IKKA 1MNUL 3RWGA 5DD6A 1CD0A 3PDOB 1RJYA 4G6KH 4TNWK 1MWAL 3WFEH 4OCYL 3SDAB 3TIDA 4EN3D 3TYFA 1NBVL 4K8RC 4BH7B 3HMWH 5IK3A 5JXEA 3QULA 2VXSH 3CZFB 1OM3H 2E7MA 1ZANH 4PR5A 3WE6B 2V7NA 3BRFA 1JZ5A 1J1PH 2WANA 3RWGB 3U9PH 5DD6B 4LCCC 5HVWA 4G5ZL 4Z7UF 3MODH 1RJYB 1C5BL 1IAIM 1IEBA 4KRPD 3ZDZE 1TVDA 3TYFB 3PHQA 1RIUL 2DM7A 3BJLA 5IK3B 3QULB 1OWWA 4J8RA 5DVKA 4OCRH 4PR5B 1VA9A 1J8HD 3IFNH 2F5BH 1OSPL 4MJ2A 1HHHA 3Q1SL 4QOKB 1IT9L 3X12B 4EUPA 4AEIH 2IC2A 3JUYA 3BPOB 5DD3L 4R3SA 4J8RB 3CLEL 3QPXH 1MOEA 2DRUA 5E8EA 4G8GB 4XCFL 4QRRD 5JQ6L 2YPVH 1MCPL 1HHHB 1IC7L 2ZPKL 4EUPB 3E6FA 1DLFL 3B4NA 3QZWA 4KROB 4OF7A 4WUUE 4P57A 4JFDD 4W81A 5B22A 1G7HA 2NXYC 2CJUL 5EUOB 4HKZA 5ENWB 4UDUA 3KG5A 4DUXA 4KDVA 3V0WL 1FE8H 3E6FB 3QZWB 4OF3A 4Z95H 4OGXH 4XNYH 1KC5L 3VWKC 1G7HB 3B83A 2JKXA 4LVNC 3FZUD 5LBSH 4HKZB 3TCLA 4UDUB 4JM2D 4PJHE 2MWCA 1JGDA 2HN7B 1T2QH 4M62L 1UM4H 2UVEA 4NN7B 1PLGL 3QH3A 3WBDA 4NQSA 3DVGA 3OHXB 4NJ9L 4ZOCA 5FO7A 4KV5F 5HYJE 4HX1A 3ZHLA 3TCLB 4OB5H 4YHML 3KVQA 4X6CF 4FMFA 1NLBL 4R8WL 5BOPA 4QEGA 5E03A 5T1DL 3UP1A 3RWDA 3N9GH 4DGYL 1QHOA 3ULUD 4NQSB 2MCG1 32C2A 5FO7B 2BZDA 1WWBX 3K4AA 3B5HA 4YPGB 5DQ9A 5ANME 3S7GA 1AXIB 1KELL 2AQ2A 2EH7H 3G08A 4PGJA 4YHOL 4FOMA 1BD2E 2EE9A 2SEBA 5A43C 1C08A 2GY5A 5EOQL 4PP1D 5EOTB 1EPFA 5GZNC 2FIKB 2PCPA 3OR7A 3MRRA 5D7KD 5I1HL 32C2B 4EQ2A 1JGLH 5DQ9B 1MRFH 1F4YH 5TFSL 4Z5RA 1YZZA 1T22A 4KTEH 3AM8C 4PJFA 4LOUC 1RZJH 3G08B 2JF1A 2IALA 2SEBB 3GRWA 5KSBA 5MI0B 1OLLA 3QDGD 4ZFFA 3OR7B 3B2VL 3M1BA 4U0RC 4L29A 2LU3A 2P8MA 3CVHH 4NC1C 3VFPA 1EIBA 4HC1H 5ACLA 4JFHD 2I5YH 4Z5RB 4MCYA 3VMPA 1RZJC 2FH6A 1T22B 3MRCA 3DX8A 5C2BL 2HKFH 4ZS7H 2HRPH 3HCVA 2IALB 4Y19D 1FO0A 5KSBB 2O26U 1CDHA 4PB0H 3I6KB 2EEBA 4ZFFB 3M1BB 2RHEA 1RJZA 2P8MB 3LKPA 4MCYB 4YHNA 5C0DA 4JVWA 3DX8B 3RZCC 2WQ8A 1QSFA 3W82A 1RU9L 3HCVB 5DHVA 4NZUL 1FG9C 1HZHH 1MELA 5SX5H 3B5GA 2VH5L 5TH2A 1FO0B 5E5UB 4MXQA 2LE9A 4CN6A 1MI5D 4U1IA 1RJZB 4OZHA 4F80A 3EZ8A 5JHLH 4JRYE 3LKPB 3VXMD 1X3DA 4YHNB 5C0DB 1QSFB 4M02A 4RMSA 5E99L 3SOBH 5DHVB 5HY9A 2NQCA 1VFBA 4XB8A 1UKTA 5TH2B 3V6BR 4PJBE 4MB5A 2PXYD 1U3HC 5L8KB 4IOFD 4QTIH 5KSAC 2HVKA 1VFMA 4XCCL 3OJDA 2WBJD 3AMLA 1ZLUH 3HUJA 4LSPL 4GG6A 3WFCL 6FABH 1VFBB 3ES6B 4ZXBC 4PRIA 1MJ7H 3O3DA 3Q2CA 2HVKB 2IAND 3TNMB 4F57L 4GMTL 3OJDB 2E5EA 1IKNC 4TSCL 3HUJB 1JF5A 2A9MH 4GG6B 1A3RH 4TVPL 1JZ7A 4Y4HA 1CGXA 1YEDB 3N06B 3FOLA 4O02L 4PRIB 1JYXA 1OOAA 5LCVH 3O3DB 2Z8RA 1P4BL 5C7XH 4L9DA 4NUJB 3BPNC 5ABDE 4M93B 2GK2A 4KUCF 4OZFH 2EZ0C 1AGDA 2AEQL 5JZ7C 1MWAB 5C09E 4Y4HB 3FOLB 2F58H 2R2HA 1PEZA 4FA8A 1XF1A 3ARGA 1ZE3C 1KT2A 4H88H 4XPHH 4ZUTA 1TTUA 1JZ6A 4XAWL 1JNJA 1OCWH 3QUXB 1I1RA 2BSTB 2RJMA 5FV2A 3FT3A 3VXSD 1AGDB 5TE7L 1DL7H 4JFED 4V2BA 3RDTD 5I0DA 2VLJD 3ZE1F 1Q72H 2XXCB 3GSVA 2R2HB 5FXCH 2Y7QA 3MRIA 3WDIA 1E0OB 3ARGB 1KT2B 4LHQB 5DHYA 1CGUA 5MP6H 4ZUTB 1JGUH 3OBAA 3FHQA 1N0LA 2R69L 4YX2H 3FT3B 1AKJD 3QI9A 4QHNA 4RX4A 2FIRT 4N90E 5CILH 2VLKA 2Z9TA 5ESQA 1TTGA 2Y7QB 3MRIB 4HWBL 4LLWA 5J13C 5CJOL 5DHYB 4OBRA 5FKPA 3HR5A 2JB5H 4WJ5B 5C0AA 2E7HA 1YECL 4WFEE 1YEKL 1V5JA 3QI9B 2ORBL 4QHNB 1UC6A 2PTUA 3NOIA 3P3YA 4CVZA 5ESQB 5DJ0A 2E9JA 3BIBX 2DD8L 1JE6A 3C8HA 2VNCA 4LLWB 2DM2A 1PG7W 4ODBD 3VD7A 1ACYH 3HR5B 1JNLL 3C87A 1UB5A 3NAAH 3B9KA 3QEQE 3VI3E 4R4FL 2YD4A 1I85C 5C0AB 2EE6A 1SY6H 1DBKH 1CZ8L 2MQ0A 4KKCC 1UKQA 5HYSG 4CVZB 3IS0X 3B8SA 2FBJL 5DJ0B 1ETZA 4QF1A 1FLRH 3EDFA 5FM8A 1UB5B 4G6FD 2J5LB 3TV3L 3MFGB 4L4TD 4ODSL 2BJMH 2NY1D 5DFTA 2X1PA 4JN1H 1ETZB 2JJSC 4QF1B 5HSFA 2BDNL 3SDAC 4CMHB 1QOKA 4MS8D 3SO5A 4WGVB 1S5IL 5GZOD 2VLRA 1CFQA 4U3HA 3IRZA 3RVUC 4QHLA 4OFIA 5I1CL 3MRGA 3OAUH 3NFPA 3QWRD 4YDKH 3ARDA 2PW1A 3GO1H 4PV8A 3LMJL 2IPKA 4QOKE 5K59F 5JXEC 2VDQH 1CFQB 2VLRB 3DHMA 2QSQA 4XCEA 5CBAB 3T0XA 4YQXH 1WGOA 1FYTD 4QHLB 1SJVA 1UVQA 2AJXH 3MPCA 3MRGB 4CVXA 5KW9L 3NFPB 2ZCKL 5J06A 1MHHA 5K9QI 3ARDB 1Q94A 4G8GE 2PW1B 4PV8B 5EFIA 3UJJL 1JWSA 3NPSB 4EUPH 2IPKB 4OGYH 4PJ9A 2EC8A 2NY7L 5A1AA 3PJSA 4XCEB 1HNFA 4FN0A 3O2WL 4TRPL 2F5AL 2BY1A 2BVYA 2BXZA 4BQCA 2VZ3A 2APFA 4WO4D 1FAIL 2LTQB 4PLJC 4CVXB 1A7NH 4YK4B 4OCSH 5EUOE 1MHHB 2V2TA 5T3XD 2EDNA 5EFIB 1JWSB 4MA1C 3P30L 5D2LE 1UXWB 4PJ9B 4KK6C 1J5OL 3T1FA 4I77H 3PJSB 3KLHC 2DKMA 5EZLA 4FQ1L 3WIIL 1EA9C 3H8NA 2X9WA 4JANA 3RWFA 3WJJA 4TPRH 2V2TB 1PYWA 5FYKU 4LSUL 2DBJA 2O5ZH 1MCEA 4HGMA 4HUVA 3KR3H 4EXKA 3MROB 2MFNA 2AW2A 2FO1A 3T1FB 5FDYA 3MRQA 3ZE2F 3HKFA 5EZLB 3BZFB 3ULVH 4YDJA 4FQIL 1BQHA 1X4XA 3ULVE 2P45B 1MIML 1MFCL 3RWFB 4IRJA 2VMFA 1PYWB 4NQDA 4LNVA 4IIQA 4W4OA 3OJ2C 4HUVB 5MEND 3QA3A 2V5YA 3PQYD 5JUEH 1L7IL 2VN7A 4U6YA 5HGAB 1MCBA 3ULVC 3MRQB 5HDQH 5GS0H 2BVEA 1Q0YL 4P3DA 4FG6D 4YDJB 4M61A 4LHUB 1BQHB 1H3UA 2CIKA 3OGCA 4XTRD 3KWWA 4IRJB 3EAKA 4H1LG 4WU7B 1BJ8A 3T4AA 3BYYA 4NQDB 4IIQB 5ID0A 4P23A 2VZOA 3QA3B 4NDMB 5E00A 4DQOL 5GS0C 3SGKA 4NKMA 2Z8WC 3BQUC 3SE8H 4BFBD 5IUSA 4P3DB 4OM1H 4M61B 5T5NF 3U7YL 1MQ8A 2CIKB 3OGCB 3UYRL 3KWWB 4M5YL 3T4AB 2ESVD 5ID0B 3TBTB 1QR1B 4P23B 3QDJA 2CD0A 4I13B 4RMVA 5E00B 2GI7A 4QCIA 2EXWD 1W0YT 2H6PA 4NKMB 1D9KD 1P6AB 2DI8A 2ZNXA 4GBXA 5C0RH 3O6MH 3SJVD 1JZ2A 1A64A 4M7JH 2H32A 4PRPD 1RUPL 5BS0D 3VFSA 3CMOH 3QDJB 5IESH 4IS6B 2VC2H 5MI0C 3OG4B 3TEUA 3GRWH 1ZA6A 4QCIB 1C5CH 5F9DC 5KSBE 1J05A 3NMEA 5IFHH 1HH6A 5EU6D 1P2CA 4JGUA 4F7TA 5JIPA 4GBXB 3FN3A 2H32B 5CJ8A 4BUHA 3VFSB 2GK0A 2JJUA 1BBJA 5DMGD 5E6IA 5LXGH 1A7QH 5IBTL 1LO2L 5TF1L 5AZEL 1ZA6B 5DUPL 3CH1A 4U7KA 2XIDA 1J05B 1WZ1L 1YEEH 2EDRA 1WT5C 1G9NH 1CTNA 1HH6B 4WFFE 4XMKH 1P2CB 3TO4D 4F7TB 4P9HC 1RUAL 5CJXA 3GI8H 4QXUH 5KVEL 5DHVH 3P0VL 5E6IB 2BNQE 4TSBL 1QSFE 2Y4SA 3GHEL 4OF5A 5DUMH 5ELIA 4WHTB 3CH1B 4YWGH 1G9NC 3WKNA 4YDVA 3X13B 3PXHA 4KJQD 3U0TA 5D1XD 2W9EH 4KK9C 3UYOD 4NFDA 5BVPH 2H45A 1LP9F 1VERA 5IHBA 3P4MA 3INUL 3CX5J 4YH6A 4YDVB 5CUSL 2P43B 4PTUA 1N6QH 1YN7A 2Y25A 3U0TB 4XNUL 1QBBA 4UIKL 1DANU 1EGJL 4XWGL 1AC0A 3TBWA 5DQDH 3GSXA 3T3MF 1E6OL 2OTPA 3NVQA 1XMWA 3O2DL 4ZAKA 4I5BA 3P4MB 4GRWB 4GG6E 3BIKA 5GPRA 3TA3C 4YO0B 3UTTD 4XB7A 3MNVA 3F7RA 3LOWA 4K2UH 2X4RB 4PTUB 1YN7B 2WP3O 3U46A 1MNUH 3T0BA 2V2WA 5BRZD 3TBWB 3GSXB 4JPWL 1MWAH 4OCYH 4ZAKB 3RPIA 1JPST 4I5BB 3BIKB 1NBVH 2Z0BA 2ZUXA 3EYQC 4F7EA 4IRSA 2DQCL 4M93C 4K9EL 4PJIA 4YDIL 5GGSA 2V2WB 3MXWL 1FFQA 3FQUB 4G5ZH 2XQYG 1C5BH 1AO7A 4FQHA 2HLFC 4FQPA 3RPIB 3QUZA 1WFNA 1RIUH 4Z7NE 4LQFL 4GKNA 3TVMA 1EBAA 4C56B 1MFBL 5E8DL 3QUXC 1UH4A 1MCNA 3TWCL 4PJIB 4OZIA 1X4YA 5GGSB 5IFJA 1OSPH 1EJ6A 1A1NA 1KTRL 2MQCA 1MJUL 2XI9A 4PJXA 3TM6A 1AO7B 3Q1SH 5E56A 3MV7D 1A1MA 1IT9H 4FQHB 4KDTA 4XNQA 3ARGC 3QUZB 4CU6A 2EC9U 4GKNB 2AK4A 3U36A 5DD3H 5L2KA 3TVMB 1CFVL 5DD1L 4PJCF 2O5YL 1KIUA 3CLEH 5JDJA 2YOCA 3PP4L 3AFLA 2E6JA 4XCFH 3JWOL