4D0CA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
276
structure length
276
Chain Sequence
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
molecule keywords MHC CLASS I ALPHA CHAIN 2
molecule tags Immune system
source organism Gallus gallus
total genus 62
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d0cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4d0cA01
3LV3B 1P53A 3G6DH 4MD0B 3MRFB 4OCWH 5D7IE 1SJEB 1FIGL 4X5XB 4NM4L 2BNQD 4H1LB 2OI9B 2J6EA 4BH8A 2QKIA 3AY4C 4LHUD 1LQVA 3HE7A 3P9LA 1OD7A 1MUJB 6FABL 1KEGL 3UTQB 1I3GH 2AAVA 2F8VA 2DS4A 5IWLC 3FB7B 4KMLB 5GHWH 3MUY1 3R4DA 1UH2A 2E27L 4EN3D 3TBSA 1P4LB 1FZKB 3O2WH 3EZ8A 3DI2B 4PJ9B 5CEXB 3A6OA 4A6YH 5F7FA 3ABZA 4O4YH 1OAZH 5ACLA 4Z5RA 1CDCA 4PJBE 3ARYA 5ESAA 2ICWJ 4NKOB 4NJAL 3TBTA 4TNVK 5I1DB 5GSVB 3BE1L 3VXMB 5T5NF 4OCNC 5INCB 4KROB 4FQ2L 2DQCL 4JG1H 5EC1A 2HA1A 3LHPH 4QRUB 4LCCC 2G5BA 2YUWA 4WTZG 3GEWB 3JTTB 5CGMA 4PJ7A 1UJ3A 4M5ZH 4E41D 2R4SL 1NBZB 2VAJA 1NSNH 3QFJD 3D3VD 1H3VA 4D9LL 2BCKA 1X5XA 4JN1L 3VGHA 1YEFL 4MJ6A 4QXUL 4U1GC 4OBRA 1CIDA 3LD8C 4QYOB 4JN2B 1FL5B 1YEIL 3LDBB 3TH4T 4HQQL 1A7PL 3BPOB 1KCSL 3PWPE 4QCIA 2PYEE 1FIGH 1ZT7A 4NM4H 1CS6A 1O5DT 3VJ6B 1KELL 2X1PA 3TIEA 4PJFA 4WWKD 4NQUA 1F00I 4LDEB 3U4BL 4HEPG 4Z7QE 2YPLE 4NFDA 1R3JB 6FABH 1KEGH 3IDMA 2F15A 2Y7QA 4U05A 4R97B 1JUFA 5D2NB 4KJYA 2E27H 1YN7B 3L9RA 1CVRA 4Z95L 2GTWB 1B2WL 3FOMA 4OZFG 5JHDE 1JV5B 4S1DD 1J0JA 1QHOA 3O6FB 1C1EL 2OQJA 2AQ3A 3PDOA 2MHAA 4MLSA 1EA9C 5FB8B 1T4KB 3MJ7B 4F33A 1KJ3L 1U3HA 4X6FB 2HJFB 4LLYB 4NJAH 4K9EL 5J11C 3VXTB 4UIKL 4BQ6A 2G75B 5CGTA 1C5DB 2ICEA 1R0AL 5CKGA 1BIIB 3MV7E 3BE1H 1FNLA 2GK0B 2I25N 3NOIA 4Y19D 5EUOF 3HE7D 5CUSL 4FQ2H 2DQCH 1UZ8A 4OZIA 3PQYE 1JNHA 4UU9B 1RQ5A 1MCRA 2R0LL 3QT2A 4EKXA 1U93B 4MDJA 4L9LA 2R4SH 4IRSA 2ZUXA 3CC5A 3GBNL 3NABL 4QHMB 2HT4D 5JLZB 4BQBA 1H8OA 3FAWA 4D9LH 1KUMA 4JN1H 4AH2B 4CGTA 5HI4D 3DETD 1YEFH 1S5HA 1WWAX 4LIQE 1WK0A 4QXUH 4EN3C 1IT9H 2JJUA 5CJQL 5IBLD 1YEIH 5I74B 5EOTA 5IJKA 2XN9E 1HXYB 1A7PH 4HQQH 1KCSH 4OM0L 5KSUA 2P5WA 5HHMA 1A3RL 1KELH 4NSKB 1TZGL 1F02I 2P46B 3U4BH 3VRLF 2NYYD 3GMOA 3QJFA 3VXNA 3WXVL 4AG4L 1A4KA 4M1GL 3CNKA 5CEYA 4JDVA 2VAAA 4OZGF 4XXCA 3U0PB 2EDXA 3F7YB 3U9PL 3Q3GA 3MNVA 3MRQA 4Z95H 4FTVA 1B2WH 1G6RA 1GZPA 2ED7A 3MGTB 4PGDA 1BFSA 4JZOB 4PJAB 1IEAB 1C1EH 1F90L 3MLTA 3ZT5A 2F53D 3KLAB 3SE4A 4L8CB 3EDDA 4POYA 1KJ3H 4GO6B 1FVDB 1PX3A 5L2JB 4ZG1A 2BNUB 4K9EH 3C6LB 4PJEF 2LAGB 3QDMB 4UIKH 1S9YA 3X3GL 5EU6A 1R0AH 3HA0A 3V6FB 4FABH 3V52L 1B4JL 1JRHL 4OLZL 5CUSH 3NCYS 5CJOL 4ZODA 2FR4A 4X6DA 1M7DB 3S4SG 5EO0A 3WKNA 2UVEA 2EO1A 5D1XB 1QVOA 3C8HA 3QEQA 2R0LH 1IAOB 4WWKC 3QUZA 3GBNH 3NABH 3P3YA 2VLJB 2NY0D 3L3OB 4HHAA 1EFQA 1N2RB 1BD2B 1VB9A 3AVEA 3T3PF 4CVZA 1QFUL 4N5EA 4YGVB 1KN2L 5CJQH 5I1CL 1KXQE 4S1DC 3NFSL 4FS0A 2UWEE 4KKBD 3VD9A 2BY1A 4OM0H 4HIJA 1T0MA 1A3RH 1YY9C 1TZGH 2DLGA 2IPTH 2WP3O 4OD1L 1IILE 5GXBB 3L3JB 2Z92B 3MRBA 5ANMA 1FNEB 4EIZC 4JVWA 3DX8B 3U46B 2YPKA 3WXVH 2XWBB 2WQ8A 4M1GH 3D69B 1FYHB 1S9XB 4U1MA 1FNAA 3E2HC 5HHPA 1ZGLA 3U9PH 4MQXD 2GT9B 2V2TB 1HCFX 2FGWL 4RRPA 5D6DA 2O5XL 1KIRA 4M4PA 4G6AC 1G6RL 3NIFF 2FHBA 4PJDB 1IQWL 4ZUWB 4MNQD 4ONHB 5GS2D 2O26U 3MGOA 1F90H 1FFNA 1FL3A 2HT4C 2VWEC 4I0PA 4NQEA 5IROA 4GKSB 5IFJB 4GW1B 3DETC 4P57A 1T2JA 1RJYB 4P2OA 1A6TA 1I1RA 3NTCL 4TULL 3X3GH 3KPLB 1A14H 3LRHA 3V52H 1B4JH 3K4ZA 5E2WL 1JRHH 1K4DA 3HNTL 4OLUH 5FUCE 1AC6A 1XH3A 2VERN 4QT5B 4K7FB 2B0SL 4PGBB 5CMAB 1VCAA 2E9WA 1EFXB 1MCLA 2GJ6E 2IANB 3RTQA 1BLNB 3CD4A 1TVBA 2BNQB 1GGUA 4APQB 1Q0YL 4R6UA 4X0KA 4CN6A 1IM9D 5HGGS 5BOZG 5MHSE 5C09D 2NYYC 4NKDB 1AO7E 3T0EA 1YPZA 4XX1E 1G7QB 5F8QC 2OJZL 5K9QI 1QFUH 1PY9A 4KKCD 4L8BB 1KN2H 4JE4B 2FSEB 5I1CH 1YEHL 1FLTX 5F8RC 2CO6B 2GITA 3NFSH 5GS2H 5DDHB 2IF7A 1U8PA 5D7IA 4J2XA 1KCRL 2EYRA 5HHOD 2VUYA 4OD1H 3NZHL 4XH2A 5DMIL 3ULVL 2BSRA 2Y9RT 1G7LB 1I9EA 1X4ZA 3EYVA 5JDJA 3QEQD 3H3BC 5DYOB 4OSUL 4H26B 3QISA 1GYAA 2ITDB 4F9LA 4HKXA 4MWFB 3T0DA 1H3TA 4NPYA 4MA1C 3V8OA 4WI2A 4ELMB 1WLHA 5C3LD 1HHIB 2FGWH 2O5XH 3W9EA 1K6QL 4YZFF 1G6RH 1IQWH 3LN9A 3MGAA 4OUUB 4GQ9L 3N85L 3KS0H 4LKCA 2AABL 4PP2A 3NFPB 1S9VA 4PJBA 7FABL 3ULVD 3NTCH 4TULH 4HT1L 4OZ4B 3T09A 1IGYB 4L5FL 1DQDL 5E2WH 3HNTH 3G5XB 3HNVH 1L7TL 1P2CA 5GS1B 5JXEA 2JJVA 2B0SH 3VXQA 4QGYA 2AGJL 5MP6L 4NO0B 1I8IB 3HZYB 4LRNL 4O02L 1Q0YH 4QY8A 4RZCB 1OW0C 3QZWA 1CFTB 1NCDL 2NXYD 4N5UA 3JV6A 2VR4A 4L3EA 3JVGA 1SMOA 5F96L 2OJZH 1AKJA 4QF1B 4I0PD 5CP3A 3S88L 3MROA 2ED8A 1U6AL 3GMLA 1YEHH 3RNQB 5MERA 1NFDB 1UA6L 4PLJC 3ARBA 1PYWB 2W65B 1FE8L 3CFBB 3PWPA 1KCRH 2PYEA 1Z5LB 2AJ3A 5JNYA 3L3KA 1UKQA 1C12A 3NZHH 3ZSSA 3ULVH 3QUXD 5F71A 1HYRC 1QRKA 1V8HA 1FCCA 2BX5A 3LN5A 4L3CA 4PUBL 1S9KC 4OSUH 3V7AE 5DURB 1WZLA 5A2LH 3TYFA 1J11A 4GAJL 5D7LD 4BH8B 2QKIB 2CH8A 3V2AR 3HE7B 3P9LB 3T0ED 3U79A 3P4MA 5C0ND 5EO9A 2EEBA 3HI6L 1K6QH 3V4VL 5JHDA 5MI0C 2WBKA 4K3HA 4JFZL 4GQ9H 3N85H 4U1LA 3FFCE 1NUNB 3TBSB 1OGAA 1ZLVH 2HKHL 2DYPA 2AABH 1M05A 4Y5VA 2FB4L 3K80A 7FABH 3HB3D 3L5WA 4HT1H 4L5FH 4RGMC 1BP3B 5IHLB 1DQDH 1UQSA 3MV7A 4Z5RB 2YD8A 1OTUD 5ESAB 1BQLL 2AK4D 2Q76B 1FZMA 3TBTB 2H2SC 3PQYA 1T1ZA 3K7UA 2AGJH 2X5PA 3WN5C 5MP6H 2YN5A 4LRNH 2HFTA 3VXRD 5HSFA 3H9ZA 4O02H 4J3VA 3WHE0 2AQ1A 5EC1B 4PPTA 2A1WL 1NCDH 2G5BB 2Z91A 3ULUF 1YECH 5KVFL 3ARVA 4MXWL 5F96H 4P9ML 4PJ7B 1CWVA 1UJ3B 5FCSH 4JHWL 3P4NA 3S88H 4XVUD 2IQ9L 1JRHI 2DQIL 2YD4A 4YDIH 1KB5A 1U6AH 2BCKB 4LPWA 1UA6H 3W0WE 3WLWD 4R8WL 4Z7NE 4MJ6B 3LSOB 3V0WL 1FV1A 5FYLL 1UWGL 3MBEA 4U6YA 5T1MA 1MCEA 5GS0C 4U0RC 1Z0NA 4QCIB 1ZT7B 4P3CH 4QRPE 4PUBH 3TNNA 4GAJH 3TIEB 4PJFB 4O9HL 1H5BC 4J12A 4NCC1 4NQCA 4OCSL 1QG3A 1MH5A 3IDMB 5JXAL 1ZVHA 4LF3A 2Y7QB 3HAEA 3HI6H 2KPNA 4WHDA 1JUFB 3V4VH 4XBPA 3WHE1 4KJYB 4JFZH 3L9RB 2HKHH 5CILL 2ZG3A 1BVKA 3BYTA 3MV9E 4G6JL 3FOMB 5FYLD 5B8CA 3FFDA 2FB4H 5BZDA 5IV2A 4D0BA 3S37L 1KTDA 2OQJB 3PDOB 2MHAB 2VLRE 1XAUA 3VFRA 4OF8A 3Q48A 43CAA 4F33B 4JANA 1U3HB 1BQLH 3TN0C 4HK3N 1C16A 2ICEB 3QQ4A 5E94A 2I9TA 5HVGB 3R0MA 1YYML 4AM0A 1ERNA 2W91A 5IMLA 1UZ8B 4OZIB 5C0FA 2NMSA 2A1WH 3O4OB 1JNHB 3SBWA 2XTLA 4QTIL 4LHJB 5DK0A 5KVFH 5HTSA 4MXWH 4WDIA 3V9FA 4P9MH 4JPKL 4G8IA 4JGUA 1WZMA 4L9LB 1OGAD 4MDJB 3AREC 2DYPD 2IBGA 4IRSB 4U1JA 3CC5B 4JHWH 5DUBA 5FYKE 1UM6L 3WL9A 2IQ9H 2DQIH 5C0NC 5CP3H 4X9BA 5HYFA 5GGSA 4R8WH 1KB5L 2C9AA 1S5HB 3TEUA 3IDGA 2UWEA 5GZOD 1T7XA 1ES0A 1KPUA 3V0WH 3WDHA 5FYLH 1UWGH 4KK6D 2JJTC 1ZANL 5FDYA 4HUXA 3FHAA 3HB3C 3MRRA 3WUZA 5KSUB 2P5WB 3IRZA 3RIAK 1O7VA 5HHMB 3IT8D 5LWYL 4O9HH 3QAZC 3OJVC 1RHHA 4OCSH 3GMOB 3QJFB 4JZJA 4OFYD 5AAMA 3CVIL 3VXNB 5JXAH 1A4KB 3VDAA 5CEYB 4JDVB 4TVPL 1KBGL 5D2LE 2VAAB 5SWQA 1DLHA 4LPCA 1NAMA 3MNVB 3MRQB 3Q3GB 5CILH 4LSSL 4LLVA 4FTVB 4G6JH 4OD2A 1G6RB 1GZPB 2A6IA 4PGDB 3R8QA 4X98A 3S37H 4MGXA 3MBED 2BFVL 4M93C 5E70A 3OSKA 3MLTB 4KI5F 3O45A 4WUKL 2VITA 5ADPL 2BOCA 5DGRA 3LAFA 1S9YB 4QRRE 5EU6B 1BVLA 3ERYA 4BFGA 3QH3A 3ZYZA 2WV3A 4UT6L 4NQCD 4TVPD 2FR4B 4X6DB 5A2IH 5EO0B 4QTIH 3WDIA 2DIJA 3GRWA 4AJ0A 1AO7A 1QVOB 1KACB 3QEQB 4JPKH 1OSZA 3QUZB 4EI5D 1X5FA 3DTXA 2IAMD 1UM6H 3WS6A 4HHAB 4ZAKD 2D3VA 3BZFA 4LMQE 4K7PY 3BOVA 4LK4A 1KB5H 4CVZB 5F7UA 4F57L 2D0HA 2BRQA 1V7NL 3CUPA 3QFJE 2UZYB 1ZANH 3W5NA 3QIBA 4M3KB 3OG4B 4XMKL 4TNWF 2VXQL 4XNXL 1EK3A 4HIJB 2IFFL 1T0MB 5CS7A 1TDQA 5LWYH 4FQLH 1EUUA 3MRBB 5ANMB 2NPLX 1J9CT 5CBAA 2YPKB 1R6VA 5DMYA 4NC0B 4TVPH 3FAXA 1KBGH 1F3DJ 2NY2C 4M6ML 4U1MB 4G8EA 3HAEH 5HHPB 4P2QE 1ZGLB 4K94L 5M95B 1G1CA 4LSSH 4XPBL 3TESA 3DVIA 1T5WA 4LPUA 1KIRB 1KIUA 2JELL 3RA7L 1A21A 2BFVH 4NP4L 1C5BL 1QTYT 3MGOB 1FL3B 1FFNB 2HTLD 5IVXF 3PP3K 1T83C 4I0PB 4NQEB 4WUKH 5ADPH 4P57B 1FP5A 4P2OB 5GZOC 1A6TB 2PW1A 4KK6C 3FQTA 3QHTC 4UBDD 1K4DB 3MRGA 4UT6H 1XH3B 2QHLA 1TCMA 3IKKA 5F7EL 2AJVL 2AP2A 2EKSA 3VD4A 1ZK9A 3RTQB 1TVBB 1K8IA 4X0KB 4WW2F 4EJ1C 3ME0A 5SWZD 3MRCA 4BFIA 1DQLL 3PHQA 3T0EB 1T7YA 4JKKA 1YPZB 2WBJA 4I9WD 4XB7A 3P4OA 4F57H 2YMXL 1V7NH 4KJPD 1ODAA 1MFEL 1MHEA 4KKLD 4YR6A 2VWEE 2YUXA 3D85A 3CFIC 4XMKH 5KBNC 4XNXH 2GITB 2VXQH 3PIQA 3AB0C 3ARFC 4XPGL 2ZWLT 1U8PB 2IFFH 2C3VA 1TIUA 3EFFA 5D7IB 1RAMA 4I5BA 1MQ8A 2EYRB 4XH2B 4ZMAT 2BSRB 3P0YL 5D71L 3EYVB 1RZ7L 1CGUA 2DBLL 5BOPA 5JOPD 1D6EA 1Q9OA 1HH6A 4M6MH 4HKXB 2V9TA 4K94H 4NPYB 3UTSA 3MLXL 4XPBH 3BD3A 3C5ZC 3VWJA 3W9EB 2JELH 3RA7H 4PJCA 4M5YL 1QUNA 4NP4H 4EI5C 3PV6A 5CBEA 5CJXA 4LKCB 5T1KA 4PP2B 4ZAKC 4F9PC 1VFMA 5TGBA 1W0VA 3PP4L 4PJBB 5IJVA 1R5IA 5C0DA 5AYUL 4DK3A 2FEDD 2BVYA 1L0YA 1G0XA 1FAKT 1P2CB 3ZLQC 1OOAA 4MCZA 3VXQB 1NEUA 2AJVH 5F7EH 3DHMA 4IMLA 3KPOA 3EIFA 1P4BL 1VFAA 4TUJA 4QY8B 5EA0L 1AGFA 3QZWB 2GHWB 1DQLH 3X11A 1PZUB 2VSCA 3JV6B 4L3EB 3S7GA 1T21A 5J9PA 1AKJB 1DUZA 2YMXH 2W0PA 3UBXG 5JW4M 2VL4A 4HULB 1MFEH 2XICA 1F3RB 3MROB 3GMLB 5MERB 2BVUA 3ARBB 3O0RH 4XPGH 2HFFA 4XHJC 4AK1A 2HTLC 3PWPB 2PYEB 5JNYB 2AJ3B 3L3KB 4QRPA 2JF1A 1C12B 2R0ZL 3V6BR 5E56A 1TTUA 1E4KA 3P0YH 5D71H 1RZ7H 4JQIL 3LN5B 5DD5L 1WZ1L 2DMCA 1EDQA 4MB5A 3TYFB 1A4JA 3BKML 3DBXA 1DE4A 1IKNC 4QO1A 3HMWL 3P4MB 5EO9B 3TA3A 1IAII 3MV9A 2BHYA 5JHDB 4M5YH 3RVVC 5HYSA 4U1LB 1M6OA 1OGAB 3D85D 5DEGA 2BZDA 1AXIB 2DYPB 1SVZA 2VLRA 1EHNA 1T89A 2RGSA 3CXDL 5JPMA 1M05B 2PO6A 4Y5VB 3PP4H 2G5RA 5DJXA 1BEYL 3L5WB 5IW6A 5AYUH 2X9WA 1UQSB 3MV7B 3SDAC 3D48R 1C5CL 1FZMB 3RKDD 3KPQA 1T1ZB 4NYLA 2E5EA 1S5IL 4HIEA 5I8EA 4I13B 1DN0A 1P4BH 3P30L 3QWRA 2PTTA 3K2MC 5EA0H 1XGPA 2Y07L 2Z91B 4YC2B 1A1MA 2VDNL 2FD6L 2QL1A 4YIQA 2BNRE 3TV3L 2NY4D 1N5AA 4NC2B 5T1KD 1X5ZA 2FBJL 1LP9F 1A9BA 1FQ9C 5DJ2A 1DBJL 1KB5B 2WP3T 5JIIA 5KSVA 5DO2D 3HNSL 1FV1B 1RIUL 2LV4A 3MBEB 4KJQD 5CJ8A 2XXMB 4U6YB 1IGML 2R0ZH 2XWTA 5T1MB 4OFPA 2IGFL 4GBXC 3FTGA 3IDXL 4HIIA 4JQIH 5B3JE 5DD5H 1WZ1H 3TNNB 4RIRA 4M7LL 3STZA 3BKMH 5D2LA 4NQCB 1MH5B 1X5YA 1VKXA 3SKUD 3HMWH 4L8DA 4LF3B 5SWSE 3HAEB 3B6SA 4XBPB 5C0BE 4Y4FA 1UH3A 2J8UE 2ZUQB 5HGHA 1BVKB 3PF2A 4I3RH 3CXDH 2ZOLA 5B8CB 1SJXA 1S7TA 3FFDB 5BZDB 1EEYA 5HYEA 5IV2B 4D0BB 2N4IA 1BEYH 1NPUA 3BQUC 1KTDB 4WHYH 3MV01 3T2QA 3VFRB 5DJDA 3QG6A 43CAB 4OFVA 4JANB 3EYSL 1C5CH 1IC7L 1C16B 1S5IH 4PJHF 3QQ4B 5E94B 2I9TB 3P30H 4FFEX 2JB6A 4AM0B 3FB5A 2ZCLL 5IMLB 4ZXBA 1MCWW 5C0FB 3EO1A 4FZEL 5IW1A 3TA3D 1JN6A 4Y5YA 2VDNH 2FD6H 5DK0B 1IM3A 1ZLWK 4WDIB 5F88A 3TV3H 4J3TA 4G8IB 4F7TA 5HYIA 4G8FA 4U1JB 2FBJH 4KK9D 5D7JD 5DUBB 3GI8L 3WL9B 1DBJH 5D5ME 4PRHD 3P73A 2NXZD 2D7TL 1HZHL 4YBHA 3N1GC 5GGSB 2MNUA 4BFEA 4DKEL 3IDGB 2UWEB 4KVNL 1ES0B 1KPUB 1DQTA 3HNSH 1RIUH 1RVFL 1IGMH 4HUXB 1J8HD 2DI9A 3MRRB 4JQVA 2IGFH 3IDXH 4A2LA 1PKQE 4KY1L 3RJQB 1TTGA 2QLVB 4M7LH 4MA8L 1HINL 3S3PA 3FJTA 1FYTA 3U30B 4RA3A 2R8SL 3RKDC 5F21B 1ZWIA 1RHHB 3QPQC 4JZJB 4P2QA 2ARJA 4N1EA 4EVNA 3TCXA 3MZGB 2D9QB 5T3XE 1SM3L 5D7LE 2JB5L 1BAFL 2EDLA 3GDBA 3UMTA 5SWQB 1DLHB 1AY1L 2IG2H 2XG5A 4G9DA 1NAMB 3PWNA 3I6LD 4LLVB 2VL5A 2Q7NA 4OD2B 1WC7A 2A6IB 4RDQF 3ILPA 2NY4C 1TPXB 5EU5A 2JIXA 4X98B 2DB8A 1NMCB 2YKLL 5B39A 5KVEL 4EQ2A 4NUGL 3O45B 4GRLA 3KXFE 4XHQA 3EYSH 1JYWA 2VITB 3VW3L 2BOCB 4YPJA 1IC7H 5DHYA 1BVLB 1D9KD 4UV7L 43C9B 3QH3B 3IFLL 4YEFA 2ZCLH 1QO3A 2AK4E 4FZEH 3TFKC 2NY6B 3E2HA 4JGMA 4J4PA 3L3GA 3H9SE 1AO7B 2QADC 4Z7OE 1IMHC 5FYKH 3RQ3A 1A6WL 1OSZB 1F6LL 4YFLI 3JUYA 3DTXB 2DM3A 3GI8H 3IFNL 5BRZE 2D7TH 1HZHH 2FO4A 3BZFB 4DKEH 5E2JA 4KVNH 3CUPB 1CDUA 1H3PH 3C08L 1YNTA 1G7HA 1RVFH 2XXCB 3QIBB 4A2MA 4LP4A 4H88L 3ZKMD 2WLZA 2P43B 2VSDA 4KY1H 2P24A 1MREL 4M6AA 1WZKA 4MA8H 4ZXBD 3SJVD 1HINH 2R8SH 4Y16D 5CBAB 5J6HA 4Q9RL 4DN3L 5KSAC 1CICA 1SM3H 2JB5H 1BAFH 4G8EB 3F6IA 1N0XL 1AY1H 1FFPA 1F3JA 1YQ2A 1R3HA 3I9GL 4DUWA 2CK0L 1DBKL 3IS0X 5E0QA 5C0AD 1T5WB 2JKXA 4PP1D 1HN1A 1LDSA 1ZEAL 5KW9L 1N0LA 5D7JC 4KK9C 2HLFC 3UPRA 4YK4B 5KVEH 4GKZA 2X1XR 4MXVE 4NUGH 4X5WA 1S7QA 4OFIA 3VW3H 3QIWC 4WI8A 3VFUA 1WWCA 2ZUSA 3TGXA 1KXTB 2PW1B 5D4QA 1JWMA 1TNMA 1FYTD 3FQTB 4JFEE 2I07A 4UV7H 4X4ME 2NQCA 3MRGB 3IFLH 3MFGB 2K1MA 1LK2A 1WEJL 2K7PA 3OKLA 3OKKA 3GM8A 2EKSB 3PXJA 5J1TC 3QWOA 5C6PB 2CD0A 1K8IB 1A6WH 2R2EA 5I6XC 3MRCB 4BFIB 1UKTA 1ZHLA 3KAAA 3SQBA 3PHQB 3IFNH 3VG9C 2JIXD 2WBJB 3IETA 3FKUS 3WUWG 3P4OB 2FH8A 3WD5L 1RJLA 3PGFL 3C08H 1MHEB 4GRLD 4N0CA 4YR6B 4KDTC 3LMJL 1Y0LA 4Z9KB 3D85B 3MA7A 4H88H 3J8F7 3PIQB 3IDYB 2AXGA 5FGRA 2C3VB 3EFFB 4RQQA 4I5BB 4YO0A 4D0CA 3CSBA 4C58B 2NNAA 2GEEA 2P49B 2XZAL 1MJJA 4Q9RH 1OW0A 2QBWA 4MVBC 4DN3H 1D6EB 4AIXA 1Q9OB 3BUTA 2YR3A 3CH1A 4YFDB 3GBLA 4ZTPL 1NEZG 1HH6B 1N0XH 1SHMA 3HZVA 3UTSB 4JM2A 3M45A 2CK0H 1DBKH 2DLTA 3VWJB 3RY6C 4R4FL 4WFED 2FX7L 4DKAA 5KANG 1LO4L 1ZEAH 5KW9H 4PJCB 2ZSWA 4Y8DC 1DCLA 3PV6B 5CBEB 3TZVA 5T1KB 2PYFA 2FX8L 4J23A 5TGBB 3SO3C 1W0VB 5J57B 1RZKL 5IJVB 1R5IB 5C0DB 4BZ2L 4JFXA 1A6VL 5KAQF 3KPRE 1WEJH 5AG9A 1MI5E 2JCCF 2VB5A 3MRIA 4MCZB 3CLFL 4IMLB 3KPOB 1VFAB 1ZTXL 4TUJB 1I85A 3ZKSD 2XWJA 1AGFB 3X11B 4GSDL 1AH1A 1LQSR 4YDLB 3ZDYE 4UTAL 1T21B 5J9PB 4JO4L 4PRDA 1DUZB 4JKLA 3PGFH 4IJ3B 4NOBA 4HH9A 1BJMA 4RMWA 2HFFB 4QRPB 3G6JA 3ULSA 2XZAH 4JZNA 1BBJA 4QXTA 3DSFL 3VXPA 2CO7B 3ZKND 4ORGA 1ED3A 3B43A 3IFOA 3RY5A 4ZTPH 1K4CA 1A4JB 4V1DD 4KUCD 5C0BA 3DBXB 1JZ6A 2LU7A 1DE4B 4JPVL 4XVSL 3BN3B 4R4FH 2D7QA 2FX7H 3TA3B 2NX5E 3MV9B 4JKWA 1BFOA 1LO4H 3RP1A 4U1HA 2H26A 4N0CD 1B88A 5HYSB 1M6OB 2AI0L 4PB9L 4FMKA 5DEGB 3MRLA 4JFFE 3K81A 2VLRB 1LEKA 5JPMB 1JZ4A 3LD8B 2FX8H 2PO6B 3LEXA 1G9NL 2NXZB 2EC9U 5DJXB 1RZKH 5IW6B 3HMXA 4GKNA 4BZ2H 5HYJA 1A6VH 4NRYA 3WO4C 2VQTA 3KPQB 3CLFH 4NYLB 4HIEB 1FSKC 5I8EB 3Q0HA 5CAYB 1DN0B 1LEIA 4NC1C 5GIRB 1ZTXH 3C60A 2ICCA 2PTTB 4JM2D 4R4BA 2P42B 5CKAA 2XZZA 1XGPB 4GSDH 4MNHA 1A1MB 3D39D 4X6BA 5GGTA 4YIQB 4HKZB 4NBZB 4UTAH 1FGNL 3UZQA 1SYVA 1N5AB 1A64A 2OCFD 4JO4H 3TZVD 1AFVL 5DRWA 1A9BB 5DJ2B 3G5ZA 5KSVB 5DVMA 2E7LC 4XCYA 3TN0A 5J11B 1SBSL 2EE2A 1RSFA 1OAYL 2IH1A 3NGBC 2AW2A 4EZMA 5C3TA 3U4EA 2XWTB 2UVFA 2Z93A 5F1NA 3U1SL 3DARA 3HG1D 3DSFH 3PDDA 4EUPA 2Z31A 3FTGB 4PG2C 1CFSA 4HIIB 4BQ8A 4RIRB 1N8ZB 3MCG1 5C0GA 3STZB 3PDGA 4TQEL 1L4IA 2HMID 2NY5C 4XAWL 5D2LB 5JZ7D 4JPVH 4XVSH 1VKXB 4H1LG 4L8DB 4S1SL 4XWGL 5B3JF 3B6SB 1WAAE 2VNCA 1UENA 1IBGH 2AI0H 4PB9H 4Y4FB 4ZPVA 5HBBA 5HGHB 5B4MD 2ZOLB 5KS9A 3KJ4C 2JJTA 1S7TB 1G9NH 4K71C 1EEYB 4IHOA 3T65A 2GK2A 1F58L 5DJDB 1FG2A 3HMXL 3QG6B 2J8UF 1OM3L 2HWZL 2P1YA 1RU9L 3TYGL 5D93C 1BX2A 2JB6B 3H9SA 3FB5B 1VADA 3MZTA 2XQBL 4ZXBB 3UEZA 4XPFL 1OLZA 3EO1B 5IW1B 2CUHA 1NFKA 1JN6B 4Y5YB 4ZDHA 3ULVF 1IM3B 5DTFA 4PRBB 5BRZA 1FGNH 5F88B 4F7TB 2QSCL 2ICES 2VQ1A 1AFVH 1OCWL 4G8FB 1D5MA 5I1IL 3P73B 1DP0A 4UINL 5ALCL 3EHBC 3S35L 2Y4SA 5HYJD 3QWQB 2GY5A 3GIVA 4JVPA 3CXHK 1SBSH 2BVPA 3WFBL 2RBLA 1OAYH 2CKBA 2H45A 4LLAA 4ZFZA 7CGTA 2DM4A 3N1MC 5D5MF 2J88H 5JOEA 3U1SH 2DOCA 5CSZA 1JMZA 3HS0B 1ZA3A 4FQXD 4HCRL 3WNKA 3P9WB 4TQEH 1FYTB 4PYGA 1XZ0A 4XAWH 4B53A 1ZWIB 4WRLA 4P2QB 35C8L 2ARJB 1WUNT 4EVNB 3TPKA 4GW4A 4S1SH 2APXA 1R24A 4XWGH 4MQTB 1XGYL 4LCWE 1CDJA 2QSQA 4F7EA 1Z9MA 4RMQA 1KCKA 4G9DB 3UPCA 3QCTL 4YHML 4OM1L 2BDNL 3PWNB 3AMLA 1LVEA 2VL5B 5C9JA 1WC7B 2R1WA 2YS4A 3I02A 3ILPB 5EU5B 2JIXB 1OT2A 4LVHB 3ZKQD 5I15L 5B39B 1F58H 3QO1A 2LVEA 3HMXH 1A2YA 4GRLB 1OM3H 4JFEA 2HWZH 4X4MA 2Z31D 5EZOL 1SY6A 4HWNA 2WINA 5D72L 3O9WA 4G8GE 1Z3GL 1MVUA 5DHYB 1AE6L 2D7PA 1BMGA 1RU9H 3VMOA 3TYGH 4R2GB 5GSRA 3BGFC 3UTTD 2XQBH 1QO3B 4U0QB 1AR1C 4XPFH 5L0QB 1ETZA 3E2HB 3L3GB 4POUB 3MRPA 5E8OA 1MIML 2QSCH 3B2UC 2HMIC 1K3ZA 4LLUA 3H3PL 1OCWH 5JZ7C 5I1IH 5F9AC 3E1F1 5JUEH 1OD9A 1WBXA 2ILLA 1RUAL 2FO4B 4UINH 5ALCH 3S35H 4Z7OF 5A3IC 3WFBH 1YNTB 4N0FB 4FP8L 1G7HB 1UCTA 5GGRA 2CKBL 4DWHA 4IBLT 3KLSA 3ZL4L 5EBLA 2A6DA 3WJJA 4YHPA 2DLHA 2P24B 4HCRH 2OS7A 3BD5A 3ZKXC 1N5YL 3RWEA 4TVSa 3ZDZE 5DC0A 5E6ZA 5J6HB 2ZG1A 35C8H 4M3JA 1CICB 1XGYH 4H20L 5LGJA 1QSEE 4NQXA 3STBA 3JTCA 1FFPB 2BY2A 1F3JB 3TBVA 3QCTH 1R3HB 4YHMH 4OM1H 2BDNH 3KHQA 4GQPH 1MWAA 2P8MA 3MMEA 2YK1L 5DC9B 3UPRB 5I15H 4GKZB 2XTJD 1CZ8L 3L5XL 4JRXA 2HFEA 4LCIL 4X5WB 1S7QB 1UM4L 2G2RA 4UB0L 4UDTA 5EZOH 3KPRA 3DMMA 5D72H 2WIIA 1Z3GH 2DKUA 3VFUB 2VABA 1SJVA 1AE6H 1JCKA 1JWMB 1QSFE 3CU7A 2I9LA 2I07B 3MUGA 1LK2B 3OKLB 1RK1A 3OKKB 2EICA 3QWOB 4GRWF 1MIMH 2GAZA 2R2EB 5FAAA 3H3PH 2YUVA 1ZHLB 5I30H 5SV3A 4LPXA 1RUAH 5J06A 3IETB 4F9PA 3WJLA 4JY4A 3FO2A 5GRXG 2NLJA 2CIKA 1RJLB 4HK3J 4FP8H 4PRHE 1Y0LB 4U6HA 3EW3B 3O9WD 2CKBH 1CE1L 3MA7B 4OLWL 1X5HA 1I1AA 3ZL4H 4ZFGL 2AXGB 2E8ZA 4PB0L 1N5YH 4RQQB 4YO0B 3RWHA 4D0CB 2NNAB 4WEUD 3PL6C 3PE9A 1MJJB 5DK3A 2X1WL 4X8JA 1XMWA 3CH1B 3LRGA 3UZVB 3OAZK 3NA9L 5DVOA 2NX5A 2ZCHL 1A1OA 2B5IB 3HZVB 4JM2B 3VGAB 1CYGA 2H2PD 4KK8D 1U2CA 4LSVL 1GAFL 4JFFA 3SGJA 2YK1H 3BIAX 4HKBA 1E4XL 3O8XA 2ZSWB 4OIBA 3INUL 3TZVB 4AL8L 1CN4A 3T0VA 1YEGL 2CKNA 1CZ8H 2PYFB 3FQNA 3I6LE 3L5XH 4NQDD 4WUUE 2D31A 5HGBA 4FOMA 4JPWL 4LCIH 1UM4H 4UB0H 4YDVA 3TVMA 2H6PA 4J1UA 4NQSA 2YZ8A 1SY6H 3HUJE 4NKIL 4JFXB 3GI9L 4C54A 4C57C 3MRIB 2NR6D 1J0KA 1EO8H 2DQHL 1RY7B 2X4TA 4IIQA 2A38A 2XWJB 8FABA 1KT2A 2FJHA 4O00A 4PRDB 1F4HA 4I3SL 4LHUG 2GSIA 4JRXD 3WEXB 4HH9B 3DMMD 4RGMB 5FGBA 1CE1H 4ZO7A 4KXZH 4OLWH 1M7XA 1QLFA 4JO3L 3ZDYF 5ECJE 4ZFGH 4PB0H 1F8TL 2MKLC 2NY1B 3WNLA 2X05A 3G6JB 3ULSB 4JZNB 1BBJB 1ADQL 4IOIA 4QXTB 5F1OB 3CJJA 4NZDA 3VXPB 4G7VL 4ORGB 4DW2L 1ED3B 3U48A 3IFOB 3L5HA 4C56A 4MS8D 1IVLA 1YNLL 1K4CB 3NA9H 2IWGA 2ZCHH 4WI9A 4RAHA 5C0BB 2A83A 4MA3A 1WAAA 2ED9A 4J7RA 4LSVH 5BS0E 1K85A 3OBAA 1BFOB 1QNZL 4U1HB 2H26B 3INUH 4AL8H 4QOKD 1YEGH 3MRLB 1UZ6F 3F58H 3S36X 1I1AD 1LEKB 1YYLH 4FQPA 4JPWH 3LEXB 5FCUL 4G80A 4PFEA 3L95A 4GKNB 4NKIH 5HYJB 1WT5C 3GI9H 3TJHC 4NRYB 5KN5A 1DTUA 1VHPA 2LQRA 3FONA 1ORQA 2DQHH 5AYQA 1KCUL 1LEIB 2APTA 5K9QG 4JREB 3C60B 4R4BB 4L9DA 3ARTA 4MNHB 5EBMA 1IC5L 3W5MA 4X6BB 3O8XD 3S98A 3I3BA 5IB1A 1SYVB 4JRYA 4I3SH 3BPNC 3LPGA 3NCYP 4GMSL 4Y8AA 5DRWB 4OI8A 1G9EA 2WANA 2H2PC 3EJZC 3TVMD 5H2BA 4WI6A 3G5ZB 3AAZA 2XY2A 4JO3H 5FECA 4XCYB 3BRGC 4UNTA 3TN0B 3SHSA 1F8TH 4K8RL 4M7ZC 5JMOC 1S9WA 3U4EB 3AS1A 1ADQH 2Z93B 5F1NB 4CMMA 4EUPB 4G7VH 1HH9A 1Q94A 2Z31B 3NAAL 4DW2H 1CFSB 4HW6A 1YNLH 5I1LA 5C0GB 1OL0A 1RJZA 3VFGL 3VE0A 4XPAL 5KZCD 5ICZA 1VENA 1QNZH 2EC8A 3BP7A 4ZPVB 5J13B 1QRND 1RZJC 4K8RD 5H37H 4GS7C 5KS9B 2ZSVA 4IHOB 1TJIL 5FCUH 5IK3A 3IDJA 2RHEA 3T65B 4G8GA 4C59B 5BV7L 1FG2B 4B41A 4DFHA 4KJWD 3MOBL 4Y4HA 3K0WA 4QNPF 2WZPD 2R69L 4C56D 1BZ7A 1KFAL 1ITCA 3QAZB 1KCUH 5DFWH 1BX2B 3H9SB 5IOPA 1VADB 4B0MM 3ZTJH 2P8PA 3V5DA 4W4NA 3H3KA 4ZDHB 4IM8A 1IC5H 4MS8C 4XBEL 3V4UL 2AEQH 5DTFB 4R7DA 3MODL 3RJDA 4LGSB 1LNUA 3RX7A 1RIHH 1TLKA 2VQ1B 4UT9L 4IDJL 2ZOKA 2C5DC 1D5MB 4X9IA 4GMSH 4Q9CA 2F8XC 1CK0L 4BK4A 3RFZC 2AQ2A 1UYWL 5ADOL 3Q2CA 3ZYIA 4NCC2 3GIVB 3QDJA 1EBPA 2BVPB 2CKBB 3BZEA 3DGCR 4YEEA 2ADGA 5CSZB 3NAAH 1ZA3B 4R0LA 1RK0A 3TFKA 1N6VA 1NGXA 3HZKA 3GSUA 2FWOA 1XZ0B 1QSEA 4J3OC 5LBSL 3LS4H 3Q6GL 1Y6NR 3VFGH 4GW4B 1GC1C 1R24B 4KXZI 4JRYD 4F7EB 3K46A 4LRIC 3QEUA 5FA4A 3ZT6A 5C9JB 1EIBA 2R1WB 3I02B 1TJIH 1JI1A 4HUMB 4Q58C 3GK8L 3QO1B 5BV7H 4I1NB 2HRPL 1QSFA 5HDOA 1A2YB 4PRPE 4JFEB 4CBPA 3MOBH 5IEHA 4GKOA 1JNJA 3BZ4A 2WINB 2R69H 3O9WB 5L8JB 4WFGE 1MVUB 2Q7YA 4P9HL 1KFAH 2QQQA 2R2BA 4PP8C 3LB6D 1IC4L 4Z76A 5GSRB 4HFUL 4EIGB 1P9MA 4B50A 3CDGA 5GQBA 2NY2B 1ETZB 4MD4A 5E4EB 3RZCA 4XBEH 3V4UH 3MRPB 4DOHE 3MODH 5E8OB 4PJ8A 1BQHG 2AXFA 4LLUB 4UT9H 4IDJH 5DA0B 2COQA 1CK0H 3VXUE 4CAGA 1WBXB 5ERWA 4BUGA 1UYWH 5ADOH 3CFDA 5TF1L 5A43C 4Y4HD 1VGKA 3CU1A 4K8RC 4KV5F 5GGRB 2N1KA 4M6NL 5EBLB 2FIKB 3MFFA 5C08A 2A6DB 5L2KE 4YHPB 4RAUA 3FRPG 1LHZA 1GSMA 3RWEB 2BSTA 2FRGP 4MJID 4KJWC 3U7YL 4HZAA 1Q38A 3P0GB 3QDGA 5LBSH 1DVFA 4F58L 3Q6GH 3UTZA 5DR5L 3R8BB 2BHUA 5LGJB 4NQXB 4GH7B 3DUUA 3TBVB 4CMHB 4Z7VE 2XQYK 2ITCA 2HG5A 1MWAB 2P8MB 3MMEB 4F7PA 4KDTA 3QDJD 4NN6C 3WNMA 1SBBA 3GK8H 3HUJA 1MAML 1PZ5A 5J89A 2HRPH 4JRXB 2HFEB 2DM7A 2G2RB 1J1XL 4UDTB 1W2KT 3HRPA 3KPRB 3DMMB 2WIIB 3SKJL 4P9HH 4WCYL 2VABB 1IC4H 2I9LB 4HFUH 4K2UL 3MUGB 5DS8A 1RK1B 3OAYH 1CGYA 2YD1A 3RI5F 4WTZA 2J1KA 3B5TA 1F2XK 3HPJA 3RY6A 2GAZB 5DXWA 2EIZA 1CL7L 1I8KA 1D3CA 4PDCE 3WNOA 2QHRL 5GGQL 3L3HA 3KPSD 4JY4B 3FO2B 2NLJB 2CIKB 4PBXA 2Y1VA 2PETA 5TF1H 4U6HB 2DI8A 5T1LD 3RVXD 1I1AB 4M6NH 3FHQA 1CFVL 1VACA 4U7SA 5HJ3A 1A3LL 3DVFA 5A16A 4NNPL 1ZVSA 3RWHB 3SEPA 4RNRA 4ERSL 5EDXA 4B7IA 1DUYA 3U7YH 2L7UA 3RZCD 5HPOA 2DDQL 4H8WL 4HPYL 4X8JB 4UTBL 2OMBA 4F58H 4PJ8D 5BW7A 4Y0GA 5DR5H 1P69B 5E6YA 2NX5B 3QI9D 1PSKL 4F15C 4WU7A 3ZO0A 1M7IA 3T2OA 4JFFB 4OZFA 4WEMB 4MXQC 4HKBB 3PG2A 2UY6A 1K2DA 3O8XB 5D1ZD 4UAOB 3FQNB 3TO4A 4RRPG 5HGBB 4X6CE 2D31B 5C08D 1J1XH 3MV8E 1C7TA 4YDVB 3TVMB 2H6PB 3SKJH 4J1UB 4N1HB 4NQSB 4WCYH 4XMPL 1IGIL 4K2UH 4S10A 3QDGD 2ZUWA 2D9CA 4Q97A 1SEQL 4D9QE 1MFAL 3VFTA 5LAXA 4U6VL 4PV8A 2X4TB 3IVKA 2ZP0T 4PJ5D 4IIQB 4Y2DC 1G9ML 3WIFA 1CL7H 3GJFA 5ILTL 1CTOA 3CGTA 5EZJA 1IC1A 8FABB 1KT2B 2QHRH 5GGQH 2FJHB 2C7UA 2NY3C 2GSIB 4OF0A 5EC2A 1SVCP 1MFNA 1U8OA 4Z6AT 3ORJA 1IAMA 1QLFB 2VTFA 1CFVH 1A3LH 1PG7X 1D5IL 4YBLC 4NNPH 4ERSH 1TZIA 4PBVC 4R90H 4IOIB 5E2TL 2DDQH 4NNXA 1J7VR 3M17A 4H8WH 4K07A 4HPYH 4UTBH 4WV1A 4C56B 4RISL 4DVRL 5ESVA 3QUYA 1PSKH 4XP9L 3ARWA 4MA3B 4NUJA 4X4YA 3MCLL 3TPUE 4HGWA 2APFA 3L3IA 2OZ4L 4X7EC 2FLRT 1GXEA 2Y5TA 3O4LD 3C6SA 2UYLA 2V5TA 1HE7A 4FNLL 2W9EL 1WTGT 4KKAC 3CVHA 2UY7A 4G80B 5BV7B 1F13A 3L95B 4XMPH 1IGIH 5AG8A 4X7DC 2FLBT 5ISZE 3DX9A 3DX6A 3E3QA 5KN5B 3RWDA 3MYZA 3FONB 1SEQH 3DUSA 1ORQB 3CCHA 4GG6A 1B0RA 1CFBA 1WJ3A 4NIKB 1MFAH 3EYUL 4U6VH 4K3DL 3SDDC 4XMLL 3TJEL 1G9MH 4P2CG 3T0XA 4ZOCA 5ILTH 3CDFA 5IB1B 3QI9C 2BP3A 4JRYB 1MCFA 4NNYA 3TO4D 4XWOD 4Y89A 2A6KA 3UDWA 4RGND 1RIVH 1LK3L 3RIFF 3GM0A 1F11A 3SE9L 3RY4A 3OKDA 5H2BB 3AAZB 2Y23A 5FECB 5K9OA 5D1ZC 1D5IH 2E9IA 1DBML 1TZHB 1J8KA 1S9WB 5ESQA 2ESVD 4CMMB 1I3UA 4TSBL 2D4FA 2X4OA 1HH9B 1Q94B 4O2EA 1T20A 3VFVA 4H8WC 4NZTL 4RISH 4DVRH 5FM5M 3OF6D 3VG0H 5I1LB 3WFHA 1RJZB 4XP9H 4K3EL 2YD9A 4YBQC 2R29L 3MCLH 5EU7C 2FL5A 1P7KA 4NZRL 2OZ4H 1OP5K 1V3MA 3VE0B 3EYQD 5ICZB 4IOFC 3BP7B 1T2QL 4FNLH 2CDFA 3QHZL 2D4DA 2VLKA 2C26A 2XA3A 2I5YL 2W9EH 4ZOAA 2ZSVB 4WFHE 1OTSC 5IK3B 3IDJB 1CF8L 3CVHL 1VA9A 4N68A 4G8GB 3QXVA 4OKVB 1OQXA 2VZ1A 5GPRA 9CGTA 4NQDE 5BCAA 3F7QA 4Y4HB 2FIRT 5DWUL 1R3KA 2C4FU 1BZ7B 3EOBA 3EYUH 3QEGH 4KMQA 1FGVL 4K3DH 5IOPB 4XMLH 2D03L 4IRZL 3TJEH 5D6CA 2P8PB 3TP4A 3V5DB 4OV6F 3O6ML 4H5SA 4R7DB 3L6FA 1LNUB 4J8RA 4M02A 2ZOKB 4NDMA 2Z8VC 5IM7A 1LK3H 3SE9H 4Y88A 4MCYA 1EGJA 4U2ZA 3QDJB 5GJTL 3GIZH 4MHHI 1DBMH 2ZZUT 3BZEB 5D1QD 4TSBH 5C6TL 2ADGB 4LCYA 4NZTH 4R0LB 1RK0B 5F1IA 1NGXB 3HZKB 4U6XA 1RUML 1JP5A 1HOCA 3GSUB 2FWOB 2QADB 3DVGA 1QSEB 4K3EH 2R29H 5DVLA 3NN8A 4NZRH 4Z7VA 1FPTL 2H32A 4FFVD 4BK5A 1WICA 3DRTA 2FATL 3QEUB 1T2QH 5FA4B 5FGCB 3HAEG 3QHZH 2I5YH 3QQ3A 1NCUA 2ZUYA 3RGVA 3WS3A 3WHXA 1JHLL 3CFEA 4N9GA 3CVHH 4XWOC 4RBPK 1QSFB 4JDTL 5IEHB 1EAPA 1A6ZA 3BZ4B 5DWUH 4GXUN 4ACPA 2Q7YB 3WFCL 5T1LB 3QXWA 2R2BB 1N3NA 1X9QA 1ZLWH 4D94A 5F7KC 1FGVH 4Z76B 2D03H 4IRZH 2ZPKL 3CDGB 3VFSA 2IQAA 4MD4B 1I8LC 4HX1A 3RZCB 3DO7A 5ID1A 3O6MH 3CX2A 3T1WA 4PJ8B 4PV9A 4KK5D 3N50A 4P46C 2AXFB 3ARDA 2VLKD 1JGEA 5CD5C 1UVQA 2EE9A 5ERWB 1AC0A 4NN7B 5D9SA 3CFDB 5I73C 2MPAL 5BVPL 4ZFOA 5GJTH 4TTDD 1WFUA 4K23L 1VGKB 5C6TH 3GO1L 3H9YA 1AQKL 3MFFB 5C08B 4RAUB 2B4CL 2YOCA 4WI3A 5TE6L 3ARQA 2XACC 2BSTB 2EC9T 3VGBA 1RUMH 2DJ4A 4Z7WF 1IQDA 3QDGB 1DVFB 3UTZB 3MX0A 4CDHA 5AD0A 1JGLL 3L7EA 3BRFA 1FPTH 1MAKA 4WHCA 3DUUB 4FFZL 2FATH 3SCMA 3SDCA 5A2KH 1CDBA 1PVHA 2EDQA 2HG5B 2ITCB 1IFHL 3RGHA 4X6CA 4F7PB 1E6OL 1JHLH 4E0RA 3MV8A 4XCFL 3HUJB 1PZ5B 5J3HD 4PJ9D 4JDTH 2P5EE 3TF7C 3PL6A 4MAYA 4LKXA 1KPRA 3WFCH 2IFGA 3ZYJA 2ZPKH 5DS8B 4OLYL 4J3UA 5GRVK 4OZGE 3B4NA 3ECBA 3CDYA 3HPJB 3F62A 4H1LH 2EIZB 3SE3A 4HKJA 1TJGL 4LLDA 4ZS6C 1J86A 1QLRA 3MLYL 3KNBA 3RGVD 5K59F 1HWHB 2AV7A 5BMFL 3L3HB 4HWUA 3N0PB 2NW2A 2MPAH 5FHAL 5FYJL 3BJLA 5BVPH 1T1XA 2H1PL 5JO5B 3R06A 3I85A 3JZ7A 1DEDA 1Q72L 3GO1H 1VACB 5HJ3B 1AQKH 1J0HA 2B4CH 5HXMA 5A16B 1ZVSB 3UX9B 4RNRB 4HBCL 3MOAL 1DUYB 4PGZA 4UQ2A 3WIIL 1J1PL 4TOYL 3TPUA 1JGLH 5HD8D 3ARDD 4HUKB 2DICA 4FFZH 1RPQA 2H32H 4FMFA 4WU7B 3UROR 1M7IB 3KYNA 5FYJD 4UZGA 4YLQT 1IFHH 2V2WA 1N6QL 1C7SA 3JV4A 1E6OH 4WO4A 3GSQA 1K2DB 4LAJH 4OFKA 1XIWA 4XCFH 3TO4B 4MAUL 1J87A 1LWRA 5C0IA 4HGMA 4TUOA 3L1OL 3MYJA 3O6FD 3TM6A 3OGCA 1J5OL 1PEWA 3ROLA 4AMKL 3CFJA 5T1DL 3BKCL 2OR9L 1OTTD 2MQ0A 3HC0A 4OLYH 1G7PA 1KCVL 5C8JB 2CGRL 5I75C 4WW2C 3VFTB 5LAXB 1HSBA 1MCIA 1QFOA 1KV3A 4PV8B 3HLAA 3IVKB 1K9TA 3SDCD 3WIFB 4NN5B 5E99L 3IKCA 4KHXL 3GJFB 2OI9C 5CSGA 5EZJB 5KVGH 3HC4L 2MWCA 5BMFH 3SDXF 4HJJL 3ILQC 4LDLB 2C7UB 5FYJH 5E6IA 3UCRA 3VGEA 2H1PH 4MAYD 4Z7UF 5EC2B 1KTLA 3D2UA 1Q72H 2BVTA 2J12B 2ERJB 3VMNA 4PJ9C 3OXRB 4HBCH 3CFCL 3D87B 5CEZL 3EJYD 1TZIB 1FSKB 2F5AL 4ZD3L 3MOAH 3IXAB 4XAKD 4NNXB 1A1NA 3M17B 3WIIH 1J1PH 4WV1B 4HAGA 3W11C 4TOYH 3V7AG 5F6IC 2VZTA 4EXKA 5ESVB 3QUYB 2HKFL 3BMWA 4MJIE 2MQ3A 4Y4KC 3DGGA 4NUJB 4X4YB 4HGWB 5F7DA 4KROC 1NCCL 3L3IB 1KEML 1N6QH 3L5IA 2Y5TB 3C6SB 1T2XA 2UYLB 2YRZA 3BD4A 4MAUH 3GSRA 5TE7L 3O3BA 4LL9A 3L1OH 3CVHB 5CEZD 1BVZA 4QXWA 3VGDA 1J5OH 3RUGE 4AMKH 4Q7DA 2OR9H 4PRIE 3LQZA 4WHYG 5I0ZA 3QDMD 3DX9B 3DX6B 3RWDB 4V2CB 1KCVH 1YEDA 3DUSB 3FQRA 2CGRH 3CCHB 4GG6B 1B0RB 5L8KB 3LDBC 2ZUTA 2PNDA 3BPOC 3E6FA 3RZWA 5JIHA 4OLXL 3G6DL 1HDMB 1ZT4A 5E99H 5AWNH 5L6YL 5D1XD 4KHXH 4LLMA 4YZFE 3BPLB 3HC4H 5HD8C 4IS6A 3QO0A 5JR1L 3RVTD 1KJ2A 1A7NL 4HJJH 4NNYB 2E9BA 4R97C 5DA4A 2A6KB 5EOQL 5K9JL 1BD2D 5D2NC 1I7ZA 1F11B 1KGCE 3OKDB 1XR8A 4CN4A 2LVCA 1PX4A 1S3KL 1U3YA 4NBYB 5K9OB 4MZ2A 5CEZH 3CFCH 3G04A 2F5AH 5F7WC 5ESQB 4ZD3H 3O6FC 5D93B 1YMMA 3KG5A 2X4OB 4O2EB 1LO0L 1T20B 3VFVB 2WIMA 2HLAA 2DKMA 3WFZA 1CCZA 2FGZA 2X70A 3LH2L 3EZJB 3WFHB 4P2RE 2OXHA 2XG4A 1DLFL 4CU6A 4NHUE 2FL5B 1P7KB 4WNQA 1NCCH 1KEMH 3DROA 3WDJA 1L0XA 3CLEL 3BKYL 3I6KA 1Q0XL 5IFAL 2QQNL 3VFNA 5IVZA 1AHWA 2CDFB 2VLKB 2XIDA 5C7XL 3D2UD 1MCCA 5TE7H 2RQ8A 3RPIA 1GJIA 4OKDA 4DTGL 2VDQL 3O81A 4HGKC 5MEQA 4IMKC 3MA9L 2J2ZA 1R3KB 2K3TA 2Z8RA 5I74C 2YD2A 3EOBB 5KVDL 2A0LC 4DVBA 4DOHB 4OLXH 1QBLL 2R9HC 5D6CB 1EFXD 2IAND 5L6YH 5I8CA 1JL8A 4APQD 5GZND 4WFFE 4L4VA 1DBBL 4H5SB 3SO5A 3L6FB 5JR1H 1HSAA 4J8RB 1A7NH 1U3JA 5I66A 4NDMB 5EOQH 5K9JH 1INEL 5IM7B 2EXYD 5MEOA 1BF2A 1FNHA 4AT6A 5HI5D 4D0DA 4IRJA 1T1WA 4MCYB 4AEHL 4EQ3A 3HTLX 1H8NA 4ZO9A 1S3KH 4L4TE 5IGXL 3P4LA 5EUOA 3TH2T 1ZVYA 1A02N 3THML 4F7MA 1G6VK 2QSVA 1LO0H 4LCYB 1WWWX 2Q3AA 4HJ0C 3C6LC 5F1IB 1MCQA 2VXSL 4U6XB 3MLSL 3LH2H 5M94B 1HOCB 1DJSA 3ULUE 3DVGB 2R1XA 1DLFH 1AGCA 1T0NA 3WFDL 3NN8B 3RDTA 4Z7VB 1GGTA 2H32B 2VDLL 3CLEH 1X6LA 4TN9A 3DRTB 3BKYH 1Q0XH 5FYKU 5D1XC 3ZDXE 5IFAH 3X3FL 2KQNA 2QQNH 5LG1A 5C7XH 3QQ3B 4P5TA 4WWID 3RGVB 3T4AA 3WS3B 3WHXB 3T1FA 3CFEB 4N9GB 3WO3B 4DTGH 4BSVA 2VDQH 4J3SA 2X89D 4FFWD 4ODXA 3MA9H 1EAPB 1A6ZB 2NZ9D 2YEZA 3STLA 5E00A 1IT9L 1JHTA 1CLCA 1L9MA 1N3NB 5KVDH 1I1YA 2X42A 3UTPD 3V5HA 2LU4A 4OZGA 1QBLH 1T6VN 4NO0D 4OQTL 5DD6A 2BVQA 2EE6A 3HPLA 1EUTA 3VFSB 5EBWA 2IQAB 5I1EL 4HX1B 3SGEH 3DO7B 5ID1B 1DBBH 4PV9B 2BRRL 1PBYA 2J6EL 3ARDB 3UBXA 2VR5A 1INEH 1JGEB 1TJHL 2EO9A 1UVQB 1JGUL 4AEHH 4PJEA 4XTRD 2X4PA 5K93A 5D9SB 2FECL 4ZFOB 3K1KC 5IGXH 4JHBA 4I18A 1MRDL 3THMH 3MACL 1CG9A 1NGQL 3GMMA 3T04D 3BISA 4M6OL 2VXSH 3MLSH 4BUHA 4GFTB 1MF2L 2DLIA 1IQDB 2JE8A 5DURD 3WFDH 3QXDA 4L4VD 1YC7A 4FABL 3BGAA 2Y72A 1MCDA 5AD0B 3L7EB 2VDLH 2XRAL 1RURL 4G6FB 3SCMB 3SDCB 3X3FH 4APQC 3QIUA 4IRJD 5GZNC 5MENA 5DHXB 1GGBL 4X6CB 5IEKA 1X5AA 1MAJA 4AYFA 3DV4A 4E0RB 3MV8B 3NFNA 3TH3T 2CXGA 4OLVL 4UDUA 5HI5C 3EFDL 2XKUA 3GJEA 3PL6B 4MAYB 4LKXB 1KPRB 5B39G 1JGDA 5IHZA 1YA5A 3RWIB 3PJSA 5IFHL 4OQTH 4B7LA 2YRLA 4MJ5A 1M1SA 1KYOJ 5I1EH 5C07E 4HV8A 3RAJL 3VU2A 3R1GL 2IPTL 3ECBB 2BRRH 2J6EH 4HKJB 4MXQA 3AC0A 4LLDB 1TJHH 1QLRB 4P5TD 4WGWB 3KNBB 4P3DA 2CLRA 1JGUH 3I50L 2AV7B 4ETQA 3M1BA 5E5UB 2CMRL 4KI5E 2NW2B 3LRSA 4PLKD 1T1XB 1M71A 5E5MA 1U0QA 3R06B 1QPXA 2X9YA 4D2NA 1U95A 2YN3A 1MRDH 3RWFA 1CXIA 1NGPL 5TE4L 5LGKA 3MACH 2OTWA 4KI1A 1NGQH 5DHVA 4M6OH 3UTOA 5E9DA 4BQ9A 4ZSOE 1DR9A 5JW3L 1MF2H 4UQ2B 3RVUD 1JPFA 1A14L 4OI7A 3TPUB 5E7BA 5GS1C 4OLUL 4CVXA 2XRAH 1RURH 1W0WA 1E6JL 5SX5H 1QHPA 3EOTL 1ZHBA 1HXMA 2XFXA 3KYNB 1QFWI 1GGBH 2V2WB 4FQCL 2V9QA 3JV4B 3ZE2E 5EIIA 4WO4B 3GSQB 1XIWB 5JHLL 5C0CE 4F80A 4OLVH 4OLEA 4JVUA 5C0IB 2BXYA 4TTGA 4TUOB 3EFDH 4HZLA 5DLML 4PRIA 3MYJB 2UUDH 4XTRC 2SEBA 3UAJD 3OGCB 1IGJA 3ROLB 1U3HD 3CFJB 4G9FA 5E8NA 3HC0B 5IFHH 3RIAF 1G7PB 4S2SA 3O3AA 3ZMRA 4MJ4A 3RAJH 3BEWA 3R1GH 1HSBB 4PRAA 3PWJA 1A7QL 3HLAB 3VRIA 4XCNA 3QIUD 5MEND 2IPUG 3IKCB 3K8LA 3ZE0E 4F7CA 1GOGA 3I50H 5LQBL 4FHBD 3HE7C 4IRSD 4O2CA 4MYWB 2CMRH 5IVXE 3VWKA 4EDXB 2OL3A 2HN7A 3SE8L 5E6IB 4O51A 4OTXL 4D9RE 2F54A 5KSBF 1F5WA 5I16A 5LGHH 5J12B 1KTLB 1HI6A 5DGQA 1NGPH 3D2UB 3EYFA 5TE4H 4G6ML 3SGEI 1S7WA 4WI5A 3C8KA 3BH8B 5IB2A 1DANT 5HI4C 5JW3H 1U8MA 5T3ZE 1G7JA 2P5WD 4XT1C 1L7IL 1A1NB 2MMXA 5HHMD 4K9EC 5IBLC 3LVEA 5J4MA 3HNVL 1OT1A 1S78D 1H3GA 3OXSA 3QBTB 1E6JH 3DGGB 3EOTH 5TDNA 5F7DB 2OR7A 4KH2A 3VXSA 4OQ1A 4FQCH 4JPIA 3OPZL 4FTVD 3RWGA 1I3VA 5JHLH 1JYNA 2OBGA 1UJ3C 3UYPA 1Q8MA 3GSRB 3AM8A 4M7ZB 5DLMH 1YC8A 3O3BB 4P4KA 1U8QA 5J1SC 5E9DD 2F8OA 3ISWA 4ENED 1TQCB 3LQZB 3RBSA 4BSJA 5DUPL 5EU6D 5DFVD 1YEDB 4MA7L 4Z78A 1QACA 2IJ0C 3FQRB 4N90E 1JPSL 1UJTA 4NHCL 3QQ9D 3RUGF 1A7QH 1A6PA 3E6FB 5JQHC 1EPFA 1OF2A 1ZT4B 4LAQL 3T0BA 3VXME 4LLMB 1EVUA 3HZMA 3QUZD 5LQBH 1P5UA 4IS6B 3QO0B 4UUJA 2YHGA 5TPWL 1KJ2B 4Z77A 2DQEL 5FM4A 3SE8H 1R5VA 2XPGA 4OTXH 1I7ZB 4L4TA 2GI7A 3B2VL 4N5ED 3F65A 1XR8B 3VI3F 1T66D 5IMOA 1P1ZA 3DNKA 1OQOA 4G6MH 4G9FD 2J8OA 2NY0C 5IVOA 4YHKL 3G04B 4HPOL 5DHVH 3ARGA 3GZKA 4FG6D 1YMMB 1L7IH 4PJIF 2MQCA 1MCKA 4JDZA 1U3HC 2HLAB 3C2SA 1IJ9A 2L0DA 5D7KD 2X70B 1NCBL 1X4YA 2FECI 4KKBC 2EDFA 5FDWA 2NTFA 4WNQB 3LCYA 3DROB 2X4RA 3O4OC 3VWKD 3SQOL 3OPZH 3I6KB 2F54D 4M61A 3U4AA 4I0CC 3VFNB 5IVZB 1YECL 1AHWB 4BELD 5DJ8A 4IRSC 1V5JA 1WSST 3RPIB 1ORSA 2WSKA 4TSAL 5CGYD 4NQED 5DF0A 2WNGA 2X10A 1BZ9A 4HS6A 4MQXC 3JWOH 4YDIL 1NLDL 5MEQB 1XF2A 4P2OD 5DUPH 4MA7H 5DMGD 4JEGB 4QXGL 1JPSH 1FNGA 2EDYA 1WCBB 3G9AB 4NHCH 2BHZA 2HT2D 5IJKC 1UWXH 4DVBB 5DFTA 2LAAA 1KTKE 3MCKA 3HKFA 4LAQH 2YBRA 3ARUA 3RTQD 1ZGLP 3FB8A 2E7MA 2YPLA 4DGYL 2CLZA 2VJXA 4P3CL 5I8CB 4IOSD 2CDGA 1AI1L 4L4VB 3RHWF 4GJTB 1HSAB 5TPWH 2DQEH 2XA8L 5I66B 3CK0L 5MEOB 4XXCC 4AT6B 4P4KD 3B2VH 1HNFA 4D0DB 4IRJB 1T1WB 3H7BA 4S0TD 4Q6IA 1OPGL 4PGCA 1I9RL 5BQ7A 1OVZA 1OWWA 3BP4A 4NQVA 4YHKH 5EUOB 4HPOH 1KB9K 3B9AA 5FFLA 1CGXA 2H41A 3C09B 4KKCC 4F7MB 4S0SD 2D0FA 1KENH 4ODTL 3TCLA 5F9WB 1NEZA 3GMNA 1NCBH 2CDEA 4EUPG 3CAFA 4PGJA 1NUFA 2R1XB 3FZUD 1AGCB 1T0NB 1L0QA 4JFHE 3QQ9C 3RDTB 3SGDI 3SQOH 1LP9E 3CSYA 4TSCL 4GXUM 4PLOB 1MCWM 2P8LA 1H3XA 3QUZC 4P5TB 1QSVA 3T4AB 1H8SA 3T1FB 4TSAH 3IJSA 1IZKA 4BSVB 3ZDXF 3ARGD 4RWYL 1NLDH 1MVFA 1CDYA 4ODXB 2C1OA 2YEZB 3STLB 2XN9A 5E00B 1JHTB 4QXGH 5L7XL 3RL2A 4CDGC 3HE6A 4OIAA 4LASL 1I1YB 5C07A 5JXED 1T1YA 3V5HB 4OZGB 4FG6C 2EDEA 4POZD 5DD6B 3ULVC 2BVQB 3HPLB 2DMBA 5EBWB 4DGYH 2W1NA 4YHYB 2VZUA 1WBZA 3DXAE 1AI1H 2EE3A 2DWDA 4Y1AE 2XA8H 4L3ED 3CK0H 3UBXB 4NN6B 3S5LG 1AKJD 4LSDA 4AQOA 1U92A 4PJEB 1XGTA 2X4PB 1OPGH 2LE9A 3HHRB 2VLJE 1I9RH 2V7NA 2MCG1 1KIQA 5D6DC 2NXYC 3OWEA 4XI5D 3ARBD 1S7SA 4I18B 4HG4J 3UYRL 3PWPD 4I0PC 4PJHE 2PYED 1YEKL 2UZXB 5IROC 2O5ZL 1CG9B 4OCMC 3GMMB 4ODTH 1B9ZA 4P2OC 2YPLD 5DMGC 2DTML 5IMMA 2E7BA 2VLME 3QXDB 4H0HB 4Q9QL 1GHFL 3QUXC 3FB6A 1KG0A 4TSCH 3RTQC 3O41A 5DT1L 3MR9A 3QIUB 5MENB 5F3BA 1NCNA 4JFDE 4HF5L 5JHDD 4DEPB 4FQHA 2BJML 5IEKB 4X6EA 4PJXF 3MREA 3T0EC 3DV4B 2NY7L 4HS8L 3NFNB 6CGTA 4UDUB 4NFCA 1YN6A 4RWYH 1CXKA 4LIQL 4YHZL 3GJEB 3QA3A 2YA2A 2BVEA 4K3JL 4P4RA 4PJGF 5I71B 5L7XH 3MV7D 1JGDB 5HDBE 5IHZB 1FG9C 4LASH 5EOTB 1W8OA 2IPKA 3PQYD 1IAIL 4MQ7A 3PJSB 3QFDA 3NACL 4MJ5B 4OZHF 5GISL 4HV8B 4RFNB 1R3IL 1QKZL 4FQLL 1OTUC 3MNZA 3FZUC 5IVXA 2AJYL 2BNQE 4F9LC 4P3DB 2CLRB 3EO0A 4G43A 4FXGA 4ETQB 4L8SA 3M1BB 1FO0A 1JTPA 4LEOA 2X4SA 3GSOA 3LRSB 2Z8SA 2KH2B 3BSZL 5HVHB 1M71B 3IYLW 5E5MB 5C92A 2AJZA 4MX7A 2XN9D 1U95B 3UYRH 5FO8A 4N8VG 3RWFB 1YEKH 3KJ6L 3HE6D 2O5ZH 5DD1L 1JI2A 2OTWB 1CFQA 4PD4K 4XVUC 4OFDA 5DHVB 5E9DB 2EZ0D 4WW2A 3WLWC 2Z0BA 3TBWA 2Q3ZA 2DTMH 1JPFB 4I77L 2BOBA 4BM7A 3CX5K 2GJ6A 4Q9QH 1GHFH 1MJ8L 4CVXB 4HLZH 2VOTA 3MRJA 2C4FT 4KAQL 1W0WB 3WSQL 2R1YA 5DT1H 1ZHBB 1HXMB 2XFXB 4HF5H 4LFHD 2GUOA 4QLRA 3RWCA 4DFIA 1CLOL 5JMRA 2OJEA 2BJMH 5D96B 5EIIB 4ELME 2NY7H 4HS8H 3JVGC 4NQTA 4OCXL 2PXYA 2WAHA 4LLWA 4UILL 4LIQH 4YHZH 4NWTL 4U1IA 4HZLB 4PRIB 4X4ZA 3QEHA 4K3JH 5DJAA 2DL2A 5JW4Q 2SEBB 4E41E 3ZE2F 1QR1A 1IGJB 1P6FA 3D3VE 4G9FB 4XPTL 3D9AH 5E8NB 1IAIH 2DIBA 2QJDA 4S2SB 3O3AB 3NACH 5GISH 1OGTA 4PREA 4Y4KA 1R3IH 3BEWB 1P5VA 4PRAB 3PWJB 1QKZH 2VDPL 3O6LL 3QCUL 4K7PX 4XCNB 3F7RA 4NBXB 1NFIA 2AJYH 2HVKA 4F7CB 5IB3A 4O2CB 2HFGL 3VWKB 3WBDA 4I0KA 2OL3B 3CPLA 2HN7B 3BAEL 4O51B 3BSZH 2BSSA 2APBA 3ZE0F 2F54B 5I16B 1NAML 3BPCA 4NZUL 1HI6B 5TFSL 3EYFB 3KJ6H 1NUGA 5DD1H 2APVA 4U1KA 1S7WB 1MCSA 4Y5VC 3C8KB 2X1OA 1NFDE 5TDPA 5IB2B 1U8MB 2OYPA 1G7JB 1I9JL 5IG7A 4DZBA 4I77H 4P48A 4FFYL 3BP5A 3O2DA 5ENWA 3VFPA 1MJ8H 2JJSA 5HVFB 1DSFL 4P23A 3OXSB 4KAQH 3OR6A 2ADJA 3WSQH 5C70A 5HY9A 3UPAA 2DQUL 5TDNB 2E6QA 5C9KA 4NT6A 4FQJL 3VXSB 1CLOH 4ONGL 4Y19E 3GRWL 4YC2C 1WCQA 3RWGB 4OCXH 1Q9KA 1JF1A 4X9GA 1F97A 4UILH 4NWTH 4P4KB 1U8QB 2VZSA 4YPGA 5H37G 3UYOD 4QEGA 3VI4F 4XPTH 3DIFA 2W9DL 4LLYA 4XB8A 3MBEC 3O0RL 4Z78B 5BJTA 3NVQA 2GJ6D 3B9KA 1P7HL 1RZGA 1KYOK 4X83A 5CIPA 3HI5L 2VDPH 3QCUH 3O6LH 2EZ0C 2NY6D 5MHSD 1OF2B 5IIEA 1AO7D 4QHLA 5AEAA 5EH1A 3A67L 5DRXA 3ZTJG 3HZMB 4YGAB 1BM3L 3WMSA 4UUJB 3LEVL 4B5EA 2HFGH 3A6BL 4Z77B 4FN0A 3BAEH 4QHMA 1R5VB 1FO0H 5E8EA 2XPGB 3FFCA 4U4BA 4L4TB 2X4QA 1T7VA 1NAMH 3RU8L 4NZUH 5TFSH 1YDPA 2ZUQC 5IMOB 4IMKA 4Z0BL 2YC1A 1P1ZB 5CCKL 2IAMC 3QIBD 5B8CC 2CRYA 1S7RA 1ZHKA 5K33A 2A73A 1P84K 1S9VB 1GGCL 1CXFA 2JCCE 5B38A 3ARGB 1I9JH 2VC2L 1JZ2A 4JDZB 4S1QL 4FFYH 1JZ3A 1BFVL 2F53E 4ODHL 3LKQA 1DSFH 4HMDA 1TXKA 1LP9A 3AY4A 3QUMA 4H0IA 2DQUH 5FDWB 2NTFB 4PJFE 2X4RB 4FQJH 4MDIA 1D5XA 4ONGH 3GRWH 1GOFA 3SBWC 3MLZH 5IWLA 4M61B 3IGAA 1ZSDA 3MQIA 1XCQA 5DJ8B 4ZFFA 1NANH 1ORSB 3W0WA 1BZ9B 4HS6B 3VDBA 4LPTA 2W9DH 2M1KA 3BXNA 3OV6A 4XNYL 1XF2B 1EHXA 2JTDA 4UI2A 3CXHJ 5IP4A 4UOW1 3RPKA 1FNGB 3D18A 4P23D 3HI5H 1UC6A 3MCKB 3DXAA 1QR4A 3IJYA 1H3UA 3DHJA 4Y1AA 3SKMA 3FB8B 4OCYL 2YPLB 2X9XA 2CLZB 3NH7L 4L3CB 3VA6A 1ZXQA 3A67H 3U30C 4Q74A 4LCCA 5HI3D 4UBDC 2CDGB 5EZIL 4OZIE 1BM3H 2CLVA 4JZJC 3DV6A 3LEVH 3A6BH 4YHOL 1DFBL 3NCCB 4X4XA 4K94C 2WBJD 2J4WH 4TRPL 3RU8H 1V3KA 3H7BB 4Q6IB 3NCMA 4Z0BH 5CCKH 4PGCB 4PJHA 5BQ7B 3BP4B 1VFUA 4I3RL 4NQVB 4ZS7L 1GGCH 1NMCC 3B9KD 3KDMA 2VC2H 4Z0XA 2VKWA 4KJPC 4MNQE 3BT2L 4KKLC 4S1QH 2XNAA 1BFVH 1OP5H 5FUCC 3TCLB 1CI5A 4ODHH 1NEZB 3GMNB 2CDEB 3Q5YA 4K3GA 1EX0A 3PQYB 1JTOA 1W72A 4JFDA 3UTSD 5TQ0L 32C2A 2C4XA 3CSYB 3DURA 3FFCD 4JFQA 3VWJD 1AXTL 1FFQA 1MLCA 2P8LB 3ALPA 3WS6C 3F7VA 5C09E 1LO5A 3P4NB 3IJSB 1CE6A 5F1SA 4A6YA 5IFJA 4CJ0A 3GJFK 1MLBA 4XNYH 2C1OB 4OGYL 2XN9B 3QIBC 3PWUA 1QLEL 3RL2B 2WY3A 4G7YL 3HE6B 5C07B 1V7ML 1T1YB 5CIPH 1OARL 4XNMA 1OP9A 4ODBD 4PJAF 5JOFA 4OCYH 3OKMA 3NH7H 5EZIH 2FEDC 5HHOE 5JPNA 4HDIA 4X5LA 5JW4R 4NOFA 2DWDB 4YHOH 4QHUA 1DFBH 4LHUA 1ZHNA 3QEQE 4TRPH 1LO3L 3RL1A 3W0WD 1U92B 2LTQB 1XGTB 1K8DA 2IG2L 1LO2L 2V7NB 4JY5L 4OF6A 1KIQB 4XP1L 4EN3A 4ZS7H 3T3MF 4C55A 1YY8A 1S7SB 2EH7L 2NCMA 3G9VA 2FO1A 4YK4C 4LVNB 1GCFA 1SMAA 1ZGLM 1EXUA 4QRPD 3BT2H 1REIA 3HN3A 4QRRA 5I8KL 3ULVE 5IMMB 4W81A 3DI3B 2FJFA 2MOVA 1X5LA 3FB6B 5TQ0H 4HAFA 5IBTL 5KTEL 1KG0B 3O41B 1AXTH 3EDEA 1RJCA 3G5VA 4RBPH 3MV9D 3MR9B 5IBUB 5F3BB 5HI3C 3A0OA 3VD3A 5FYKL 4FQHB 2FDBP 3MREB 5C71A 1BOGA 2VLRD 4E41A 4ONOA 3NPSB 3ZTNL 2PO6D 1YN6B 3QFJA 3D3VA 3QA3B 4P4RB 2XOTA 3TT1L 3KHOA 4OGYH 1H3PL 1NGZA 1QLEH 2WQRA 4G7YH 1XF5A 1V7MH 3IDYC 2M2DA 2IPKB 3HRZA 4MQ7B 1OARH 4PJDF 3QFDB 3QWRD 1MJUL 2CRZA 1NANI 1XT5A 5CWSA 3CZJA 5HDBF 3MNZB 1JF6A 4WWKA 3QPXL 5FYKD 1JNLL 4MHHG 5IVXB 2RFXA 5LCVL 1BGXL 1LO3H 3EO0B 4G43B 4FXGB 3K8MA 5IHBA 4L8SB 3WYRA 4DQOL 1FO0B 1AIFA 4LEOB 1CLZL 1LO2H 2GJJA 2X4SB 3GSOB 4JY5H 3VWJC 3T0EE 1YPZE 4XP1H 1MOEA 3PWLA 2AJZB 3RNQA 5T33L 2EH7H 2HJKA 4MX7B 3S36L 5CJXC 5FO8B 1KJVA 3DLQR 4XP5L 4OF7A 1CFQB 4XNQA 5I8KH 2DI7A 5DK2A 1HYSD 5I75B 4WW2B 5DO2C 5E24E 3Q5OA 3TBWB 1BREA 5JW4N 1A7RL 4KJQC 2BOBB 2O5YL 3OKYA 2VXTL 2GJ6B 2UV3A 3MRJB 4WEBL 1W72H 4Y19A 5IBTH 5KTEH 5DJYA 1G0YR 2R1YB 3NIDE 2ZKHL 3WFEL 4ODSL 4M7LT 3BWUC 4HD9A 4RMVA 1DQML 2GUOB 3RWCB 3VXRE 2OJEB 4Y4FD 4P5KA 5FM5O 4YDLC 2PXYB 4PRNA 3ZTNH 4LLWB 4XNZB 4U1IB 3LKPA 3QEHB 5DJAB 3TT1H 4IJ3C 4QRRD 2VDRL 3SPVA 4ELMF 1QR1B 5I8OL 5E5RB 2Q76A 5F6IB 4KRPB 1MJUH 1OGTB 4PREB 4Y4KB 5EUKA 5F7NC 2EDTA 2EXWD 1E4KC 4HFWA 4OT1L 3QPXH 3RRQA 1JNLH 3M8OL 1NFIB 5LCVH 2Q6WA 1DL7L 5DJZA 1BGXH 2HVKB 5IB3B 3SKNA 3T2NL 4DQOH 2W92A 1CLZH 3LEYL 3CPLB 4OD3L 3TA3C 1IGTA 4L3EE 4YNYA 1CDHA 1PW3A 2BSSB 5DRZA 5T33H 1RV6X 3BPCB 3S36H 3VXOA 3F8UB 2JCCA 4HG4K 3LSOA 4XP5H 1F4YL 5F7HA 3DVNA 1T89C 4U1KB 1P7QA 5F7MC 3BWAA 2PO6C 2FYYA 5TDPB 2NXZC 3GGWA 5EU4A 5FYLE 2F53A 1MPAL 5CZXD 5IG7B 4DZBB 1A7RH 4GRWE 4Y5XC 2O5YH 3BP5B 3EYOA 2VXTH 5ENWB 3VFPB 2WMPA 5I17A 1NFDF 4P23B 4P2QD 4WEBH 3OR6B 2ADJB 2QV2A 4WY7L 1JFQL 2YWYA 5HY9B 2ZKHH 3WFEH 4ODSH 1CGSL 1DQMH 4NT6B 4WIQA 5A2JH 2M8XA 4OV5A 1PFCA 4TYUA 5E8PA 5K9KA 3MO1A 1F45A 3MOQA 3BVNA 1Q9KB 3U83A 1JF1B 5FF6A 2F19L 2Z35A 1KTRL 2Z4QA 5GGVL 2VN4A 3QNZA 1OGAE 4M62L 4YPGB 5GRYA 2VDRH 3S3SA 1HQRA 2AJUL 4X80L 5I8OH 1YY9D 3DIFB 4EOWL 4GLRI 1G1YA 4R2GD 5CD3A 5BJTB 3B9KB 3V5KA 1RZGB 3FQUA 5CIPB 4W4OC 4G6KL 3B5GA 1HYSC 1AJ7L 4OT1H 3KYMA 3ZZ1A 5FV1L 2HRLA 4LGRB 5HHNA 4J4PD 1BQHA 2VISA 5C2UB 5IIEB 3M8OH 3OHXA 4QHLB 1DL7H 4DCQA 1IAIM 5DRXB 1D9KC 3H42L 2DRUA 1TQBC 3T2NH 4U3XA 5F72S 4G6AD 3RX8A 3LEYH 3LOWA 4OD3H 1EHLL 2R2HA 5E8EB 3FFCB 4ISVA 2X4QB 4OGXL 1NKRA 4LQ1A 4Y4FC 4HXBL 4P3WA 2OSLA 1YDPB 5BVJA 2YC1B 1F4YH 3OGOE 4UOJA 3ZHDA 4LSRL 3FRPA 4MNQA 1FIEA 1S7RB 1ZHKB 2YPVL 2A73B 1MPAH 5B38B 4PJ7F 4Q2ZA 4ZNEE 3EDFA 3LKQB 1X5KA 3OB0K 3ZKMC 5CJBA 3ZE1E 4WY7H 1JFQH 1LP9B 3QUMB 4BKLA 1CICD 1CGSH 3BMVA 3MRNA 5KVMC 1FH5L 4ZXBC 3T77A 2EXWC 4KDWA 4MDIB 1D5XB 1BJ8A 2BNRA 4NQCE 4UQ3A 4Y16C 4Y5YC 3V0VA 3AXLA 4TVPE 1IM9A 3IGAB 1LILA 1WIUA 4O58L 1HKFA 1ZSDB 5C09A 2F19H 4XVJL 1XCQB 3UJIL 5GGVH 4HWEL 4ZFFB 4PJFF 2FZ3A 1P7QD 3W0WB 3LN4A 5JIKA 4M62H 4AIZA 2AJUH 4X80H 4PP1C 2EDRA 2HTKD 4EOWH 3BXNB 2CR6A 1GOHA 1NMBL 2B20A 3P9MA 3ELAT 4JKPL 3D18B 4S1RL 1HILA 4G6KH 3WN5A 1AJ7H 4JQVC 4ZNCD 5CZVL 3DXAB 2AVGA 5CZXC 5HHOA 1I1CA 4BFBD 3CSPA 3IJYB 2E7CA 4Y1AB 3SKMB 1W8NA 2YSSA 3H42H 3W2DL 4LCCB 3KPTA 4HWBA 4YXHL 4CNIA 5SWSA 2CLVB 1J18A 3DV6B 1UZ6E 1EHLH 3UXFA 1VESA 2E6PA 3FT2A 4X4XB 2J8UA 4OGXH 4G5ZL 3QQNA 1JJUA 4U31A 4HXBH 5DMKA 4OZIF 1IBGL 4PJHB 4WI7A 4LSRH 1EO7A 2YPVH 4U1GB 4LVHC 4DGVL 3KDMB 4Z0XB 3VFOA 1CXLA 2RAMA 1EMTL 1B0WA 4GRLC 2XNAB 4GW5A 2V9RA 4M7JL 4MMZC 3VRJA 3GHEL 4R2GC 1ITBB 1H5BA 5CSBA 4AG4H 1TFHA 1FH5H 1W72B 3CH8A 1XR9A 2EDJA 3I75A 4JFDB 5L0QC 5EN2A 32C2B 1KC5L 4J4PC 3DURB 4JFQB 1BQUA 4Z18A 4O58H 1MLCB 4I4WA 4XVJH 3UJIH 5D5MA 4HWEH 4PLJD 3IAGC 3F7VB 3SGKC 3MSPA 1LO5B 1UXSA 5SWZE 3NCFB 1CE6B 4A6YB 1MLBB 2YD5A 3VH8A 2I27N 4I9WE 1NMBH 4KC3B 5CZKA 4JKPH 4S1RH 3PWUB 1CDIA 3O2VL 2PF6A 1PKQA 4OLZH 5CZVH 5CJOH 2J88L 2CJUL 5C0JA 1Z9SA 5CLTA 4XNMB 3QUXA 2B1AL 4LMQI 5CFHA 5JOFB 4R3SA 3C9NA 3OKMB 4UT7L 1VFBA 3W2DH 2BNRD 4YXHH 5JPNB 1LD9A 4HDIB 4YH6A 5D7LA 4HWBL 3H0TA 4QHUB 3B9VA 4LHUB 1CICC 3AREA 4K55A 5JOPE 1ZHNB 2ZNWA 4WVRA 2D7OA 4W6WB 1RUKL 1VERA 1T6WA 4G5ZH 3RL1B 1K8DB 4H25A 3QJHA 4X6DF 2D0GA 1MNUL 4M4RA 4EN3B 3MRMA 1JHKL 4QNPE 1YY8B 4DGVH 1LE9A 1GIGL 3KXFA 2NY1D 1EXUB 2H2SD 5IF0A 1EMTH 1RZKC 3JV5A 4QRRB 5GS0L 2HTKC 4GRMA 3BP6A 1WFNA 25C8L 3D5OF 4M7JH 3GHEH 2AK4A 5SWSD 2X44D 5E2VL 2FJFB 5C0BD 4OGZA 3VXRA 1KC5H 3ZKNC 4YHLL 5C86A 3G5VB 1EV2E 3BHBA 3MUHL 5DQ9A 5FO7A 3NIGE 1AGEA 3RX5A 2VIRA 2RCSL 5GGTL 4NKMA 1BOGB 4E41B 1XEDA 5JUEL 3QFJB 3D3VB 5GS0D 2DMKA 5E1AA 5AAWA 4N0CC 2Q8AL 4HUVA 2OP4L 5FEBA 1NGZB 3O2VH 1PG7L 2B2XL 3ARRA 1XF5B 3KPPA 4N1CA 1EEZA 2CJUH 3ZHKA 1KCLA 3HRZB 2B1AH 1M4KA 4UT7H 3C60D 3KPMA 1TETL 3F6LA 5CWSB 5DMJB 2C3XA 4HWBH 2V7HA 4WWKB 4G59A 4JKMA 5T3XL 2BMKA 2RFXB 2WWKO 1RUKH 1QSZA 2B5IC 4XCEA 4JM2C 3VGAC 1AIFB 4NRXA 5I9QC 1J12A 3QDHA 2YA0A 1MNUH 1ZOXA 1JHKH 3PWLB 4XP4L 3V6OC 2D2OA 2HJKB 3TN0D 3TZVC 2JJWA 2MKWA 1GIGH 1KJVB 1N26A 1G9NC 2X4UA 5IQ9A 4AQ1B 2HH0L 4BJLA 4XNQB 1VEOA 2R56L 1IKFL 5GS0H 1YPZF 2P7TA 5DK2B 25C8H 1TVDA 2OR8A 5DMIH 2AEWA 5C6WH 1CD0A 1NDGA 5E2VH 1Z9OA 5T3XD 2QSTA 1QOKA 3ARED 1KLFA 4Y19B 5DJYB 4YHLH 1FFRA 2OLDA 4OCRL 2AERT 5D7IF 1AQDA 2XKSA 3QYCA 1I85C 1HNGA 4CRPA 2RCSH 3AU1A 5GGTH 3UTSE 1J88A 4P5KB 5I30L 2F5BL 4KV5E 4PRNB 1EAJA 3NIDF 5FYJU 1VEPA 3KXFD 3V79C 1T83A 4PJCE<