4E0RA

Structure of the chicken mhc class i molecule bf2*0401
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
272
structure length
272
Chain Sequence
ELHTLRYIRTAMTDPGPGQPWFVTVGYVDGELFVHYNSTARRYVPRTEWIAANTDQQYWDGQTQIGQLNEQINRENLGIRQRRYNQTGGSHTVQWMFGCDILEDGTIRGYRQSAYDGRDFIALDKDMKTFTAAVPEAVPTKRKWEEESEPERWKNYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIEAQPGDGDKYQCRVEHASLPQPGLYSWKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I alpha chain 2
publication title Narrow Groove and Restricted Anchors of MHC Class I Molecule BF2*0401 Plus Peptide Transporter Restriction Can Explain Disease Susceptibility of B4 Chickens.
pubmed doi rcsb
source organism Gallus gallus
total genus 73
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e0rA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4e0rA01
5HD8D 3L3GA 4ISVA 3FQUA 3T4YB 1IC5H 4UNUA 4WO4B 1WZKA 3U4AA 1A7PH 1HEZA 3B9EA 5AG9A 1U36A 1J1XL 5FF6A 2VZTA 4TN9A 1PSKL 2PR4L 4P2QE 4UV7H 1J8KA 2J88H 4Z78B 5I15L 1FGNL 3BP4B 1J0YA 5I9QC 2R1XA 4H5SB 4POUB 4ZODA 3HCVB 1JPFA 3FRUA 3MRLA 1A2YA 3DI2B 3C6SA 4UUJB 3TPUE 5CGTA 3AREB 2NY5L 4N0UE 2CUMA 3QNXA 2HWZL 3C5SA 4OIIH 4G8GA 3WLBA 4FG6D 3EYQD 1R24B 1D5XB 1JYXA 1UGNA 1F3JA 5CEZE 2AKRB 3BE1L 4XBEL 3DIFB 3DUUA 3S5LB 4XMKH 5HHOA 3ULVH 4OKVA 3S34H 1B3JA 3MOQA 1G6VK 5T5FL 1A4KB 1I1FA 1KACB 3KR3H 4HWEL 3MV7E 1HCVA 4L8BA 1DQLL 2CRYA 3RQ3A 3OXRB 5DHVH 5DRNA 3NZHL 2FECL 5IT2H 5F7EL 2I07B 1PG7L 1EAPB 2DF3A 4EI6A 3CFJA 3VFNB 5LXGL 4MNQE 4D0BA 4MQXD 4OI8A 2OLDA 3LS4H 1C5CH 5IVZA 2BY3A 1A3LL 3X13B 1YQ2A 2MHAB 1F8TL 1P9MA 4NC1C 1D5MA 3TN0D 5BVJA 2ITCA 4OCYH 4Q9QH 1AKJB 4JFHE 2YUXA 4WU7B 5A2IH 4PGBB 1URLA 4QRRD 4NZUL 2DQIL 3N1MC 4LVOB 4U6YB 2FB4L 4MDIB 1KCVH 1T80A 2BNQB 5DUMH 3MJGX 3QWRA 1U8QA 5CZXD 1MAML 5DHXB 3QRGL 1JZ6A 3HI1A 4A2LA 3ULUC 5KSBB 4L9DA 5FYKU 4XBGB 1X5LA 5IG7B 3T4AA 4ZDHA 1BGXH 4PJAE 4F9LC 4ZTOL 2CGRL 5KVDH 3WXWH 1MUJA 3T2NH 2B4CH 2VXVL 1VERA 2OYPA 4HMEA 4KTDH 1L7IL 5GGTL 5D7IF 5C0RH 2OL3B 3BIKA 3BPLB 4XXDA 4M4PA 1ADQL 1OW0A 2IPKA 4DTGH 1QKZL 4YXKH 4LSPH 5JHLH 2I9LA 2UYLB 2VDOL 3HZYA 3TC9A 5T3ZH 4R6UA 4LEOA 5D1ZB 4PJ8A 5GJSH 2H2SC 2Z91A 4GT7A 1IQWH 1XR9A 3BRFA 4QHNA 3X14A 5HSFA 3I9GL 4HFWA 4K9EH 1U58A 4JRXB 1XF4A 1BQLL 1IAIL 3C2AL 5CJ8A 3G6JA 4O5LH 3E8UH 2IAMA 2CDFB 3ZDYE 5IOPB 1RZIB 4P5TD 3PJSA 1JN6B 1QTYT 1KJMB 3QUYB 2VXSL 4LHQB 1KENH 1OAUL 4R4FL 5DJZA 4RNRB 4PTUA 4JO2L 3U7YH 4B7LA 1ZA6A 3HRPA 3MODH 4JLRA 3RWGA 5GS0C 1T3FA 2ZG1A 3HZVB 1QLEH 5I8KH 4HPYH 2DQEL 2P8LB 2APBA 4K23L 2X4QB 3EZ8A 3PABA 4JN1L 4LASH 4X6DE 3O2VL 4F3FA 3G08B 3VWJD 4MDJB 4R96B 4W6YB 3U4BL 2X4PA 4F8QA 3G04B 1KLGA 4PGEB 3VXQA 5F3HB 5JIPA 2DWEA 3L1OH 3QQ3A 2Z35A 4ZSOE 4XCEA 25C8L 3EJZC 3FQXA 5J9PA 1W0VA 3RBSA 2WWKT 4YHYB 1XGYH 5DQJA 4XMPL 4XCYB 2V2WA 4UNVA 3E6FA 1M7IA 1MLBB 5FECB 5I1GH 1JVKA 1FVDA 4C56B 4GXUN 5JW4M 3UO1H 3WHE1 1MRDH 1C12A 4JFZL 5F97E 3CLFL 1N59B 4JO1L 5L2KB 1T4KA 3BFOA 3ZDZE 1MLCA 1DEEB 2LVEA 2CIIA 4QTIL 1OP3K 1CDIA 3O3BB 4M43L 4NHCL 1XF3B 4FQCH 4HV8B 5F70A 3DO7A 3UTTA 4PUBH 5HDOA 1O7SA 2EYSA 3JUYA 4NN5C 4OV5B 3W5MA 1UJTA 2DOCA 1S9KC 5DRZA 3VFTB 3DYOA 1AD9B 2F53E 2H3NB 4G6MH 2Z31A 2UVEA 2BY2A 1NCWL 2CLRA 1U93A 4G9FE 4LLYB 3HFMH 4Y19D 1X5JA 1I3RB 3IFOB 5D7JD 3NTCL 5ABDE 1UWEL 2DLEA 2BOCA 3N06B 1CICC 4PJ5B 2GT9A 1ZXQA 5E2TH 1IC5L 3DX8A 4U1SB 1F4YL 3UTZB 4KI1A 4ORZC 5C08A 1XGUB 1JUFA 4P9HL 3HC3L 5BRZA 3QEQE 2NMSA 5IVXF 4R26H 5KSAC 5TFSH 4PRIA 1A9EA 4FZ8H 4U1LA 5LBSH 2AXFA 2IALB 3ULSA 1YEKL 1T04B 3VJ6B 4H26A 1ZS8B 1Q1JL 4NZJA 2MQ3A 1U92A 4JRYD 2JJWA 4P2OA 4TRPH 4M03A 5F1NB 4DGIL 2ESVD 4N9GA 2JJTA 1DL7H 4XCNA 5D2NC 5IFHH 3D2UA 1G9NL 3BZ4A 1RQ5A 5DJYB 2PTTA 4ZAKB 3QO0A 4OLYH 1ZGLB 2VDQL 1AGBB 4KTEH 3WCYA 3UTQB 3V0WH 2CLVA 5LGHL 2R4RH 4XVJL 1PZ5B 4FFYL 4NQED 1Q9LA 2VDML 4GRLD 3B2UD 4AENB 2NY2B 3CFCH 2BJML 2BVEA 2FJHB 15C8H 1AGFA 3RRQA 1SEBA 1UG9A 1AIFA 3LQAL 4BKLB 5FUCE 4AMKL 4NJ9L 3SJVD 4N1EA 4F7EA 3DGCR 5FO7A 3MRRB 5HGBA 4NO0A 1KG0B 3W11D 4WEMB 5D2LB 2OTUA 3IFPB 5IEKB 1UEMA 2H32B 3QUXD 3ZKMC 3BP7B 1OM3H 4NQCD 1J18A 4N8VA 3BW9B 1JWUA 4IRJC 5C2BL 1QHPA 1IGIL 4IOSD 1S5HB 4FFEX 5E4EC 4MS8C 4ODHL 3TT1L 4JM2A 2COQA 4XVTL 2E3VA 3FFDA 4Z7UA 2M8XA 1FYTD 1I8IA 1MFDH 1TXKA 3O3AA 1DLHB 3ET9F 2MCPH 2NX5B 3DYPA 5IEHA 4TYUA 1D5ZA 2B1HH 1U95B 2ZUQB 4KTDL 4W4OC 5DS8A 1U8JB 3CDFA 4OFIA 3MV9B 1OGAB 5FM5M 3H9HA 3IJHA 1YMME 4FXGB 3R1GH 4J8RB 2JB5L 2G2RA 1UCBH 2VZUA 5F6IB 4YR6A 2LE9A 3BD5A 4M8QA 4Z5RB 2DM7A 3VW3L 1G7LA 4OLZH 2BNRA 3BJ91 5DA0B 2WZPD 1ZTXL 4GJTB 5B39B 2JIXB 3H7BB 1Q9WB 4UV4H 5GJSL 4KMQA 4PJBA 1N5AA 4HUXB 3MCLL 5BS0D 3DVNA 1JPGA 2GYSA 4L3EA 2P8PB 4J1UB 4K9EL 4MAUH 3OJDB 4MA8L 5IBUB 1XZ0A 3E8UL 4ZO8A 2X1OA 5BO1H 1FFRA 5C09B 2CRMA 3F7YA 4CN1A 3EGSB 4HS3A 3TT3H 1A7OH 2IMMA 2M1KA 1FH5L 5IR1B 2ADFL 5TDNA 4MD0B 5ITFA 4S2SA 3RTQC 5EU6E 1BX2B 3V5KB 5ID0A 1FVEA 1OGTB 4LKXA 1NGXB 1WIUA 2BFVL 1OT2A 3O4OB 2V7HB 3LN4B 2DQCH 4HPYL 1RJCA 2R0ZH 1JRHI 2CPCA 1X5FA 4HJGA 4YGVA 1Q0XL 1LO0H 3KLHC 4PJIA 2VXTH 4JJ5B 3IDYC 4TVPE 1X6LA 2R0WH 4UMGA 4I3SL 4F9PA 3SGEI 1ITCA 1EO8H 2BVPA 3RJQB 4PYGA 5T1DL 3L1OL 3LKQB 4G8EB 3OJMB 5A1AA 3ILPA 1U3HC 4OZGA 4XNYL 3NPZB 7FABL 2DMBA 2DB8A 5EO9B 5E1AB 2R0LL 3S5LG 5D5MB 2YD8A 2YOCA 3AXLB 2Y7QA 4HIJA 1NUGA 5DK3A 3HPLA 4KHXH 4TNWF 5F88A 4E42A 2JJUA 4IRSD 4JFQA 4UT7L 4S0SD 1ZLVH 3VH8B 1AD0A 2CO7B 3UO1L 4LLQA 1CR9H 4WFGE 1T0NA 3EYVA 5H35A 4K7FA 4ZS7L 5GRVL 3U7AA 3V6OE 1H5BC 4P2RA 3ARDD 3G6AA 5F44A 4S11A 4RQQA 5TF1L 5LGJA 4WWKA 1J10A 4XVUD 2M2DA 1BMGA 4WHTA 5CEZL 3D39A 3D3VD 2F5BL 1RK0A 1F4XH 4N8PA 3MV8D 3SDCB 4I2XA 5E8EB 5ERWA 2DM3A 1ZLUH 3GJFH 3WFBH 1ZAGA 1J0HA 2EE3A 1OVZA 1RJZA 3RVVD 4RFEA 5EIVA 3ARYA 2Y6SD 3PG2A 3RWFA 1A7NH 5ACZA 2AJYH 3G6JF 3BP6B 1TMCB 2YPKA 4JFDD 5ADOH 4X9IA 2IFFL 1EX0A 3DECA 4U6XB 4CJ0A 4OKDA 3LN5B 1BIIA 1QR1A 1OWWA 1A0QH 4OZHB 4F33A 4ONGL 5GGSA 4X5XB 4PJDB 3O4LA 5I1AA 3MRBB 3SDDD 4APQA 3V7AE 2OI9A 4M6OH 1KLUA 3MGOB 1GZQA 5FKPA 3LEYH 1RMFL 2DIAA 1FG2B 3EOBA 2R39A 4ZXBA 2E5EA 4J4PC 1S7RA 3Q5OA 2W65A 4LIQE 2CRIA 3NN8A 3MA9H 1QSED 4TUJA 3F65A 3KLDA 4Q58C 5IFHL 1SJVA 3PP3H 4KRPB 5I1LA 4UOJA 3GFUA 3TESA 4OLYL 3R06B 3MLYH 1A3RH 1G0XA 5HYJD 1NCBH 1VGKA 1MCFA 2I24N 4K3JH 1T21A 4O58H 3T0WA 3DURB 3MOAL 4M48H 1T6WA 3CFCL 2C1OB 4M6MH 3E2HC 5EOCL 1G84A 1S5IH 3HE6D 2AV7B 3QXTA 4MJ5A 5DTFA 3T77A 4MD5A 1JGUL 1Z0NA 5J11C 4MNHA 1A6AB 1M7DB 3A6CL 4OD3H 4YDVB 4RBPH 1RJLA 2GI7A 4F80A 3T4YA 3B3IB 3X12B 1J8HD 3MZTA 3FFCD 1UZ8A 4XP1H 3QXVA 3BMVA 1IAOB 3VE0B 3P30H 4OUOA 1KYOK 3VCLB 4Z78A 4RZCB 5JW3L 3BP4A 3HCVA 2EEDA 4Y4FB 1CXHA 4E0RB 4A6YL 4UUJA 1NMAL 4AQOA 2BSTB 3O45B 3AREA 1JHLL 4M7ZC 1OTTC 4TSBL 4XMLH 3ULVD 3KPSB 2BCKB 5E08H 4YHZL 3V4VL 5D71L 2Y07L 3OG6B 1R24A 1D5XA 5DD3H 2AKRA 3DIFA 1NCAH 3S5LA 3FRPG 2GJ6B 4LSUH 4H0IA 4RMTA 4NHUE 2FX8L 2YMXL 4NN6C 1ORSB 2EH8L 1A4KA 2HTLD 5T3XH 5E8NB 5D1QB 2BY1A 3TBTB 4LGPB 3EYSH 3LQMA 2I07A 4LHUG 1EAPA 4OFPA 3VFNA 5E4IA 1SEQL 3KS0J 4LU5H 5DJAB 5DRWB 5DJDB 3C2SA 5EH1A 1U8PB 3BH8B 2FR4B 3GHEH 4MAUL 2MHAA 4G43B 1QVOB 3ARSA 4F57H 4AL8H 4Q7DA 1IC1A 5E2UL 3TP4A 1MCBA 1AKJA 1WC7B 3L3IB 4WU7A 43C9B 3P0VL 4PGBA 3ORJA 4M7JH 2WLZA 4YHKL 4DN4H 4FS0A 3BT2H 3EO9L 4U6YA 5GGQL 4MDIA 4UINH 3NFSL 5HYIA 4ZD3H 4WNQB 1NC2D 1TIUA 4FQPA 3MACL 3PL6C 2IGFL 3BSZL 2VDRL 2XT1B 4L5FL 1ZV5A 3W9DB 5KSBA 2HVKB 3MBED 2EC8A 4XBGA 5IG7A 1AO7D 2R0ZL 5C0BE 4JO4L 4JQIH 4HWNA 3LS5L 1FCCA 3QHFL 3W0WE 2EICA 4U3HA 3UP1A 5ISZD 3C60B 4XTRD 2ENYA 3QIUD 1Z9LA 1LNUB 3EOTH 4QRQB 5J12C 4AG4H 1IKNA 3DETD 4X7TB 1LO4H 2OL3A 3JWOL 4GAGH 1ZEAL 4PJGB 5BV7H 5T3ZD 1KTDB 1QOKA 4OZFA 2VMFA 1LK3L 3IS1X 4JM2F 2GJZB 2WBJB 3OL2A 4OFDA 1FL5A 1TETL 4PRAB 2GY7B 4Z7UF 4RDQF 2UYLA 2DQUH 4OF0A 4YH6A 3CXHJ 4PJEB 1XH3B 4Y89A 3MTRA 5F6HI 2FSEB 2E7CA 1JPST 5HVFB 4F15C 1K5NB 4JRXA 4Y1AD 5DI8B 3AMKA 4M7LH 3GNMH 1AXIB 5E24E 2CDFA 1IVLA 1M71B 5IOPA 1RZIA 1XF1A 3STLB 2WP3T 4P49A 5GRVK 1JN6A 2AK1H 2EDTA 2DLGA 2YRZA 3QR2A 5KOMC 1KJMA 2EO1A 3QUYA 3R8BB 4M00A 4PJBF 2E9IA 3GSNB 4WEBH 4L4VE 2W9EL 4BQ9A 2VR9A 4ODTL 4RNRA 1L4IA 4PJHE 3RX7A 4JFFD 2DAVA 2PYEB 5DGRA 3HZVA 1HH6B 5FIEA 2AJYL 5GRUL 2P8LA 1KN4L 1LP9E 2X4QA 4OCRH 5IROC 4NN7C 4R2GB 3SKMB 5J06A 2GK2A 4EI5B 3GIZH 4P9ML 2F58L 4MDJA 2XN9D 3VGGA 3AU1B 5DZOA 3G04A 5J3HC 5DK2B 5D7LE 4PGEA 5F3HA 3KWWB 4XC1H 5CIPB 2UWEA 1IFHL 4NZRH 4WFED 4M6OL 3CCHA 1ZANH 4XCYA 2AXJA 5SWQA 1HSBB 1MLBA 1BEYL 5FECA 4CMHC 5IP4A 3JV4B 4PJIF 4HULB 4YAQB 4CVZB 4E5XB 3DJ9A 1CU4H 5HI3C 5D1XD 1CTOA 2F8OA 1KEMH 3HNSL 4GKSB 3FN0L 4MVBC 4YK4B 1D6VL 5AYQA 2ZCHL 4OGXH 5L2KA 2VL4A 1JZ3A 1XGPA 3P11L 4ODVL 5E6ID 4PGZA 4OBSA 5AYUH 4HWZB 4G7YH 1WEJL 1DEEA 2FH8A 3FOLB 4O58L 3O3BA 2OS7A 1GGIH 5FYJE 3S6CA 1XF3A 2EDHA 2VN7A 1FLRH 4EQ2A 5C0NC 4ZPVB 4OV5A 4TSAH 1FRGL 2QQNH 3VFTA 1AD9A 1FGVL 2H3NA 3MUHL 5JHDB 3KYMB 4LLYA 4WV1B 3FQRB 5F8QC 1I3RA 4RMQA 3IFOA 4PV8B 4Z7VB 3MV8E 2UY6A 2FJFB 4PJ5A 1MIML 2KL6A 4LP4A 3BEWB 2D03H 1C16A 4U1SA 5D70H 3UTZA 5BMFH 4YWGL 4JGUA 3WNPA 1NMCB 1RIHH 2QEJA 4R97B 4KI5F 3P30L 1XGUA 3RGVB 4HK0B 4WGVB 4R8WL 1JNJA 5DJ8B 3VXUB 4EN3C 2IALA 3SOBL 4OLVL 3VJ6A 4PG9A 1KNOB 1ZS8A 3SDXB 2R56H 3ESVF 4P57A 2YRLA 3HRZB 2BSED 3RI5F 3GB7B 3WNNA 3VH8G 1XF2B 1HCFX 1A3QA 2R29L 3MRIB 5DJYA 2O5XL 4TVPL 4ZAKA 1J1PH 5DD6B 1AXTL 2D7QA 3QCUH 1ZGLA 1GOHA 3S9DB 4NCC1 4LPCA 1SMOA 2UZIL 2X5PA 1PZ5A 3O41A 4YFEA 5IHUL 1WT5A 4AENA 3D87B 2BRRL 2F5AH 2FJHA 3NZ8B 3O9WD 1Y18A 3RY6A 2OZ4L 4Y5YB 4LDOB 5LWYL 4JFED 4BKLA 3LB6C 1ZMYA 3WHE0 2X41A 5CEYB 1RUKL 4L8SB 4AM0B 2X9YA 4NQVB 3CZJA 4AL8L 3MRRA 3TEUA 1HIMH 2ARJQ 1KG0A 3QUZB 5D2LA 1OAQH 3IFPA 4QHLB 4HC1A 5IEKA 1NC4B 2X4NB 4ZD3L 4I0PD 3BP7A 2O5ZL 1P4BH 3BW9A 4ZYKB 2DD8L 4PJCE 2VZVA 3BQUD 1S5HA 1KBGL 1MHCB 2VC2L 3OJVC 3ZSTA 2YK1L 1J8HE 3IKKA 1CFNA 3MOBL 5I75B 3MGAA 1E27B 1G7PB 1DLHA 2FJGB 2A6KA 4ALAH 1NDMB 1RURL 1TPXB 2NX5A 5T5NG 1CIDA 3O8XD 4KMTL 1U95A 1FNEB 1U8JA 1FFNB 4GW5B 4PDCE 1OGAA 3K8KA 1T83A 4X4MA 4OCSH 5B8CC 2EDRA 4PRPA 4J8RA 5C0AE 3ZL4H 2ZCLH 2Y4SA 2CUIA 1BVLB 5AZEH 4Z5RA 4FQXB 1MFAH 5HHXH 4CNIB 4B7IA 4K3HA 1S7XB 5B39A 2JIXA 1FNFA 1Q9WA 3H7BA 2BNQE 5IW1B 4HUXA 4WCYH 3SO5A 4OB5L 2A38A 2P8PA 4J1UA 5F7HA 1UJ3C 3CUPB 3EHBC 3OJDA 4LIQL 1WVZA 1EUTA 1OPGL 1P4IH 1WZLA 1CWVA 4KDTC 4YHML 3EGSA 4X6BB 1P84J 1DP0A 4F2MB 3NCEB 1DQML 5IR1A 4OSUL 5T1KB 2FX9L 1ROWA 1LO3H 4KJYB 3WUWG 3K74B 4MHHG 3RA7H 1QLFB 4MD0A 1YY8B 4IBLT 1BX2A 1OAKL 3GSUB 5FM4A 3V5KA 4N0CA 1OGTA 1NGXA 3MC0A 1QG3A 2EDJA 2FL5B 3AAZB 4XAKD 1LGVA 1H3UA 2V7HA 3LN4A 4HIHB 4PBXA 4LVNC 2EO9A 2FEDD 3OPZL 4RSVA 4GKNB 4G3YL 1OARH 4L9LB 5T33L 4JJ5A 3S37H 4NM4L 3NCYS 4MAYB 2QADB 3O11B 1IRAY 5C0DB 1GCFA 1IC4H 3EDJA 4Q6IB 1GJIA 1UM4H 4OT1H 2V5SA 1PEZA 3F6LA 3NACH 1DANT 1I9IL 2ZWLT 4K94C 2G5BB 5KSBF 1I85A 5E1AA 1TCRB 1V05A 1ZANL 2J7LA 5D5MA 5JUEH 2EDEA 2KKQA 3AXLA 4YPGB 5I17B 1GGCH 3Q6GH 5AZ2L 4DJMA 4FFWC 2BRQA 3HS0B 3VH8A 2B5IC 2KQMA 3HE7D 4QLRA 4ODWB 4NQXA 2AVGA 3MLSH 3MLVH 4FFVC 1WAAF 3GRWL 1MJ7H 3ALXA 5IMMB 4H8WC 3K3QA 1R0AL 3EO0B 4XNXL 2CD0A 3RVUC 4JQXA 4X6CF 5GGVL 1OP5H 5ID1B 2HTKC 3SDCA 5IM7B 4NGHH 4RX4A 5E8EA 1INEH 2ZJSH 1ZGLM 1DQDL 1YNKH 4Y1AE 4X4XB 2P7TA 2W0PA 4Y16C 1TDQA 1CVRA 2YA1A 3LPWA 1UADC 1MCSA 3BP6A 1TMCA 3H3BC 1RAMA 1MPAH 3B43A 4U2ZA 2DRUA 3A67L 4U6XA 5I9QB 3T0EB 3WIHA 4C56E 5K33A 5C07E 4G8GD 3LN5A 3U9PL 2AEIT 3MRPA 4MXQA 2AJZB 2R23B 4OZHA 2R69L 4H0HB 3M07A 1MJ8L 2HMIC 4X5XA 4PJDA 3MRBA 4FTVE 5FHAH 3GJEB 2X4RB 3MGOA 4YFLF 3QEGL 3CU7A 3A6BL 4N8CL 8FABB 1FG2A 4CAGA 4NQDA 4CN4A 2AEPL 5EG6C 3K46A 1UB6A 4O51B 2CKBB 2D0GA 1UT9A 3DSFL 4JZNB 3GGWB 4YBLC 2HT3C 4HH9B 1A7RH 1EUUA 2UWEF 3JV0A 1B2WH 3R06A 3WLWD 4XVSL 2DKMA 3FCTB 4JG0L 2VLME 4PG2A 2IFGA 3T1FB 3LPFA 3MBXL 1RV6X 5MEQB 2C1OA 5K59E 1WICA 3BWAB 3BIBX 3WDJA 3QWRD 4YE4H 1ACYH 2AV7A 5HGAB 3TWCL 1AR1C 3MXWL 5MERB 5FA4B 5LVEA 2XV6B 1TFHA 1A6AA 1FBIH 1M7DA 3TFKD 2X1XR 3KAAA 4YDVA 2DLTA 5T1LB 2AEQL 5ICZB 3KHOA 2BZDA 5ITBL 3B3IA 2L4OA 3X12A 5EZOH 5M95B 2E27L 3RVTC 5FGBC 4OM1L 1CDJA 1IAOA 3VE0A 2YN5A 2OXHA 2K1MA 5DEGB 5EDXA 3VCLA 2PW1B 4GG6B 4RZCA 4HCRL 4G6FD 4Y4FA 4E0RA 2W0FB 2BSTA 3O45A 2OL3H 2ZP0T 2BCKA 1JZ5A 1IGML 4QHUB 1V3JA 5T3XD 3TO4A 1ONQB 4OZFH 4PJ8D 4CBPA 5HD8C 4YDLC 5DZNA 3C8KB 4A2MA 3ILQD 4LSQL 2Y23A 4CRPA 3GMOB 1QSVA 4CL7A 5C86A 2GJ6A 1P7QB 1UH2A 3MUZ1 1ORSA 5TE4L 2IAMD 5GRXG 5E8NA 2CIKB 5D1QA 5J1SC 2YPLB 1AGDB 1HZHH 1ZE3C 1BAFH 3TBTA 1DE4A 1INQB 2P5WB 3QQ9D 5L6YH 1FLTX 1KB9K 2XIDA 4JM4L 2DQJL 2ADIB 5DRWA 2V9TA 2K7PA 2R2CA 5DJDA 1U8PA 3BH8A 2X1PA 2YZ1A 5CJOL 4G43A 4FG6C 3EYQC 2QQLH 4UIKH 1NJ9B 1U8HB 5FUOL 2AEWA 3ZE0F 43C9A 1KULA 1IGFL 1RZJL 1N7ML 3HC4H 5D8JL 1JZ2A 3WO4C 1RZKL 1W72L 2CLZB 3TV3L 4OLUH 4JPWH 4WNQA 5FYJL 2D2OA 5IB4B 5H37G 3MV9E 5I1CL 2AJXH 3SE3C 5JDSB 2E7LA 3W9DA 1JGLL 3FO0L 5HYQB 4MQXC 2HVKA 5L2JB 1H3XA 2XZQH 4JG1H 3UBXA 5D2LF 4MA1C 1HHGB 4U6VH 4RCAA 3TN0C 3C60A 4QOKB 1U8NB 4AEEA 1KOAA 4RAUB 1QBLL 1LNUA 4QRQA 3KLAB 4X7TA 1IBGL 3UPCA 3HI5H 1CFVL 1H8NA 1KTDA 3H9YA 2GJZA 2WBJA 1MCKA 4FQ2L 5C09E 5CZXC 1U6AL 1SQ2N 2D0FA 3MJ7B 4PRAA 43CAA 5I6XB 4R3SB 3LHPH 2W38A 4PJEA 1XH3A 1GGYA 2FSEA 3D5OF 3LDBB 2Z31D 3GKWH 1PKQB 1K5NA 5DI8A 2X4TB 2YXMA 1AFVH 2WMPA 3VG0H 4JAMA 1A14L 1M71A 4GRWE 4JHBA 3STLA 4JB9H 2VLJD 2GSIB 2ZUTA 5HDLA 3IFNH 3BD4A 3FB8B 5J0BA 1EIBA 2LVCA 2X7LB 5C08D 1L0XA 3GSNA 1NCNA 3QXAB 3UCRA 2VQ1B 1GXEA 3MRGB 3EAKA 5BRZD 5C9KA 4WUUE 4YDKL 1U8KB 1AP2B 1MFCL 4PRID 2PYEA 4BFBD 3QI9A 3IAPA 2JCCA 1Q38A 3MRMB 1OAYH 5D6DC 1JIBA 3SKMA 3VXTB 5KANI 1ZT7B 3OX8A 3VI3E 5DMGD 4EI5A 3I6KB 4P2OD 4KQ4H 5J6HB 3REVB 1D5IL 3AY4C 3KPRA 3AU1A 2CR6A 5I30L 5EO1A 2DMKA 3M8OH 5DK2A 3KPTA 4XAKE 3VI4E 3D2UD 4P5TC 1MCQA 4Q0XH 1F6FB 3KWWA 3LPGA 5CIPA 3JVGA 3QEHB 4HXAH 2WWMD 4HWBL 2ZSVA 3H3KA 5IK3B 1NPUA 3NBNA 1UZ6F 35C8H 5DR5H 1DQTA 4WFHD 4IEFB 1HSBA 4Y2DB 3BZEA 3JV4A 5CFHA 4WHYG 4E5XA 2QTEA 1ZK9A 4GKSA 4J3UA 3WJLC 1UH3A 3HUJF 1H3GA 5J13C 3VWJC 1KXQE 3WS6A 4EXKA 4G59A 4PV9B 3NA9L 4WTWA 1D6EB 1H3TA 4NQTA 4HWZA 4NO0D 4ZFOB 4QRPE 1H8OA 3FOLA 4DFIA 1G6RL 3AFLA 1A6PA 4NM8L 4ODXB 4NWTL 4QRSB 1I9JH 4ZPVA 4HHAB 3QDME 2FDBP 4X6EB 1S3KL 4Q9RH 2Y06H 5JHDA 3KYMA 2AABH 4M6AA 5EIQA 3GO1L 4WV1A 3EBAA 1WCQA 2V5TA 3FQRA 4HC1H 1KIRB 4PV8A 4EDWH 4JM2D 4Z7VA 2OM5A 2FJFA 3O6MH 3OAUL 3H2WA 4TUKH 4E41B 5HYFA 3BEWA 3GSQB 1INDL 5E4EB 5EC2B 4IS6B 3KPNB 2DS4A 3DX9B 3QCTH 3GI8H 3TYGH 3RGVA 3LD8C 5B3JE 2WUBH 1F4HA 1KC5L 4HK0A 4HQQH 3V9FA 3RNQB 4ZUSB 3SPVB 2XTJE 1QRNB 3S97C 3KLSA 3CFIC 4XPGH 5DJ8A 4S1DD 4OCMC 3PF2A 1A6UL 1KNOA 2HG5B 4HF5H 4BZ2L 3GM8A 4OAWB 5MEPB 2BNRD 3TJEH 3HRZA 3JV6B 5DXWA 3RKDD 3F7PC 5D7JC 2GCYB 1P6FA 2VZSA 3STZB 4OD1L 4HIXL 3GB7A 4KRLB 4L3ED 4PJDF 1IEBA 1X4YA 3MRIA 3KJ4C 1BZ9A 2APWA 1OP9A 5MEOB 1DBBL 1FDLH 4RWYL 5I71C 1J0ZA 3QDAA 5JW4Q 3S35H 5ELIA 5T5NF 5K9JL 1QA9B 5EU3B 3I6LD 2Q6WB 4AYFA 5MP6H 2YSSB 3MJ6A 3NZ8A 4P3CH 4XP6L 2VLKB 4AY0A 1HWHB 3ZT5A 3EKCA 4Y5YA 2BDNH 1TTFA 2SEBB 2ATKB 4WU5B 4WTZA 5CEYA 1EEUA 1DUYB 4L8SA 4AM0A 4PP2B 3UZEA 2ATPB 4NQVA 4RAHA 5F96H 5B4MD 3QUZA 2C3XA 3OWEA 4WY7L 4LVHC 5EUOE 3CXDL 2ICCA 2VWEC 3I2CL 3KPSE 3EUUA 2PN5A 2J8UB 4JKPL 1NC4A 2X4NA 1QSFE 4B50A 4GRLC 3B2UC 4ZYKA 5CZVL 4U1KA 4CADB 5GRJH 1DCLA 4Y4HB 4DVRH 4DKFH 1VPOH 3TF7C 5DT1L 1C1EH 5TQ0L 2EYRB 2KPNA 1E27A 2OTWB 3TA3B 2G60L 1JL8A 5DMJB 1NDMA 2EDNA 5IB3B 4TTGA 2VLRB 3W11C 1DJSA 1FNEA 3CSPA 1FFNA 4GW5A 4M9PA 4P2RD 1A47A 4PJ9B 1BM3L 1G9MH 1VGEL 4WWKD 1GC1H 3CDCA 2GK0A 1JNHB 1JZ7A 2PTVA 3QUXC 4Z8FH 3D39D 1BVLA 4FQLH 1TITA 4UILH 4FQXA 3LHPL 4CNIA 1UENA 1HKLL 3BI9X 2VDKL 1S7XA 2O61B 4KI5D 5IFJB 5IW1A 1CBVH 1YPZB 5J4MA 3WKMH 3CUPA 1JMXA 3VFOB 2VO5A 4I3RL 1MAJA 1WFTA 3FTGA 3UTPD 1RUMH 4RMRA 4X6BA 4F2MA 2P8MB 4OZIB 1ZHLB 5T1KA 2XKUA 1D9KB 4KJYA 1REIA 1QLFA 4NUGH 1YY8A 2QSTA 3O4LD 5JO5B 1OAXH 3GSUA 4YQXL 5I1EL 4J6RL 3WIHH 4APQD 4O02L 2FL5A 3AAZA 1VKXB 1NFIB 3SDAB 3OZ9H 4PJGE 4XPFH 3DRTB 4HIHA 2OJEB 5BQ7B 2HJFB 5JPNB 1GGBL 4K3GA 5F7YC 4ZXBD 3HMXA 4GKNA 4H88H 4L9LA 2WIMA 5JIHA 1CDBA 4MAYA 3O11A 4FFZH 1BFVH 5INCA 5CILH 4HJJH 1MF2H 3OAZK 5C0DA 3A0OA 1BF2A 3CLEH 3C08L 4O2EB 4P4KB 4Q6IA 3ZHLA 4QWWD 1OAZL 5FYJU 4I18C 2G5BA 4R4BB 3AB0B 1TCRA 3LRSB 5HPOA 4YPGA 2R2HB 5I17A 1P2CB 4HFUH 4K3DH 4OBRA 5C0IB 2A83B 3S37X 3ZKXB 3HS0A 1SM3L 4HKJA 1T1ZB 3RIAF 1YECH 4NNPL 4ODWA 4MNGE 3KDMB 4LMQE 3LZFH 2Q76B 1DBJH 3GM0A 5C0CB 1RZ7H 3MMEB 5FK9B 3PDOB 1DQJB 5IMMA 4BM7A 3EO0A 5I19L 4MLSA 1FV1B 4PS4L 4GXUM 4N9OB 4U1HB 5ID1A 4JY5L 3SCMA 2AK4B 1I9JL 3K7UA 4TPRL 4OUUB 3IS0X 2XWBB 4Z7OF 2VZ3A 4X4XA 2HLAB 1FJ1B 3SBWC 4IRSC 1YJDH 4Y5XC 2IG2H 2W92A 1Q0YL 2VB5A 3NIGF 3E3QA 3OKDB 3KPMB 2VLJE 3FO9B 2QJDA 2FIRT 3ARED 4G6JH 3ARDC 5F9WC 5CUSH 3T0EA 5CP3A 4XVUC 5EO0B 5F3BB 4BSJA 1FN4B 1SBSH 2AJZA 4M7ZB 2R23A 5E8PB 1CL7H 3Q2CA 2K9UA 4WUKH 4UT9L 4AEHL 1KCLA 4ODSL 5E5MB 4P2YA 1F3DH 3GJEA 1QO3B 2JCCF 5L88H 3NPSB 4N1CA 4WVRA 4NKQB 8FABA 2XFXA 4F58H 3RVVC 3DPBA 5JNYB 2Y6SC 4HW6A 3ARZA 4O51A 4HBCL 2CKBA 4GW1B 2Q8AH 4JZNA 4UU9A 3GGWA 4HH9A 2AJSL 1EK3A 2V5YA 3FCTA 2BHUA 5FV1L 1AKJD 1MIEH 3FZUD 1EMTL 4PRBA 4D94A 1EO7A 4UNTA 3SDDC 3T1FA 4I4WB 4DK6A 4X80H 4HSQA 1NKRA 5MEQA 3HG1B 3BWAA 4HG4K 3RWHB 1HYRC 2PF6A 5B3NA 5HGAA 1AY1L 2L7UA 4DUVA 5MERA 5FA4A 1MAKA 2VDLL 3DMMB 4KHTH 1DEDA 5EOTB 4BSVB 1BBDL 3BN3B 4GKZB 5DSCB 5T1LA 2XKNB 5LCVH 4UT6H 4Z76A 2DLFL 3SDXE 3VG9C 5ICZA 2A9NL 2UZYB 3JBG7 3PWPE 1BFOB 5GJTL 3KG5A 1N26A 1A7QH 1BD2B 1NLDL 5DEGA 5BOZG 1CZ8L 2PW1A 4GG6A 1M6OB 3WNLA 3QG7H 5GRJL 5INDB 4Z7VF 1RU9L 2FBOJ 3HE6C 3FKUS 1HINH 3QXDB 5I8OL 3ESUF 4QHUA 2FGZA 3BPOC 3B5HA 1ONQA 5DMIL 2FLBT 3C8KA 3QFJE 3WUZA 1LQVA 3QUMB 4QF1B 3GMOA 1VFMA 4JRXD 4NT6A 1P7QA 4YO0B 1JV5B 3RNKB 4M93C 3ZDXF 1J5OL 1ERNA 2CIKA 4JPIB 4DWHA 2YPLA 1FSKC 4PRHB 1AGDA 4AEIH 5IB1B 3OSKA 5KG9B 5IGXL 2P5WA 3QUYD 4XZUB 3VA2C 4O2FB 3KXFA 3ZLQC 1G1CA 2ADIA 5HHME 1CBVL 1EERB 1MCPL 1EEQA 4LSTH 2J5LC 3ULVC 3CJJA 1P1ZB 3KPPB 4V1DE 2A77H 3WD5H 3CH1B 4F7CB 3THMH 3GSNH 1LVEA 1NJ9A 1U8HA 1NMBH 2EECA 4M5ZL 4Z7NE 1CD1B 1EJOH 2DBLH 4IHOB 3ZKSD 2B1AH 2CLZA 4RGNB 5SWZB 5IB4A 1FPTL 1Y6KR 1KJ2B 5HYQA 1VFAB 5L2JA 2GUOB 5CIPH 1HHGA 3LCYA 4WDIB 4MJIE 2WK2A 1L0YA 3C09B 1LK2B 1LO2H 3TH3T 4QOKA 4PGDB 4I0KA 1U8NA 2Z8VC 1YEDB 4CMHB 2W0LA 5LGKA 4RAUA 2XNAB 4LRNH 4QHKJ 4NWUH 3KLAA 4M02A 1VDGA 4JKMA 5C6PB 2R1WB 1ETZB 2ZUWA 4RFNB 1QNZH 4K3DL 5GS2H 2IQ9H 3MJ7A 4R3SA 2AS5M 2CDGB 3MBEC 1ZVSB 2LAGB 2B4CC 3DUSB 1AQDB 2YD4A 1E28B 1HN1A 4RMVA 4U0RC 3GKZA 4PJXE 1RUAH 2X4TA 4KGJA 4HUWB 1RZ7L 4XTRC 3QIUC 5HVWA 3K1DA 1FC1A 4PJ5D 5JPMB 4RGMC 2EZ0D 5EZJB 3DETC 3V7MA 2GSIA 3FB8A 3D9AH 4X9BA 1YC8A 2X7LA 4M8VA 1V7MH 3QXAA 3GMPB 4J3TA 2VQ1A 3DBXB 4MA3B 3DROB 1RHFA 1HQ4B 1U8KA 4QXGH 2OTPA 4OQTA 3WDIA 5H37H 5HXMA 4ZUWB 4JPKL 3MRMA 4G6JL 1XF5A 5DWUL 3B4NA 3RDTB 2H26B 3VRLE 5IMOB 3I6KA 4IRZL 5J6HA 1E6JL 1Y6NR 4KKNA 3MV01 3QNZB 4N5UA 1F58L 3VDAA 5IFAH 3Q3GB 4P2QB 5HBBA 2FZ3B 3LKNA 3MFFA 1CLCA 4ZAKD 1QFOA 3HLAA 3QEHA 4LLVB 1N0XH 3IXTB 2HP4A 1CF8L 4KDWA 2X42A 4Q2ZB 5IK3A 3B9DA 3B9AA 4YDJB 5E8DL 4YFLI 4Y2DA 3TPUB 3WL9B 3MSPA 4N0UB 2NY2D 4P5KB 1KYOJ 2RIKA 3UTSE 5F9JB 1AQKL 4JDZB 1TCMA 1MNUL 4UTBH 5L7XL 3IDUA 4PV9A 3VGBA 1N5YL 1QEWB 1D6EA 3VGAB 2RCSH 2XOTA 1TJHH 4ZFOA 1NAKL 5EZIL 3MV7B 5F71A 4ODXA 4GXVH 1FHGA 4OLXH 3RFZC 4QRSA 1LE5B 3PQYE 3PV6B 4HHAA 4MNQB 4X6EA 2PXYA 1JHTB 3KPLB 4CN6A 1LEIA 4LQFL 3KJ6L 5D1XC 2MPAH 4KXZH 3U46B 4UB0H 4N5EA 5CGYD 5LCVL 5SX5K 4CMMB 4E41A 4S1RL 3GSQA 5E6IC 5DVKA 5EC2A 3JWDL 4IS6A 1L7TH 2NX5D 12E8H 2CJUH 3DX9A 1FZMA 3HNVH 4ZUSA 1OGAD 3SPVA 1QRNA 3O0RL 4PRPD 4LKCB 2HG5A 2EH7L 3BD3A 4OAWA 5MEPA 4PJAB 4NC1E 3JV6A 3ZE1E 5HVHC 2JIXD 1KCSL 2DKSA 2GCYA 3STZA 1KPUB 2DQTH 4WHYH 1A1MB 3PHOB 4ZTPH 1H3PL 3OXSA 5MEOA 4LPXA 1RVFL 2DQHH 5FEBA 5ILTL 1MRFH 5K9OB 3IDJB 2Z8WC 5FAAA 1LMKA 3ULUE 2WY3A 1QA9A 1CN4A 1HI6B 5EU3A 4NJAL 2Q6WA 3EJJX 2DI7A 1IZKA 2YSSA 4WW2B 1QFUH 2EYTB 4KKLD 4XXCC 4X83A 1CGYA 2H45A 2SEBA 3CFBB 4N0CD 2ATKA 3TYFA 4WU5A 3N1FC 1C5BL 3G5YB 1EO5A 1DUYA 4PP2A 1PVHA 5J1AB 5DJXB 3BKYH 3GSNL 2HKHL 3S35X 1F4AA 4FQJL 1BWMA 3IVKB 2CMRL 4RIRB 4LVNB 1KJVB 2J8UA 2M26A 2YR3A 4KK6D 2EXYD 3HMXH 3RGHA 4RFOH 3GMNB 4CADA 3O9WC 4Y4HA 1JMZA 1E4KC 1E4WL 2X4OA 1HWGB 5IBLD 5JW5B 5GS1A 4X6DB 4BFEA 4RWHA 2EYRA 2OTWA 1OLLA 4LSRL 3TA3A 5C3TA 1WAAE 5B21A 3CX5K 5IB3A 2B2XH 5MHSD 4PP8C 4GH7B 2VLRA 4FQ1L 4HIIA 4K3EH 2B5IB 4PJ9A 4ZSOB 3VWKB 4GG6F 1ZLUK 1JNHA 4QGTA 3GJFK 3MGTB 4B41A 4X6CE 2ED8A 5JR1L 1MREH 4I0PC 5C6TL 1BQHB 3ARGB 5ALCL 2IQ9L 3L3JB 5DVMA 2ID5A 1UVQB 3BQUC 2BXZA 3SDCD 4RX4D 5FGCE 2O61A 1OD9A 2YHGA 3WFEH 5IFJA 1YPZA 2VZOA 5GHWL 4Z7WE 1ZT1B 3OAYH 1RIUL 3KPOB 1A7BA 1AE6H 5DK0A 3VFOA 5BW7A 3O8XC 5LJYH 1A1OB 4GAYB 2QHRL 4JANB 2HKFL 2V2TB 2P8MA 4OZIA 1D9KA 3PXHA 5DD5H 3CD4A 4MXQD 4KVNH 4UDTB 4JJHA 2Q3ZA 3HB3D 2F53B 3LOWA 5CP3H 5F9OH 1VKXA 3SDAA 4G9FB 5KVGH 2A73B 3DRTA 3ISWA 2OJEA 4JHAH 5BQ7A 2HJFA 5JPNA 5DZLA 5GGTA 4AT6A 4NQDD 1M4KA 2FCBA 2ZKHL 1EGJL 2VDPH 5CINH 2Y5EA 4M3KB 3AGVA 1ADQA 1CK0H 5TJWK 3I75B 4Y5VB 4M7LT 3R4DA 5D7KD 2UUDK 4O2EA 4P4KA 4KRPD 1EA9C 3QEQB 1PKQE 1EHLH 4W68A 5E99L 5C0GB 2VH5H 3MRJB 4R4BA 2CKBH 1JFQL 3BXNB 3LRSA 3NCJL 5EOCJ 1QFWL 1P2CA 1QBML 1J05B 3WJJC 5C0IA 5A43C 3DX6B 2A83A 5GGSY 3TIEB 4MXWH 5LQBL 5IESL 4XWGL 1T1ZA 2VE6B 2NNAB 5HDBE 2FEDC 2BSRB 1G0DA 4O4YL 1E4XH 1MQKH 3KDMA 4QO1A 4XPHH 4UTBL 2O5YH 5C0CA 3MMEA 5FK9A 3PDOA 1DQJA 5DLMH 4TNWK 3MNWB 3PXJA 1CTNA 3OKMB 1FV1A 4U1HA 5HGDA 2AK4A 2ORBL 2R15A 2GTWA 4LRIC 3QCVH 4HXBH 4OUUA 4JDTL 1A6ZB 1Q72L 1IGCL 2FX7H 2XWBA 3VXRE 2OQJB 4TOYL 1L0QA 4PLOB 4Y8AA 2HLAA 1FJ1A 4G7VL 1YEIL 1OT1A 3O3DB 3B5TA 4G8FA 5JXEA 4QXUH 1IKFH 5D2NE 3HE7C 4GBXB 3FT2B 3OKDA 3KPMA 1BOGB 3FO9A 2DM2A 3QYCA 2ADGB 2XPGB 3ZTJG 2LQRA 1S7SB 1ZLSH 4TTDD 1FNAA 5EO0A 4EIZC 5CBAA 5F3BA 3TO4D 1FN4A 2XA8H 2KZWA 3S4SB 1RIVL 5F93C 5E8PA 3TBYB 5E9DE 5KTEL 4Y0GA 2ITDB 2GJ6D 5E5MA 1A6WH 3ARFB 1QO3A 5F7LB 1DBKH 1JNNL 4DGYL 4YHLL 1NGWB 3MLUL 1CGSH 5D1QD 2F8VA 3QDGE 1FE8H 2A0LD 3MUGB 3OR6B 5JNYA 5BOPA 5IQ7L 4K8RL 1HSAB 4MA7H 4ZFZB 2QSCL 2NYYD 1F4WH 2IEPA 3VGEA 4GW1A 3HI6L 1L9NA 3V5HB 5EFIB 3D0VB 1TJGL 1OCWH 5DDHB 5FYKH 2NY3C 3LIZH 3NAAL 3PP4L 3UJTL 4GW4B 3RPKA 1UM5L 3EOYG 5H2BB 4KK9D 4CU6A 2HRPH 4FMKA 1K85A 1PYWB 3NFNB 4I4WA 3HG1A 1CE1H 3RWHA 4YXLH 5FM8A 1V7NL 2BP3A 3SKUD 3BKJH 4D9QD 1EH9A 3KYKH 3DMMA 3WO4B 5EOTA 4BSVA 4GKZA 2NY1B 2Z8RA 1P9MC 3WLWC 5TQ2L 3C60D 4M1GH 4JO3L 1BFOA 5FCUH 5A2JH 3OGCB 3H3PL 1BD2A 1RFDH 1FAIH 2BVYA 5EU6B 1MRCL 1M6OA 5EA0L 5JLZA 5INDA 3RL1B 2HT4D 2EIBA 2WBJD 1HE7A 2P48B 4XNQA 5D7SH 1DSFH 1X5ZA 4GS7B 3QXDA 1G7MB 5DRXB 3TFKC 5HVGB 1TZGL 1KCRH 1UCTA 2VLKE 1YYML 4HPOL 5DC0A 3U9UB 4Y4KB 4QF1A 5E7BA 1X5XA 1WUNT 2X44D 5I1JH 1VB9A 4KH2A 5EBLB 1JV5A 2ZNXA 3RNKA 1X5YA 4OCXL 4XP5L 1K6QL 5CLTA 2OK0L 4I9WE 1X7QB 4PRHA 2X05A 5HTSA 5IB1A 3B2VL 5KG9A 4ZOAA 3TVMD 2EDQA 4XZUA 1OW0C 4O2FA 1MCWM 3MZGB 2C3GA 4P48A 4M1CD 3BUTA 1FFPB 3WSQL 4YX2H 3FQTB 4QNPF 2EDFA 2DWDB 4WI5A 5C1MB 1P1ZA 2PYED 3KPPA 3QI9D 4PJ8C 4J7RA 3L3KB 3ILQC 1KCUL 4R2GD 1S9YB 4EI5D 2HH0L 3MO1A 4FP8H 3KPRD 4KROB 4HAFA 2K7QA 1CD1A 2IAMC 3QAZB 4IHOA 4FABH 4KTYA 2R2EA 1S7UB 2VSCA 3BKMH 3OKKB 2FGWH 3QQ9C 3MLZH 2RR3A 1KJ2A 4JGMA 1VFAA 4LLUB 3S3JA 2GUOA 3SE4A 2XZCL 4MXVE 1BBJB 5ALBL 1ORQA 1IQDB 3VD9A 2MKWA 1HQRB 2HFEB 3L5XH 3VFGH 3HUJE 4WDIA 3RWDB 1NUNB 2KUTA 1LK2A 4OCWL 2J8UF 4PGDA 4JREC 4PREB 1MCEA 1YEDA 4MSWB 3JWNC 5GS2D 3NH7L 2FEEI 3CX2A 5JIKA 4LLDB 3P40A 2E7MA 5ESQB 1FNHA 1AC0A 2R1WA 1ETZA 4DVBA 3BHBB 1CDGA 1MEXH 1QLRB 3WIIL 2V2XB 3C9NB 4ERSL 1SYSB 5MHSE 4JZJA 2CDGA 3UBXI 3WKNA 1ZVSA 3WNMA 3UYRH 1T2QL 3DUSA 3U83A 3RPIA 4N68A 4Z9KB 1GAFH 4P59H 1EVTC 1U2CA 4MZ3A 1E28A 5JHDD 4KV5F 4XPHL 4G9DB 5BV7C 5L9DL 4ZOBA 2NXZB 2KZ1B 4HUWA 5JORB 4OZ4A 5TE6L 3VMPA 4DOHE 3HC0B 5IIEA 3CSBA 5I73C 5JPMA 5EZJA 3VA6A 1TTUA 4OF3A 2VISB 2X1QA 3M17B 4L4JA 2YD7A 1H0DB 4LK4A 4HXBL 5CJQH 2D7NA 3IAGC 4XC3L 4D0CB 3RGVD 3GMPA 3GZKA 1YPZF 3H42L 1Z9SA 2APFA 4RGOH 3SGDH 3DBXA 4MA3A 3DROA 5I74C 3ULUL 4XCFH 4X7SL 1HQ4A 2BMKB 1CCZA 1LHZA 1TQBB 4HIEB 3LD8B 4OGYL 1JGEB 1VFBB 2Z31C 2LTQB 3RDTA 5IMOA 3X3FL 2JJSA 4V3DB 4OZIF 4XNZB 1A5FH 2W9DH 1BJ8A 1OP3H 4MWFA 4HT1L 2N7AA 3QNZA 3RP1A 3Q3GA 4P2QA 1Z5LB 2FZ3A 4HEME 5JA8B 4LLVA 3W5NA 3IXTA 2X89A 3WXVH 1U2HA 2QSQA 4Q2ZA 4YDJA 3INUH 3DI3B 3TPUA 1NSNH 1JHKL 4N0UA 3N9GH 3WFCH 4P5KA 1BQHG 2YKLH 4V3EB 2EDLA 4XT1C 5CWSA 2PO6B 3MLRL 4YZFF 4RISL 5F9JA 2HA1A 4PB0H 4JDZA 5GISH 3U0WH 1MVUB 3CMGA 5DMGC 4S1QH 3MA7B 4P2OC 4ELME 3FHQA 3SDYH 4EBQL 2PNDA 2JJTC 1QEWA 4M5YH 4DKEH 4NHUB 4H1LB 3WFDL 5FHBL 5J1TC 1NGPH 3MV7A 3QUZD 3GI9H 4KVCL 3L7FB 3FAWA 1T5WB 3AROA 1DR9A 2ESVB 4XB8A 2DDQH 4NZTL 1LE5A 4YIQB 5IW3A 1BVKB 3PV6A 1NC4D 1DLFL 1J1XH 4MNQA 3U4EB 1JHTA 3KPLA 1PSKH 2PR4H 5GS0L 3U30B 5I15H 3KYKL 4IDJL 3L9RB 2Q86B 1FGNH 2YD3A 3ERYA 3GHBL 2RBLA 2YD9A 4CMMA 1KB9J 2NY5H 4ZNEE 1I1CA 2HWZH 3UPRB 4YHNB 4KZEH 1F02I 2X40A 4P0DA 3SJVB 1N3NB 1OF2B 3BE1H 4XBEH 1P69B 4BELD 3LEVL 2N56A 1ULVA 3H9SE 1WFOA 2X70B 1I4FB 2GQHA 1BFSA 4BZ1L 5IJVB 3T2OA 5T5FH 4LKCA 5K93A 4HWEH 3B9KB 4Q9BA 1DQLH 3M1BB 5C0BB 2E6PA 4EEEA 4PJAA 4FQXD 3W0WB 5D7SL 1CE6B 3NZHH 2C9AA 3OR7B 1MCJA 5F7EH 1PG7H 4JM2C 5LXGH 2IQAB 4MMXC 1CGTA 1A1MA 3PHOA 3AM8A 1A3LH 3BGFC 1PDKA 4W70A 2LU3A 3QQ4B 1OTSD 5K9KB 1NBQA 4JGJA 5K9OA 2ICES 3IDJA 1I1YB 4N0FB 2XTLA 3NIDF 1HI6A 5T1KD 1SY6L 4S1DC 4M6NL 2JK5B 5C71A 4NZUH 1PLGL 4LSSL 4WW2A 2DQIH 2EYTA 3DUHA 5TH2B 2FB4H 2HN7B 3C5JB 4PBWD 5IWLA 1MAMH 2BHZA 3RKDC 3QRGH 4G80A 3G5YA 4QY8B 3PGDB 5DJXA 3IXAB 4KRMB 4XB7A 3SKJL 4OFVA 4ZTOH 3B5GA 2CGRH 2BOBB 1JFMA 3IVKA 4MAYD 4RIRA 3WDHA 1KJVA 3ES6B 2E7LE 2VXVH 2ICWA 4L4VB 4A6YA 4MQ7B 1L7IH 5GGTH 3BKML 4YHOL 3PWUB 4PJHB 3GMNA 1OSZA 4K7PL 3P9WB 1ADQH 2XY1A 1LP9B 5JW5A 2XYCA 4X6DA 2NPLX 3VFGL 1IMHC 2VDOH 3RUGE 2BC4B 1WZMA 4LCWE 5B4MC 5D7LB 3U36B 1AJ7L 5I76B 1E0OB 2OP4L 5D72L 3D69B 4ZSOA 3VWKA 4F9PC 2DKUA 3SO3B 5BJTB 1BQLH 1IAIH 3MGTA 4NIKB 5L8LB 3DV6B 1FO0L 2D9QB 2W91A 1BQHA 1R3IH 2VSDA 3ARGA 1DBAL 5IBTL 5J8OA 3L3JA 4UQ3B 2CH8A 1UVQA 3SCMD 2WW8A 4YC2C 2VXSH 1T7VA 4TUOB 1OAUH 4XRCB 5SWZE 4R4FH 3NIGE 1ZT1A 2F54E 4JO2H 3KPOA 5C7XL 3EJYD 1EZVX 3T8XA 1A1OA 2DQEH 4GAYA 3GK8L 4JN1H 4K23H 4Y5XB 3SHSA 5KJRL 3T0ED 3O2VH 4HK3J 2V2TA 4WWKC 4OD2B 3U7WL 4PRDB 5F9WB 3FB7B 5JOFB 4UDTA 2YUZA 4LCCC 2F53A 2YD2A 3GMLB 2JLLA 5HHQA 1J0IA 3AS1A 25C8H 4G9FA 1U91B 4OJFL 1FZOB 4KI5C 4D0DB 32C2B 4M7KL 4XMPH 4S0UC 3MV8B 1HK6A 3OQ3B 3QP3A 4MZ2A 3F6IA 4GAJL 3EFDL 5EU7C 1DUZB 3V6FB 5B38B 3NCFB 3PWLB 3IDGA 4JFZH 1NGQL 3I75A 4Y5VA 5DEFB 4WFFE 1EHNA 3W2DL 1Q9KA 3CLFH 4JO1H 5FDYA 3QEQA 5ADPL 3CFDB 5C0GA 3PWVB 1NL0L 3MRJA 3BXNA 1C08B 3ARTA 4QTIH 1J05A 4APQC 1DFBL 4M43H 1KPVB 4NHCH 2OI9C 3DX6A 3N9GL 5A2LH 3TIEA 1FQ9C 2CR3A 1YY9D 2VE6A 2NNAA 4PB0L 4ZXBC 2BSRA 2L7JA 2CXKA 1OOAA 4K2UL 2C3WA 2XQBL 4U6HB 3VXME 2JELH 1UEYA 1NCWH 2XRAL 2W9LA 4LLAA 2IPUK 1B0WA 3BUYB 5T1LD 2EE9A 1NGPL 3MRHB 4LHJB 3NTCH 3MNWA 1UWEH 1S7WB 3OKMA 4QWWC 2D7TL 2DDQL 3QZWB 1F4YH 4CVXB 3PDDA 4MYWB 5CHNB 1A6ZA 1UWXK 4P9HH 5KVEL 3HC3H 3O3DA 1T5XB 4WI3A 2ZCKL 1CLYL 4GBXA 4UQ2B 1BOGA 3NMEA 4U1GC 1YEKH 3S36L 4R0LB 1Q1JH 4LP5A 2XPGA 4PRNB 1A6VL 4R4ND 1S7SA 3HE6B 4DGIH 4KZEL 3S4SA 2OSLA 5EBGA 3DXAD 1NFKA 2HJLB 3TBYA 1W2KT 2ITDA 1G9NH 4HX1B 4OI7A 3BPOB 4UAOB 3VMOA 1P7QD 4PJCB 5DO2D 3ARFA 3RVWD 2VDQH 1NGWA 3SGKA 3OTTA 5LGHH 3K1KC 4XVJH 3V7AG 1J8HB 3MUGA 3MUY1 5L0QC 3OR6A 2NXYB 4JFXB 4FFYH 3TLRA 2A74B 2P5WD 2VDMH 5FYKD 1VEMA 3KXFD 2JB6B 4M93B 1HSAA 2BJMH 1G9EA 2J3SA 2E7HA 3AREC 2V9RA 5EFIA 5FYLE 5TDPB 3D0VA 1G6RB 1SHMA 3LQAH 4AMKH 5DDHA 4NJ9H 1U8MB 4L1HA 2MQCA 3V8CA 3MNZB 1YMMA 1YEHL 2YC1A 4GW4A 5H2BA 5C0AB 2C7UA 1YNLH 4BK5A 3TCXA 3PE9A 1PYWA 1UC6A 1UM6H 2ZG3A 1A4JB 1I7ZB 3BGMB 3QDJE 3VD4A 5SWSA 5F7KC 3BZDA 4OIBA 4ONFL 4NNYB 4BUGA 5C2BH 1IGIH 3BOVA 2DIJA 4ODHH 4HDIB 3TT1H 4XVTH 3I3DA 1YC7A 3RAJL 4BZYA 1DVFB 3K2UL 1KJ2H 4QOKD 5DD0L 1YDPB 3QDHA 2C4XA 2OCFD 4HLJA 3FZUC 3OGCA 4QEGA 5EU6A 1MFNA 1HOCB 3FB5B 4LVOC 5CBEB 3WYRA 4URTB 5I16B 3QO1B 1NBVL 4L4TE 3RL1A 2JB5H 3EFFB 3SEPA 1Z3GL 4EUPB 2BNUB 3VW3H 3F62A 1G7MA 5GQBA 5DRXA 1J0KA 3SE9L 1ZTXH 5C0EA 1FL6B 1SJHB 2VITB 5A2FA 5I66B 3CZFB 3DGGB 2VXQL 4Y4KA 3MCLH 4YBHA 3MBEB 3WFHB 1MVFA 4LQ1A 4MA8H 1G7JA 3U6RB 5EBLA 4WRLA 3PGCB 5KZCB 1R3IL 2OZ4A 2N7BA 1IKNC 4U0RB 1IE5A 3QJFB 5EBMB 4PJAF 4K55A 1X7QA 3S88L 4H1LG 3BPLC 3L5WB 1FH5H 6FABL 4D9LH 1FFPA 3FQTA 3NABL 2ADFH 2IANE 3V6OA 2DWDA 3WN5B 3HNTL 3QHZL 4FQQB 2BFVH 3ALPA 3G9VA 3K8LA 3L3KA 5KVFH 5HGGS 2YZ8A 4ODUB 1S9YA 4XP9L 3L95B 1Q0XH 5DVOA 1P7HL 3LMJL 1S7VB 4I3SH 5FOBB 3VXSE 1SJEB 4WW2F 4UIMA 2OR9H 1JK8A 3CFKB 1CI5A 4KMLB 4Y1AB 4MB5A 5T1DH 1XCTB 1S7UA 3OKKA 3QUYC 2UV3A 5KS9E 4XNYH 7FABH 2R0LH 2NQCA 5F6HJ 4MJ4A 3D6GA 1LO5A 4Y2DD 1W8NA 3ZDYF 1BBJA 5MI0B 1HQRA 2HFEA 4UT7H 3RWDA 5C07B 3ZTNL 1KIUA 3DVGB 3CSGA 4PREA 4MSWA 4ZS7H 1FIGL 2VL5B 4LLDA 4NBZB 4KAQL 5DFWH 5ESQA 4FTVB 1BP3B 5TF1H 5DURB 2VOTA 3BHBA 1B4JL 4XAWL 5DA4A 1QLRA 3MREB 5CEZH 2V2XA 4LHUB 2XN9B 3C9NA 1JNLH 1MI5E 4X6DF 4ONHB 2C5DC 2F5BH 4GMTL 1JBJA 1RZFL 5EZLB 2V17H 3VFPB 2FO4B 3X11B 1TNNA 1EEYB 5JIIA 3RWCA 2PXYD 3HHRB 3L5JA 1B6DA 4I8DA 2JELL 4G9DA 1B0RB 3DHMA 1II4E 4X4ZA 4N5ED 5JORA 3D85A 4E41D 3ARBA 2IFFH 1EHAA 2VISA 3LRHA 3ABZA 2Q7YB 1TLKA 4AIXA 4GLRH 4JHWH 4D0CA 4DFHA 3JTTB 3CVHL 2MQ0A 4ONGH 1QRND 1GHFL 2BMKA 1IEHA 3OKOB 1H15B 5EWIL 4HIEA 1T1YB 4LARL 3ZDZF 3WS3B 2LU7A 5KW9L 1JGEA 1RMFH 1WZ1L 4LGSB 4ZUUB 3QJHA 4HG4J 5HDQL 5KAQF 4H20L 4EVNB 1YEFL 4X9FA 5D7IB 3QUKB 3UMTA 5T1MB 4FXLA 2P24B 2EZ0C 1WF5A 1Z5LA 1NEUA 3EYUL 5CJXA 1KB5L 2ZUVA 1JF6A 4ZO9A 1PGRB 5HYSB 3TO2A 3BDYL 3D18A 2C1PB 5HI5D 3QUML 3MOAH 4I77L 4RMSA 2Y5TA 1IGYB 3GRWA 5ANMB 2PO6A 2QR0B 5EOCH 3IDXL 1MVUA 3H0TB 1BHGA 3MCKB 3I6GB 3MA7A 4NPYB 4D8PB 4LAQL 1JGUH 4PY7B 4X5WB 2P44B 3A6CH 4ESKA 4NHUA 4C4KO 4H1LA 3ARUA 3FHAA 3LQZB 1YNLL 4NKMB 1T1XB 4NO2B 1T5WA 4ZAKC 3K4ZA 3CSYA 1GL4B 5DUPL 4YIQA 1BVKA 1UM6L 4AQ1B 2DMCA 5CP7A 1J0JA 4N90D 3H7LA 3U4EA 5FDWA 1R5IB 1WT5C 1RSFA 2NY2C 4NKIL 4XCCL 1T0PB 2Q86A 4NCC2 4D9RD 5JW3H 3RY6C 1T0MB 4MX7B 4Y4HD 1CIUA 1MFBH 3O6KL 4LCUB 2XACC 3RU8L 4KZDH 3RHWF 4A6YH 1NMAH 1JHLH 4O00A 3ARWA 4TSBH 3UPRA 1KJ2L 4YHZH 4YHNA 3V4VH 5D71H 5JW4R 2Y07H 2CKNA 2H8PB 2VLRD 2ERJC 1YN6B 1N3NA 1OF2A 4PJ9D 3VD5A 2GHWB 5B38G 1XCQB 5D93C 2X70A 1I4FA 4JPVL 5IJVA 2FX8H 2YMXH 2ZOLB 2EH8H 3EYFB 2IC2A 3B9KA 2I26N 2ZSWB 3M1BA 5C0BA 3W0WA 5E6YA 3QIBA 2VLLB 1CE6A 3DXAE 3OR7A 3SGDI 3P4NB 3MX0A 5CGYC 2I5YL 4QRTB 4HBQA 2IQAA 1KT2B 1L6ZA 4KRNA 1SEQH 2WBKA 3BQUB 1KN2L 2FRGP 3VFUB 3HR6A 3EDKA 4H8WH 3FO2B 1FVCB 5K9KA 1R5VB 4XPBL 1I7TB 3P2TA 3ARQA 5E2UH 4X4YA 1I1YA 2DQGL 4F37K 1T83C 3BZFB 3P0VH 4JQVA 2Y36L 3EZJB 1D9KD 2F15A 4YHKH 1PG7X 1ZHBB 4MD4B 2JK5A 5F6IC 4D9LL 3EO9H 5GGQH 5TH2A 2HN7A 3NFSH 3QZWG 3K0WA 3C5JA 5FB8B 1K4DB 3MACH 4U31A 2AGJL 2IGFH 5DJ0B 4ZO7A 1G7IB 3SDAD 3UROR 3BSZH 3GIVB 2VDRH 4L5FH 5GIRB 4QY8A 3PGDA 1ES0B 5FUZL 3IXAA 5KVFL 3Q1SL 3VXNB 3P4OB 4JO4H 4GRWB 4TULL 3LS5H 3QHFH 4QRRE 1LE9B 1K4CB 2BOBA 4U1MB 4LCIL 5E2VL 4HCRA 5F7FA 2OR9L 4L4VA 4P4KD 4WUUB 3RKPA 3PWUA 4PJHA 4B5EA 4P4RB 5MEND 1AHWB 3JWOH 4PB9L 3TGXA 1ZEAH 2AJVL 5IF0A 1OSPL 4KKLC 4Q6YA 5EU5B 2QKIB 1LK3H 1N6QL 1LP9A 1UYWL 2NY4B 4N0CC 4FZEL 4X9GA 3RZCB 1TETH 2IH3B 3O4OC 4KKCC 4W6XB 5D9SB 4C83B 2ZUYA 2BC4A 1N4XL 3W39B 5D7LA 3U36A 5I76A 3FONA 3D69A 4FMFA 5BJTA 4KK6C 2AV1B 4KJPD 4NP4L 3DV6A 2EXYC 2P46B 1JNLL 4O2CB 1N6VA 3R0MA 2HFFA 4UQ3A 5C8JA 2MTPA 1I85C 2NZ9D 2V17L 1VADB 1F42A 1KTLB 4TUOA 5IBLC 1EVUA 3BJLA 5GSVB 3LKSB 2W9EH 1G9MC 4ODTH 5KSUB 4I48A 1GC1C 5JXED 1F90L 3FT4B 3EO1A 1V8HA 2Z9TA 4C55A 5GRUH 1KN4H 3PWJB 4QRPB 2XWTB 1EZVY 1W72A 4KKAD 1EEZA 5D96C 5FYLL 4BH7B 5J89A 2AJ3B 2R2BB 5EUKB 4OD2A 4P9MH 4PRDA 2F58H 2ILLA 1Z6JT 3VDCA 1KIQB 1Z9OA 4P23B 5A3ID 4MQTB 4JHWL 3FB7A 3QDMB 5JOFA 2FD6L 2IMNA 2A2QT 3NGBB 1WWBX 4JQXC 3S96B 1A64A 3SDCC 3GMLA 1CLOL 4LLWB 2DQFB 1IFHH 1U91A 1FZOA 1CT8B 2P47B 1JTTA 4D0DA 3UC0L 3MV8A 1ODAA 1BEYH 5HPMB 3TZVB 4EUPG 1DUZA 3V6FA 5B38A 3HNSH 3PWLA 3FN0H 4BFIB 1J86A 5DEFA 1D6VH 2CRZA 2ZCHH 2AW2A 3CFDA 4U7KA 4KK5D 2Y25A 2XTJB 3P11H 1X4ZA 4ODVH 3PWVA 4MXQC 1T1WB 4QYOB 1WEJH 3HB3C 2CDEA 1DBML 3DLQR 1KPVA 3LV3B 1QSZA 2P45B 1VSCA 3SN6N 1QHOA 3HG1D 5C70A 1JGVL 4P46B 3T65B 3TM6A 4XPTL 3RJDA 5GZND 4OM0H 2B7DT 1FRGH 5IV2B 1FGVH 4U6HA 3DMMD 2J1KA 2WINB 4OGAD 4Z0XB 3QA3B 4OF6A 3CK0L 1KPRB 4FXKB 4KRPC 1MIMH 4D0BB 3WUWB 3QPXL 4WO4A 3O6FB 3QZWA 4CVXA 3RIAK 4YWGH 4U05A 1TVDA 5CHNA 5IVOA 1BD2D 4PG2C 3VDBA 4Y19E 4R8WH 4KUZL 3BPCB 1T5XA 4OFYA 3MJ9L 1MFBL 1AXSB 4H5SA 1OB1B 3BN9D 4UQ2A 3SOBH 4OLVH 2WUCL 3P77B 4KZDL 4R0LA 3SGJA 1Q94B 3FB6B 4PRNA 5EUOB 5JOPD 1WTGT 1H9VA 1U8QB 4HWBA 3HE6A 4K71B 3DNKA 3L3HB 3QIWB 4AK1A 1MQ8A 1QSFB 2DL9A 1YJDC 2HJLA 5IB5A 4HX1A 2FLRT 4QT5B 4K94L 2R29H 4XPAL 2O5XH 4PJCA 1JPSL 3N85L 4TVPH 3T4AB 1AXTH 3P3YA 3RX8A 4U49A 3TJHA 2OJZL 4BQ8A 4JRYE 1WWAX 2UZIH 4GQ9L 3TNMB 1J8HA 4PRHD 3OXRA 2ESVE 4JFXA 2RFXB 5IHUH 2A74A 2BRRH 2JB6A 2OZ4H 2VWEE 1VFOA 5TDPA 1G6RA 4NKDB 3X13A 2Z92B 2IPKB 5LWYH 4TTDC 4H8WL 4I5BB 4IM8A 3TO4C 2FATL 3MNZA 1XMWA 2I25N 1HDMB 1RUKH 4AIOA 1MHPH 4NQEE 5C0AA 4PJ7E 1B88A 1T89A 2NY0B 1CD9B 2VUOA 3CX5J 3BPNB 2YBRB 4JKWA 3X14B 1QFPA 4IDLA 4GRMB 3UZQA 1I7ZA 4RGND 5D1QC 2BNQA 3BGMA 2CK0L 4J12A 3SJVE 2A0LC 2O5ZH 4FNLL 4LEXL 1N64L 2DD8H 2QQKL 4NNYA 1UQSB 2NYYC 1KBGH 4HDIA 3PJSB 4YDIL 2VC2H 2YK1H 3MOBH 4HUUB 4N90E 3IDNB 4OIAA 4YUEL 1DVFA 1Q9OB 4TSCL 2A1WL 4KK9C 1YDPA 4NQCE 1RURH 1FNLA 3O3UN 5J56B 2R4SL 4KMTH 5DF0A 1YQVL 3OKNB 5CCKL 3P0YH 3FB5A 5CBEA 5I16A 3QO1A 1KSRA 4D2NA 2EIZB 5I1IL 3MLPA 3EFFA 1FYTE 4EUPA 2DICA 3ZT6A 2E7LC 2B0SL 2BNUA 5HYSG 4Y8DC 1MCOL 4KKBD 3VFMB 4BQBA 1ZOXA 1JPTL 1FL6A 3OHXB 1SJHA 2I27N 2VITA 5D1ZA 3CZFA 1I9RL 1X9QA 3DGGA 1S7QB 2Q8BH 5C2UB 2ZPKL 4X8JB 5DQJB 3WFHA 3PGFL 4OB5H 2H9GB 2V2WB 3C60C 1NANH 3VFRB 4LIQH 2AAVA 5AAWA 2VXUL 3PGCA 1OPGH 2YXFA 4YHMH 3QJFA 5EBMA 2WANA 2P49B 2H1PH 1NAML 4JFPB 1I3GL 2X4UB 2QSVA 5M94B 1CGVA 4G6KL 1DQMH 4OSUH 5I73B 2HT4C 5BS0E 2FX9H 1K3ZA 2WBJC 1T4KB 1B90A 1FNGB 1LD9B 2XG4A 1YYLH 3WN5A 1OAKH 5JMRA 1S9WB 4ZUTB 1NCDL 4FQQA 4MNGB 1FYHB 2IBZX 2R0KL 4B0MM 4CU8A 1T7XA 3V52H 3F8UB 1HXYB 2HJKB 3I50L 3O2DL 1Z9MA 4ODUA 3RDTD 3OPZH 3L95A 3G5ZB 3IU4L 4G3YH 3G08A 1MCWW 5T33H 1QYGL 4R96A 1S7VA 4NM4H 5ESAB 1SJEA 2Z31B 3WFZA 3CFKA 1PY9A 4P2QD 4Y1AA 1XCTA 3G9AB 4XH2B 5EOQH 3TVMC 2BOCB 2X89D 4M1CC 4X99B 1I9IH 3DX8B 2VLJB 3AVEA 4WJ5B 1B4RA 5CSGA 3F7VB 5DQDL 1IT9L 4C56A 5AZ2H 4WHDA 1JUFB 3QI9C 5C07A 1UKQA 4WIQA 3FRPA 1EFXB 4R2GC 5CEZD 5MENE 4EI5C 2VL5A 1N59A 3GBNH 4PJHF 3GRWH 4FTVA 5GGRB 4OZGF 3V79C 1U92B 1AI1L 1BPVA 3MV7D 1LP9F 3MREA 1ZT4B 1NLBL 4LHUA 3JVGC 1R0AH 4XNXH 4ONHA 2Q7NA 4P2CG 2Z4QB 4HV8A 3MR9B 5GGVH 3D0LB 5EZLA 3D2UB 3VFPA 4H1LH 2FO4A 4MNQD 3X11A 1EEYA 1S8DB 3I3BA 3QO0B 1DQDH 4OM0L 4O9HL 1X44A 3CMOL 2DQDL 3D3VE 4PLNC 4YK4C 4KY1L 4JFHD 1JRHH 5E5UB 3WS6C 4AH2B 3A67H 3GEWB 4GKOA 1G7QB 2Q7YA 1CXIA 3U9PH 3JTTA 4F7EB 2R69H 1MJ8H 3OV6A 1H15A 2CQVA 3ARXA 4JFDE 3W82A 3QEGH 4Y88A 1T04A 3WS3A 3A6BH 4N8CH 5CMAB 3QPQD 4ZUUA 4NO5B 2MOVA 2NY6B 1T03L 4IJ3B 4EVNA 2AEPH 5F1NA 4N8VB 3QUKA 3PWPB 2XA3A 2P24A 3DSFH 4XNUL 5FO8B 1GIGL 4JCLA 5DJ2B 1E4JA 1NFDE 3MV11 4R97C 3MXVL 1AGBA 1CDUA 4XVSH 3V6ZB 3RGVC 4DQOL 3UTQA 3AS0A 4JG0H 4POYA 2C1PA 1QSEE 4IIQB 5IW6B 4X98B 1IGYA 3MBXH 5TE7L 2QR0A 4OTXL 1IM9B 4QGYA 4JCMA 3QFJB 3MCKA 4NPYA 3I6GA 3TWCH 4D8PA 5HYJE 3SQOL 3MXWH 4BUHA 4PY7A 4X5WA 4I0CC 5JQ6L 1MHPL 3RWIB 5DD1L 3LQZA 1ZGLP 3IGAB 4NKMA 2AEQH 1T1XA 3C6LB 4NO2A 4X0KB 3KPQB 1NEZB 4PJBB 5SV4A 3JUZA 5ITBH 1BREA 4RMUA 5KBNC 4OCLC 4L3EB 4GG8B 1TQCB 2E27H 4Z0BH 2H32A 1R5IA 4NYLB 4OM1H 5HHMB 4EZMA 2RQ8A 5FGSA 3CU1A 2X10A 2P4AB 4HCRH 1T0MA 4V1DB 4MX7A 4FHBD 4LCUA 4KQ3L 2OBGA 2AI0H 3FFCE 4JY4B 1MELA 3Q5TA 5I1HL 4L8SC 1UACL 5ITFB 1IGMH 1TZHB 4R7NB 3HA0A 5ID0B 3QUZC 2H8PA 1YN6A 4LSQH 3VWKD 2MWCA 4QXWA 3P0YL 3MV9A 1XCQA 1XGQB 4FXGA 4WWID 4R90L 5FXCH 2ZOLA 1UA6L 5TE4H 3ARGD 3ULVE 1JGDB 4Z7QF 1Y6MR 2VLLA 3N1GC 3JZ7A 4MJIB 4X9HA 3RX5A 2AQ2A 1JYVA 3UJIL 4QRTA 4JM4H 1KT2A 2DQJH 3CDYA 5I75C 3BQUA 2Q8BL 3IKCB 4M62L 1KELL 3QHTC 3VFUA 3T3PE 3GMQB 4PJCF 5CJOH 3FO2A 1FVCA 1TPXC 1R5VA 4E42B 2J6EL 1FZKB 1I7TA 5IB2B 2O93L 1KLFA 5C09A 4LLQB 5FUOH 1GSMA 1T0NB 2H1PL 3BZFA 4MB3A 1IGFH 1RZJH 1HH9B 1N7MH 1ZHBA 3ZHDA 4MD4A 5D8JH 1BQUA 1CVSC 3F58L 1RZKH 1HHHB 5JA9A 1W72H 4Y2OA 1CGXA 3QT2A 4FQXC 2F53D 3I85A 1YYLL 3TV3H 5FYJH 4PJFE 5FB8A 4FQIH 1K4DA 5I1CH 4G9FD 1G7IA 4PJXB 1FCGA 5GIRA 1JGLH 4DW2L 3FO0H 3V52L 1ES0A 3PUCA 4LCCB 3BGAA 4PY8I 3VXNA 3P4OA 1RUQL 2YUWA 3UJJH 1LE9A 5HI4D 1K4CA 3FMGL 1HHIB 4M1DL 4U1MA 1KFAL 1OTSC 3C5ZB 4R9HA 4RFEB 1RZ8B 3OGOE 4OQ1A 1QBLH 3QEQD 3LKQA 4WUUA 5EOQL 5ACZB 3UDWA 4UTAL 4G8EA 1IBGH 4P4RA 1AHWA 2P5ED 5EIIB 4JN2B 1AO7E 4P3WA 1CFVH 5EO9A 1BVZA 5EU5A 2QKIA 1UXSB 4QRUB 2RB8A 1XIWB 1O0VA 4FQ2H 3U2SB 5ISZE 3RZCA 2VUYA 1U6AH 2IH3A 1QR1B 5CEXB 3CVIH 4C83A 4F33B 5I1AB 1CLZL 1J1OL 1I1AB 3W39A 3L3OB 5BVPL 4L9LC 3GBNL 5T3ZE 1JWMB 1P5VA 4MAYC 2ICWI 1HKFA 1EBPA 3LN9A 2AV1A 1MCCA 1A14H 4IMKA 4Q6IC 1RY7B 2EIEA 4O2CA 3KVQA 4TUJB 4AEFA 3JV5A 3GBML 1VADA 1KTLA 5GSVA 3UTSB 5C3LD 5I1LB 3LKSA 5KSUA 2D31B 4YDKH 2WWKO 1FNSL 2NY7L 2E6QA 2DJUA 1MFCH 2DTMH 2GJJA 2UZXB 4S1SL 1K9TA 3OAZH 3U1SL 4GBXD 1N6UA 3PWJA 4QRPA 2XWTA 5JTWA 1JRHL 4BH7A 2AJ3A 2APXA 2R2BA 5EUKA 1FZJB 1LQSR 1LDPL 3ZKND 1D5IH 2NY3D 1KIQA 3PQYB 2NLJB 1MSPA 4P23A 3T77B 5I30H 3TNNB 3QDMA 2YD6A 1ZSDB 2BY0A 3S96A 4JFFE 3QXUA 3SCMC 5HHOD 2JJVA 4YXHL 5C0JB 4LLWA 3ARFD 2DQFA 3IFLL 4HWBH 1CT8A 2XN9E 2V7NB 1IARB 1UZ8B 2BHYA 2DN7A 1TZIB 2OR8A 2WIIB 3EJYC 3E3QC 1FAKT 3TZVA 4DZ8B 5HPMA 3WEXB 5L0QB 2P1YA 4BFIA 3T0EC 1RUPL 4WFEE 1R3HB 3O6LL 4NSKB 1YMMD 2IADB 3NA9H 5KVMC 3HKFA 2FBJL 1T1WA 4QYOA 4POZD 1G6RH 2O26U 2A6JB 3DURA 1DN2A 3LV3A 4MJ6B 4NM8H 5HHVL 3HAEB 2F9BT 4NWTH 4HGKC 4DGVL 5I1KL 2C3HA 4P46A 3T65A 5IUSA 1S3KH 1X5IA 5SWSD 5IV2A 4DUWA 2PETA 2YA0A 3GO1H 3IAQA 2RHEA 4TNVK 2WINA 3LKPB 4Z0XA 2NY1D 3QA3A 3K8MA 1KPRA 3OAUH 3GDBA 4FXKA 3WUWA 5TPWL 1INDH 3O6FA 5FKAB 2AJUL 3FOMB 4DN3H 1HXMB 5D7IE 4Z0BL 5EU6D 3VGHA 1KC5H 1I8LA 1WTLA 3BPCA 2Z0BA 1YY9C 2LFGA 3MLXL 1AXSA 1OB1A 3QWQB 3MRDB 1BQSA 1A6UH 3P77A 2AI0L 4BZ2H 1BWWA 1Q94A 3FB6A 1KF9B 5EUOA 4TVPD 3KPSA 5ANME 5K59F 3L3HA 1B6UA 3QIWA 4OD1H 4HIXH 4EUPH 4Y4KD 1QSFA 3TFKA 4QT5A 3MJ8B 5E2WL 2EIDA 4YEEA 1I8MB 1U3JA 4OGZA 1DBBH 4RWYH 3IRZA 1U8OB 3F7RA 3TNMA 2PW2B 2RFXA 5K9JH 5I18L 1BJMA 4WFGD 3V4PL 4XP6H 5DJAA 5E94B 2IBGA 4R4NC 2VDNL 4NKDA 3BAEL 2Z92A 4OZFB 2FR4A 3WBDA 1QZ1A 1GPOL 4I5BA 1FL5B 1QVOA 2GIYA 1HDMA 2XZZA 4X6CB 5C92A 4LSVL 5K9QI 1MCDA 3HMWL 5F1KC 4WY7H 1WC7A 3CXDH 5TF0A 3L3IA 5DO2C 2WQ8A 5ICYB 3I2CH 4KROD 1FORL 3RVWC 4L3CB 1NH6A 3OB8A 3S7GA 2YBRA 5FGCB 1X5AA 4GRMA 1TJIL 4MJ2A 4JFEE 4J3OC 4JKPH 1OD7A 3ME0A 1F2QA 4Z7WB 4Z77B 4FQIL 5CKAA 2R8SL 5EULV 5CZVH 4YJZL 1UQSA 2HFGL 4GFTB 2I60L 1WGOA 4BSWB 4LLMB 3UJJL 5DT1H 4HUUA 4U0QB 3X3GL 5TQ0H 3IDNA 4PLKD 1Q9OA 2G60H 3QB7C 3CNKA 3OKNA 3GUTB 3QISA 4N8VG 1D5BB 4LDLB 1BM3H 1VGEH 4ZG1A 4PJGA 4GUPB 2EIZA 2JKXA 1YEEH 1DANU 4JVWA 3CVIL 3VFMA 3UTTD 1HKLH 2VDKH 4RDQG 3BH9B 3OHXA 3MLWL 4UI2A 2UWEB 1CYGA 1MFEL 1S7QA 3CCHB 3OKEB 4X8JA 2H9GA 1NCTA 2NXZD 4NN5B 3VFRA 5SWQB 2AQ1A 2MSPA 4I3RH 3O2WL 4D3CL 3D85D 3ARBD 3VGFA 4JFPA 1E6OH 2X4UA 4U33A 4IOFD 1WBYB 5F7NC 1UWGL 4MGXA 4GMSL 1CICB 1XGPB 5IVXE 1FNGA 1LD9A 1NEZG 5I6XC 5JXAL 3BKCL 4YQXH 2YPVL 1S9WA 4ZUTA 5I1EH 4MNGA 2F19L 4J6RH 3BYTA 3VFVB 4O02H 2DTML 3EIFA 1HH6A 3DHJA 2IBZY 1EBAA 4ZO6A 1HXYA 2HJKA 3LDBC 4TVSa 1GGBH 3G5ZA 5KSAB 4XHJD 3ZHKA 2CXGA 2J4WH 5EN2B 5ESAA 4GSDL 3VXRB 3VXOB 2Z8SA 4HZLB 5IVNA 1HNGA 4M3JA 3C08H 4XH2A 1F6AB 5JZ7D 1OAZH 4X99A 1HYSD 2LV4A 5D2NB 2KBGA 3QWOB 4P99A 1C16B 3F5WB 2VLJA 1A7PL 1F97A 4WJ5A 4GRWF 3F7VA 3HTLX 4CVZA 4YAQA 4UV7L 2PO6D 3U0TB 3EW3B 3NCBB 2J88L 5L8KB 4L29B 1SM3H 1EFXA 1FC2D 1FO0B 1GZPB 2EKSB 2P5EE 4NNPH 4UBDD 5E9DB 1KGCD 3Q6FB 4PG9B 5GGRA 1V3KA 4P57B 1CGWA 5D5MF 4OIIL 1ZT4A 4W81A 3QDGB 5I19H 4HD9A 4PS4H 1OLZA 2Z4QA 3VI3F 3MR9A 4XHQA 3D0LA 4JY5H 3RVXD 1C5DB 4TPRH 4XMKL 4I3GA 4NKOB 5I8EB 1SVCP 1S8DA 1X3DA 3ULVL 4Y2DC 2EXWD 3S34L 1MWAB 3LKRB 3VI4F 2P43B 3KR3L 4PD4K 3IU3B 3O41B 1Q0YH 4UOW1 5AEAA 3R0NA 2WNGA 2H32H 5IT2L 4AH2A 4IRJB 1Y18B 2BVTA 5BXFB 2ARWA 1G7QA 3LS4L 1C5CL 1WV7T 4DN3L 2WM0A 4L3AA 4DZBB 1NANI 1U0QA 3NOIA 4UT9H 4ODSH 4AEHH 4OCYL 4Q9QL 3VXUA 1EGJA 2ERJB 1ZVYA 1O7VA 2PXYC 3B9KD 2AXHA 5C0BD 5F1IB 2FIKB 4G8GE 5CMAA 3W0WD 1NQBA 1VEOA 3SDXA 3QIBD 4NO5A 5D93B 1KCVL 5C0FB 5DUML 4N5EC 4Z95H 5HHOE 3PWPA 1ZLWH 4HBCH 4HEPG 4ZFFB 4OZHF 5FO8A 4H0GA 3IYLW 1XF2A 5H8DA 5DJ2A 4XI5D 2WBWB 1EAJA 1NBZB 2YD5A 1BGXL 5DD6A 1CFNB 2AJSH 3ZSSA 5KVDL 1NCUA 1WCBB 3V6ZA 3WXWL 4XGZB 2A6KB 3T2NL 1EMTH 2B4CL 4IIQA 5IW6A 1HHKB 4X98A 3VRIB 5C0RL 1PX4A 5SX5H 1IM9A 5B3JF 3QFJA 4ZNCD 1AY1H 4PRPB 1EDQA 3OB0K 4DTGL 4U6TA 4YXKL 4LSPL 5JHLL 4S0TD 2VDLH 1I3UA 3HZKB 3S98A 1DTUA 3RWIA 5JDJA 4I13B 3RTQB 1BBDH 3IGAA 2DLFH 3C6LA 3GMRB 5T3ZL 3QNYB 4X0KA 2EDWA 3KPQA 1NEZA 2A9NH 1IQWL 1CDCA 5SWSE 4QHLA 5KSVB 3DTXB 4YGAB 4GG8A 4AJ0A 2OX5A 5GJTH 5HI5C 4NYLA 4L4VD 5HHMA 4GRWH 1NLDH 3IDYB 4YBQD 2PYFB 4O5LL 1CZ8H 3FQNB 5C9JB 4V1DA 1U42A 1RU9H 1MHCA 3TPKA 1KENL 1U3HB 4JY4A 4NDMB 1TZHA 1G7PA 4R7NA