4ELMA

Crystal structure of the mouse cd1d-lysosulfatide-hy19.3 tcr complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
273
structure length
266
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type II natural killer T cells use features of both innate-like and conventional T cells to recognize sulfatide self antigens.
pubmed doi rcsb
molecule keywords Antigen-presenting glycoprotein CD1d1
molecule tags Immune system
source organism Mus musculus
total genus 61
structure length 266
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4elmA01
2R1XA 5KG9B 4N0UA 4XNZB 2HTLC 1XGRB 3RUGE 4RZCA 5FYJH 1RQ5A 1KJVB 2DWDA 4KWUA 4IOIA 4LSTL 5IGXL 1LWRA 2XWJA 3DX8B 2JCCB 4M1GL 4D2NA 2AV7B 1K5NB 1FDLL 4L8DB 3H2WA 5E00A 5I73B 1SEQL 3LB6C 5EO9B 1CDCA 4X4XB 1NGYB 2MKWA 5TPWL 5DFWH 5JA8B 1VERA 4LDOB 4HLZG 3S98A 1HOCB 3BWAA 1CF8H 2KUTA 3DWTA 4FFZH 1WBXB 3UXFA 4NZTH 1FNSH 2DMCA 1KSRA 4XVJH 4QHUB 3QWRA 3NFSL 15C8L 5DGQA 5ADOL 3KAAA 1S7VA 1MY5A 4TUKL 2EC8A 1AO7D 1X5KA 3O41A 5CJXC 1LE9A 1MUJA 3VI3F 1HNGA 5BZWB 4ZD3L 1NC2A 3TO4A 2CSPA 4QHKI 1KENL 3MRPB 4YHOH 1RZJC 2E6JA 4PJ9A 5BQ7A 3F7VA 2VLJB 8FABB 4HK0A 4GLRH 2OL3L 1WIUA 2IG2L 2VC2L 3I6LD 3UZVB 5GXBB 2DQFB 2EXYC 1X3DA 2DQEL 3FO1A 4RA3A 3EYQC 3P0YL 4KJWD 2NZIA 4AIOA 2P44B 3LV3B 5EU6D 3RGVD 1A47A 3EOTL 3TN0B 2NW3B 3S5LA 2DI8A 3DMMC 4MB3A 2NX5E 3I9GL 3T4AB 1IEBB 4ZQKA 5GS2D 3TEUA 4U33A 4Z18A 4LLMA 4XCYA 4XAKE 3WFCH 1G84A 3WIIH 4MD5B 3HNTL 1NSNH 3FB8B 3L3HA 5DQ9B 4NDMB 3MREB 3OKKA 4ODBD 5IBLD 3EDEA 5C92A 1NEZA 5T3ZL 2OP4H 2VNCA 3PWLA 3UTSA 1E0OB 1QFWH 3WO4B 5EORH 4ZFGH 3VFOA 2EYTA 4GW5A 2DQDL 3MUY1 3ARVA 4YQXH 4RMUA 1NCDH 1QPPA 2H32H 4XXCA 3CX5J 3O4LA 3VXUB 1AQDB 1XAUA 1YEFH 3BKMH 1VPOL 4KKNA 4JKWA 1Q9WB 5KSVB 3BO8B 3GI8L 4LHQB 5FA3B 1V3LA 2IH3B 3SGJA 3NFPB 1FCCA 4X7SL 3GJFH 4ODVL 4G43B 4DVBB 2FX9L 2V2WA 5FYJE 1YQ2A 4XPHL 3VXSB 2F5BL 1FNAA 4N0RA 4LSTH 4PGDB 4PLNC 4CMMB 1IEAA 1DVFC 5IGXH 3V6OA 2ICCA 4M1GH 4RFNB 1T0MB 3CAFA 1FDLH 5ISZA 1SEQH 4KH2A 3O0RL 4L3ED 1GOGA 1CGYA 3CFBA 2VDNL 4F9PA 1AGDA 3RP1A 4DKDC 1K2DB 3O9WC 1U91A 3EYFB 5TPWH 1VFBB 3KXFA 3RZCD 2ORBL 3QDJA 4ZO8A 3HZKA 5D1ZB 3LKPA 3QULA 4R0LA 4YH6A 2HLFD 1E27A 2A0LC 2E3VA 2E9IA 3G6JF 3NFSH 15C8H 1U9KA 1HHIB 1YN6B 4ZOBA 5ADOH 4PPTA 1WBYB 3KLAB 1UM4L 1Q94B 1L0QA 3FZUC 4TUKH 1JPTL 3QEQA 1BJ1J 4YXKL 2HJKB 5BCAA 1GGIH 1SJEB 1EV2E 2ZNXA 1ADQA 4OLEA 2CLVA 3FTGB 4ZD3H 1N6UA 3I3BA 4M1CD 1KENH 1G6VK 3UP1A 3CZFA 3PL6C 1RY7B 1JFMA 2VLMD 2PF6A 4TRPL 2OL3H 1BOGB 2R2EB 5F1NA 4NP4L 1U8OA 5C09A 3SKOA 1I8KB 3PF2A 4B41A 1FO0B 1ROWA 2DQEH 4KZEL 1TZHA 1EVTC 1FV1B 1KIUA 3P0YH 1IAKB 1VEMA 1DN2A 3H9SB 4WW2B 1GL4B 3EOTH 3B8YA 2HYMA 4OKVA 1QO3A 5FDWA 4GRMB 3I9GH 1HHKA 5DVMA 3RL1B 5FF6B 4G9DA 1QSFA 1NGXB 5JPMB 1G7QB 2VMFA 4JHBA 3HNTH 1CDGA 1OSZB 4LSQL 4FN0A 5TDPB 4UB0L 3VXMA 1K9TA 1WIPA 3IF1B 3MZGB 3CVHB 4PJ8A 3LPWA 2YMXL 3KPRB 1MJJA 3LN5B 5T3ZH 4QRSB 4H0GA 4JDVA 4WU5B 1ZLUK 5LGKA 3ULUF 5GS1C 1AGFA 3BDXA 2DQDH 4WI8A 4FNLL 4UU9A 4WGWB 5C86A 1ZMYA 2DKSA 5EBMA 4Q9RL 3QWRD 4Z7VE 3QJFB 4XVUD 4CKVX 5CMAB 1RK1B 3TV3L 3KHOA 5KVEH 1VPOH 3NA9L 3GI8H 4R4BA 3OKDA 3HE7B 3GM0A 1UXSA 3HCVB 1NC2D 4DZ8A 5F7MC 3TO4D 4X7SH 2HAZA 1MH5B 1WBZA 4ODVH 4PJ9D 4PBWD 2UWEB 2FX9H 5MI0C 4G7YL 1OTTC 3DARA 3P73B 4H1LA 2W0FA 4XPHH 4F7MB 2F5BH 4RISL 1CE6B 1ODAA 1RHHA 2BXZA 1HH6A 4IHOA 2PO6B 1QLRA 1AP2A 4XZUB 1NQBA 3KYNA 3O0RH 5K93A 5C1MB 2VDNH 3FAWA 3GMRB 2BC4A 5C0JB 2GJ6B 1ZLVH 1CXHA 2ORBH 2CQVA 1A02N 2OTPA 2YC1B 2E9JA 2BVQA 5F6IC 4E41E 1KELL 5DHVA 1Q9KA 3MR9A 5CP3A 2FHBA 2V5RA 1K4CB 3BE1L 3EBAA 3MJ9A 4PJEB 1UM4H 4D8PB 3TF7A 4LHJB 1F3DJ 4FXGA 4BZ2L 1JPTH 3MRBA 4JFFA 2DBJA 3LKQB 3BZFA 4JQVA 3UTSD 4TULL 4MX7B 1G7PA 3VFVA 3QDMA 2ESVE 3L3IB 4JFHD 4WUUB 1S7TB 1BLNB 4I18A 4WI5A 3O4LD 3MV9E 3B2UD 4P49A 1P4BL 4TRPH 3FQRA 4E9LA 3QHZL 4LCWE 3AU1B 3I3EA 4NP4H 5I1CL 5MENB 4Y4KA 1F4XL 3CU7A 4KZEH 2OSLA 4KKBD 1T20A 4P5MB 5C9KA 1WAAF 1XCTA 3G5ZA 3VWJC 3OKMB 5C0BB 2HT2C 4LF3B 1S7WA 4GXUM 3DUUA 1K85A 1UQSB 5C0ND 1BQLL 4FQXC 3WS3A 4PRDA 3RTQA 3KPOA 4BK4A 5DMKA 4Z9KB 1BAFL 5CINL 3P40A 3QP3A 1KPVB 3HC3L 4K3HA 3RY4A 2Q3ZA 1IKFL 1D5BA 4LSQH 3AGVA 4FFWC 5ISZD 4UB0H 3FFCA 2VUOA 1VESA 2YMXH 5GRJL 2IAMB 4KJQD 1GC1C 1J8HB 2DJ4A 3KXFD 2NPLX 3S9DB 3QDJD 2NY0C 1XCQA 4O00A 4BSJA 1YNKL 4N0YL 3KVQA 4PYHA 3T0WA 1LD9B 2HG5B 5H94A 4FNLH 2VXUL 5GGQH 1IGFL 5C08E 4Q9RH 4MCZA 1R3LA 4YDLC 3GMOB 3QEQD 2YA0A 3TV3H 4MJ6B 1MFAL 3NA9H 1GXEA 1DQJA 4EI5A 1AD0B 3G6JA 1B4RA 5D7IF 1T5WA 4HPOL 1AIFB 4OCMC 5ERWA 4G7YH 4FQHB 3SDDC 1J1OH 3DYOA 4X6DF 1ZGLB 4RISH 1FPTL 4G8FB 4LLDA 1BP3B 3CSBA 5C09D 1T1ZA 5HI3D 2Z35A 5C0AB 3LS5L 3SE8L 4HS6B 2VAAB 3EW3B 3EDKA 3ZMRA 4X7CC 3F62A 2YUVA 3KLHC 3JXAA 5IJKA 3BGMB 4KROB 4EKXA 2ZCLL 2C26A 4P99A 1NUFA 1QSFD 3TZVA 4OLVL 3SGDH 1KELH 2AXGA 2HKFL 5DXWA 3SDCB 2WANA 4H26B 5DS8B 5IBUB 4JGMA 4UDTB 3BE1H 4C4KT 3VXMD 1ZK9A 4PJ8D 5EOQL 4BZ2H 5ICYA 1YDPB 4HUUA 3RIAF 3EYSL 2OR7A 3JUYA 3TFKA 4GMTL 1A7PL 4QT5A 1BEYL 4L9LB 5DI8B 1VKXA 3B3IB 4DOHE 3EFFA 4TULH 2FJHA 3PDOA 3TO2A 1W0WA 3BFOA 1HHJB 3WS6A 4NKMB 2NY2B 4I0KA 3BKJL 1Q9LA 1P4BH 2HRPL 3QHZH 3LKSB 1S78D 4JO1L 5I1CH 4RAHA 4ZOAA 1F4XH 5DUBA 3X13A 3SE9L 5I1DA 2BNQA 5IB4B 2Q76A 1S9YA 3DI2B 5IFAL 4WW2F 3MXVL 3BMWA 4R97B 1VGKB 3BKCH 1VA9A 2WUBL 5F7HA 1MCHA 3LHPL 4CAGA 4PJ7E 1BQLH 2PYEE 4R7DA 5H35B 4I4WB 4GXUN 1BAFH 2KZ1B 5FIEA 3O4OB 5CINH 4PLJC 4BQCA 3HC3H 5KG9A 1IKFH 1B9ZA 1XGRA 1AR2A 4I77L 2FIRT 1KJVA 4WWKB 5CIPB 1XH3B 2VDQH 5GRJH 3DX8A 4O02L 2JCCA 2AV7A 1K5NA 1TETL 4EIZC 4BZYA 4L8DA 1YNKH 4N0YH 5FAAA 2XKUA 4JY4B 4Q74A 2OTWB 5EO9A 4RGNE 1IGFH 5KBNC 4X4XA 1NGYA 3QIBC 1S5IL 1HOCA 3X14B 5GS0L 1WBXA 4KK8D 4HV8B 1OPGL 1MFAH 4HSQA 3UCRA 1I1AC 4JFFD 1DQTA 4QHUA 4YO0B 3G04B 4LCCC 1CGWA 3QDMD 4HPOH 4FQJL 1JF5A 4O4YL 2YR3A 3RY6A 3DV4B 3ARWA 4FXKB 2VH5L 4DK3A 3NCMA 1FPTH 4O58L 4KXZI 5BZWA 1MIML 3MRPA 4Y4KD 2RGSA 1TNNA 3LS5H 3SE8H 3DROB 1NUNB 2VLJA 8FABA 1A7NL 3ZE2E 2AQ1A 3PP3K 2FCBA 3GSXB 1B6UA 4O2EB 2DQFA 3W0WB 1I3UA 5ESQB 3UDWC 4JFXB 2NY5C 2J88L 2ZCLH 3ULUL 4FQ2H 3RTQD 1IZKA 1BFOB 4MQ7B 3EJYD 1WAAA 4OLVH 4F9LA 3LV3A 4R9HA 4YHIB 4CJ1A 3TN0A 2NW3A 1U3JA 1HXMB 1A7BA 4PJEF 3FFCD 2ITCB 4PLKD 3T4AA 1IEBA 3PWPE 3DPBA 5EOQH 3EYSH 1HH9B 4GMTH 1A7PH 1BEYH 4MD5A 1NMAL 3FB8A 4ODSL 5B4MC 4J3TA 3VMNA 5DQ9A 1ZGLP 4HH8A 3BPOC 4NDMA 3MREA 4FP8L 3ULVL 1QBAA 4NO0B 1IILE 4JPIB 5I1IL 2HRPH 4JO1H 3MRRB 3MRLB 5AZ2H 1QRNB 4JN2B 5CJQL 4EI5D 1OP3K 3SE9H 3DXAB 1BMGA 3VXUA 5IFAH 1U2CA 5DO2D 3MXVH 1AQDA 1SQ2N 3MMEB 1A6WL 5J11C 1Q9WA 3LHPH 5KSVA 2V7NB 3BO8A 5FA3A 3QRFM 1FVCB 4POZC 1GGCL 2IH3A 2EE3A 4LFHD 4HZAA 3NFPA 1G9NC 1P6FA 4GSDL 3VFSB 4G43A 4DVBA 3MRFB 2Y72A 1BIIB 2W0PA 4I77H 4S1SL 3VXSA 4RWYL 3ARDB 4PGDA 4CMMA 1OAKL 3HC4L 4O02H 2VQUA 1TETH 3MRDB 1T0MA 1MLCB 5B21A 5JHDE 5GZNC 1J1XL 3TZVD 4FFVC 5H8DA 4G5ZL 3EOBB 3RHWF 1K2DA 3EYFA 2FO4B 4OGYL 3HKFA 3CLEL 2ATPB 2CRZA 1S5IH 1VFBA 2NMSA 3FB6B 4NBXB 4YX2L 1MEXL 5D1ZA 5GS0H 2ZG2A 5FYLE 1YZZA 3BZDA 1OPGH 1MRDL 2EC9T 3TFKD 1UKTA 2CMRL 3MACL 4JVWA 3C5ZC 4LLAA 3ZT6A 3D39B 3C08L 3ALPA 3E2HB 4R2GB 3T3PF 1HHIA 1YN6A 3RVTC 3S36L 1WBYA 3KLAA 1Q94A 5GSRB 4FQJH 1LP9F 2X4QB 3AY4C 2HJKA 2NW2B 1CL7I 3JTSB 5F3BB 1SJEA 2FEDC 1CFQB 4NNXB 2VH5H 4OM1L 3FTGA 4O58H 4D0DB 3ARYA 2BNQD 2D2OA 2EZ0C 2B20A 2R1YB 4OI7A 2NXZB 1A7NH 3NIDF 4FQLL 2AS5M 4KI5F 1BOGA 5F7NC 2R2EA 1BX2B 4WDIB 1I8KA 2AK4E 1FO0A 2J88H 1N0XL 3ULUH 1FV1A 4XTRD 1IAKA 1EH9A 4WW2A 3H9SA 4MDIB 4U1SB 4PJDE 3L95B 4ZO9A 4MQXC 4GRMA 2AI0L 4HHAB 1P4IL 1AHWB 3MTRA 3RL1A 4APQC 4EDXB 5FF6A 5HHQB 5DUML 4UTAL 4FG6C 4S11A 1NGXA 5JPMA 1G7QA 3L3DB 3OKLB 1NMAH 3WN5C 1OSZA 5TDPA 5I6XC 4K71C 1IGTB 3IF1A 3CVHA 1Q0XL 2IPUK 2MOVA 2ILLA 4FP8H 1EFQA 2W9EL 4JLRB 4XWGL 5A2JH 3ULVH 4KFZC 4D9QD 3KPRA 3C2SA 3LN5A 3GSWB 4QRSA 1G6RB 3RWDB 4WU5A 5GGTA 5I1IH 3BPLB 3R8QA 1DQDL 3VXQB 2C3VB 5CJQH 4JHZA 1KEGL 3QJFA 5CZKA 4L8BB 5L2JB 4LCUB 5CMAA 4D9RD 1I1RA 1RK1A 1LVEA 1A6WH 1QQDB 1XGQB 4ZS6C 1TJGL 1TJHL 3OGOE 1GGCH 5D96B 5DJ8B 3HCVA 4RBPK 4LEXL 1A7OL 1MH5A 1A9BB 4GSDH 3ZKXB 1CFTB 2UWEA 1CE1L 1NFDE 2VLJD 3P73A 4IMKA 4RWYH 4S1SH 4F7MA 2XA3A 1CE6A 4ZXBB 1OAKH 2PO6A 2P43B 3HC4H 3BD5A 2PXYC 1EJOL 1RFDL 4QXTB 5HDOA 4XZUA 3VFRB 3ARUA 4H8WH 1J1XH 2ZCKL 1AE6L 4C4KO 5F7DB 3GMRA 4G5ZH 3TN0D 4N1HB 5C0JA 4OGYH 3CLEH 4NRYB 3ZT7A 2GJ6A 2XACC 1G7LB 4YX2H 3OKOB 3GUTB 1MEXH 1T83C 2YC1A 1MRDH 1CXKA 2CMRH 3MACH 2ADIB 5J6GB 3C08H 1FL6B 2XN9E 1K4CA 4EUPH 4PJEA 4D8PA 3QJHB 1OAYL 2A1WL 4TVSa 1FYTB 1PZ5B 4NRXB 3LKQA 2APFA 4MX7A 5JORB 4OM1H 2VLRB 3H9YA 4I9WD 2NY1B 3L3IA 1NGQH 1WVZA 4WUUA 5BZDB 2FEEL 4PY8J 1S7TA 1BLNA 3VXUD 1TQCC 4FQLH 4H0HB 4LGRB 3AU1A 1ETZB 3HE6C 5MENA 4UV4L 5JIPA 1IKNC 1JZ7A 4ENEC 5IHLB 1N0XH 2Z92B 3NAAL 1A6UL 4P5MA 3GNML 4Y0GA 3OKMA 5C0BA 4LF3A 3WDIA 5AG9A 5DJ0B 1UQSA 3VXSD 1LE5B 1P4IH 4HX1B 4C56B 1QG3A 4HFWB 5DUMH 4UTAH 4XCCL 5MEPB 3K74B 2VAJA 5DD5L 2COQA 1KPVA 3BYTA 4QLRA 5F3HB 1S5HB 1AH1A 3DV6B 1Q0XH 4XWGH 2W9EH 2WZPD 4N5EC 4IOFD 2CO6B 2IAMA 4KRPB 4M6AA 1J8HA 2YSSB 1XGYL 5D1ZD 1GGBL 1DQDH 4HUMB 1LD9A 1PEZA 2HG5A 4J4PA 4AG4L 4U2YA 4MD4B 2VTFA 5I2IB 3WXVL 1EUTA 1KEGH 4TTGA 3KJ4C 4QRUB 5GGSB 2MMXA 3GMOA 4MJ6A 1TVDA 1TJGH 4B53A 1H3GA 1LK3L 1E6JL 1TJHH 1IT9L 1AD0A 4LMQI 4Z7NF 3HPJB 4LEXH 4K9EL 1A7OH 4W81A 1AIFA 1CR9L 1QBML 2UV3A 4CMHC 2BNRB 1UWXH 1DUZB 3QEUB 1CE1H 1NKRA 4LSUL 4FQHA 5EBWB 5JTWA 3O2DA 5EC2B 1ZGLA 5IB3B 4MXVE 3SPVB 4G8FA 3GMMB 3L7EB 5I17B 1EX0A 4YIQB 4KK9D 1EJOH 1RFDH 1H3PL 2DOCA 5C0AA 3LH2L 3S7GA 4HS6A 2VAAA 4PJIE 3H9SD 2ZCKH 1AE6H 5C0CB 2YD7A 3P11L 5BJTB 5CKGA 3GSNB 3BGMA 3QI9C 1CICC 3VGFA 1SJVA 1O7VA 4MNQE 3P9WB 1EJ6A 3SDCA 2RJMA 3QA3A 5HSFA 4H26A 5DS8A 4YHLL 1U3HC 4UDTA 2QR0B 4EBQL 1PG7X 3SKNB 4Z7QF 5DEZA 5FO7B 4NGHL 1OAYH 1YDPA 1RUKL 2A1WH 3BSZH 4WFFD 3KPRD 3QZWG 1MAKA 4L9LA 4JRWA 3ZO0A 4AEIL 1XF1A 4GBXB 2ED7A 5DI8A 3B3IA 3V5HB 4LEOB 4XHJC 1GZQB 3C6SB 4OQTA 4WY7L 1HHJA 1NLDL 2YUZA 4NKMA 4JFDE 3KDMB 2JE8A 2Z8VC 2EDOA 3LEVL 2YXFA 4HWBL 5I1EL 5IK3B 4HJJL 4N8PA 3LKSA 3B9VA 1NJ9B 4ZSOA 4EDWL 4XMPL 4UV4H 4LLVB 1YEKL 3HE7D 5DJ6B 5IB4A 3QUXB 1T7VA 1RJZB 3NAAH 1A6UH 4PGZA 3WD5L 3GNMH 2ZSVB 1VGKA 2JJTA 4ZPVB 1MPAL 3O3EB 1IAMA 4KVCL 4NC1E 4XPTH 1OTUC 5H35A 2YPLB 2C4XA 3QT2A 4I4WA 1Z9MA 4XCCH 2PO6D 3L1OL 1FNHA 5DD5H 5I0DA 4IRSC 1ACYL 1X5ZA 5IHZB 5IKCB 4PS4L 4M02A 2XQYG 4HT1L 3HUJF 2HN7B 5CD5C 4WWKA 5CIPA 1XH3A 2GJ6D 1QPXA 2AEWA 1XGYH 1EEQA 1H8OA 4K94L 4U31A 5LCVL 5SX4H 4MCYB 3VH8B 1GGBH 1RU9H 4GS7C 1FG2A 4JY4A 1OVZA 2OTWA 2I07B 5IEKB 5EO1B 3VGAC 4Y16C 3WXVH 5ESVB 1UA6L 1PKOA 3X14A 2ICWJ 5C2UB 4U1LB 4QHMB 5TH2B 4HXAL 4MA1B 4HV8A 1OP5K 3BD3A 4ODXB 5FGCB 4YHKL 3GIVB 1E6JH 2M1KA 1IT9H 5CEZL 4NQEB 1RUML 3G04A 3FO0L 2P5WB 3S35X 4K9EH 2MHAB 2Z91B 3QUMB 2VLLB 1CR9H 1QBMH 4WUUD 4LPCA 1KTRL 4LSUH 2H6PB 4C54A 4M3JA 2C7UB 3DV4A 5HPOA 5I75C 2CXKA 2PYFB 4FXKA 4LNRB 5IB2B 5MEND 1CTOA 1H3PH 2X70B 3JSSA 3DROA 2W91A 2NZ9C 4P4RB 5DA4A 1BBJB 2VXVL 5I16B 4HK3J 4UV7L 3P11H 3KPQB 2Z31C 5C0BD 3GSXA 4O2EA 3W0WA 1R24B 5ESQA 2L7UA 4JFXA 2EDRA 4TSBL 1BFOA 3QDGB 4MQ7A 1JYNA 5ACLA 3UTTE 2DQUL 5JIKA 2E6PA 4YHIA 3PGCB 4M6ML 1HXMA 4YHLH 2C5DC 4EBQH 4PV9B 3QUKB 2ITCA 5JXEA 2ED9A 3QSKB 5D5MB 4NGHH 3I75B 1RUKH 4XC1L 1CD8A 1HH9A 2IAMD 1J8HD 4AEIH 3D87B 4WY7H 2FBOJ 3O8XB 4NO0A 1NANH 1NH6A 3OAYH 4JPIA 1TZGL 3LEVH 4HWBH 5F9WC 5I1EH 4UT6L 4PJBB 1LO3L 4HJJH 4RGOL 3MJ8B 4M9OA 3HAEG 3MRRA 3MRLA 4EDWH 1G0DA 4JKLA 1QRNA 4JN2A 4P2QE 4XMPH 1YEKH 3QWQB 5C07B 3DXAA 1R0AL 4ELKB 3WD5H 3QIWC 3MMEA 1MSPA 3SBWC 4FS0A 1HYSC 4X4MA 4PJHF 2V7NA 4OZIB 1FVCA 3DVGB 4KVCH 5L6YL 1X9QA 3L6FB 3N06B 3CK0L 3L1OH 2Y1VA 5C0AD 3VFSA 1ACYH 3MRFA 1BIIA 1GGTA 4PS4H 3ARDA 4HT1H 5J1TC 4CADB 3ZDXE 2LFGA 2ZUQB 4KKCC 2P8PB 4L8SC 1SBSL 3MRDA 4K94H 4KROD 1MLCA 5LCVH 5F9JB 2VB5A 2PTTB 4X6FB 1MCBA 3EOBA 3SDCD 5IOPB 2F58L 2FO4A 1UA6H 2ATPA 3FB6A 1JBJA 4WW1B 5E56A 3NCBB 1G0XA 3O6FC 4Q9BA 1XF4B 4K2UL 4HXAH 4YHKH 3D39A 3QG6B 5A2IH 3E2HA 1U8HB 5CEZH 4HIJB 4J3VA 4LIQL 2ZUXA 4YPJA 5J12C 4NJAL 1FNEB 5GSRA 1CDYA 1WUNT 4Q97A 2X4QA 2A77H 2NW2A 2NY2D 3NZ8B 5GGVY 3T8XA 1FIGL 3JTSA 3GZKA 5F3BA 1KUMA 6CGTA 1CFQA 3BP7B 2R29L 4NNXA 4D0DA 3QXWA 4S2SB 1MRFL 1BHGA 2VE6B 2R1YA 1UEMA 1SMOA 3X3FL 4P57B 1EUUA 3IDYC 2VXVH 4UV7H 1BX2A 4X8XA 4WDIA 4YDJB 1PDKA 1X4ZA 4PJAF 3FFDB 1ZANL 3RVXC 2AQ2A 4TSBH 1PKQB 4KK5C 2W9LA 4MDIA 4U1SA 5FECB 4GG8B 2DQUH 3L95A 1WFTA 3IU4L 4M6MH 1H8SA 4BFGA 3DTXB 1SMAA 4HHAA 2HA1A 1AHWA 2X4PB 4EDXA 5HHQA 4WWKD 4LOUC 3SDXE 4JFYB 1MY7A 4P2OC 5EU7C 3L3DA 1KCGC 4K55A 3RKDC 3OKLA 4NRZB 1MREL 3GM8A 1IGTA 2QQQA 4JLRA 3DI3B 2AERT 3GSWA 4YE4L 4MS8C 1TZGH 3RWDA 3CH8A 4WI6A 2P4AB 2VWEE 4UT6H 3MSPA 1LO3H 5C71A 2Y9RT 4RGOH 1PVHA 2A38A 2B1HL 2IBZY 3VXQA 2C3VA 4J8RB 4JQIL 3DMMB 4LDEB 4MYWB 1KB9K 4L8BA 4UZGA 5E9DB 5L2JA 2HT3C 3MJ7B 1QQDA 1XGQA 1HI6B 5HVGB 4JJ5B 2J2ZA 1AO7E 4K8RD 5IMLB 5DJ8A 3RA7L 5L6YH 5L8JB 4QY8B 3CK0H 5GHWL 3RKPA 1X5JA 1A9BA 2F8XC 3T2NL 2UY6A 3BN9C 2WWKO 1CFTA 5J0BA 1ED3B 3OG6B 2Q20A 2FDBP 5DUPL 4PRPB 1NBYB 3ILQD 4HMEA 4ZXBA 1FNGB 1PBYA 3E6HB 3IU3B 3ARFC 3W0WD 3I6LE 2APWA 4QXTA 4KJPC 1SBSH 4P59L 5HYSG 2Z4QB 3VFRA 1EVUA 3F5WB 4OM0L 4P23C 4GO6B 5F7DA 1U8NB 2Y25A 5DMIL 2F58H 3FO9B 3BN3B 5EU6E 4B7IA 5I19L 4NRYA 1EHNA 1G7LA 3OKOA 3GUTA 5JXED 2X4SB 4K2UH 3FJTA 4B5EA 3WLWD 1A0QL 3TH3T 2Y6SD 2ADIA 5J6GA 1FL6A 1JMZA 4EIGB 4LIQH 5E5MB 3QJHA 4NJAH 1OGAB 5F9DC 4UAOC 1FYTA 1PZ5A 1FIGH 4NRXA 2EYSB 3QIUC 5EC1B 3TIDB 2R29H 5JORA 5FGBA 3D1MC 4LCYB 1QRND 3O9WB 1G0YR 1JNHB 2VLRA 3DHMA 1MRFH 5BZDA 3DXAD 2V9TA 3IJHB 5GGUB 3W39B 2WIMA 3X3FH 2EIZB 4XP9L 2YD4A 1H3UA 1ETZA 4AENB 2DLHA 4PJXB 4NNPL 4X4YB 2Z92A 5ILTL 4BUHA 1ZANH 1S9KC 2E7LC 3TH2T 1IJ9A 1CT8B 3IU4H 4LP4A 3PHQB 3RX7A 5DJ0A 1LE5A 2VIRB 2AJVL 2E7HA 3ARDD 4HX1A 3VRLE 4C56A 4HFWA 5MEPA 2YKLL 3GMLA 1A5FL 3PL6B 5F3HA 1S5HA 1MREH 3DV6A 3M1BB 4LSRH 3ZDYE 4X9FA 3GBNL 4OLWL 5FXCH 1RULL 4L3EE 5SWQB 3QEGH 5IQ9B 4X9HA 4JB9L 4YE4H 2YSSA 3K81A 3GK8L 3S5LG 3DRQB 4PJBF 1FIEA 2B1HH 2FH8A 2N7AA 3V95A 4JQIH 4HLJA 1S9WB 3D39D 1AGCB 4MD4A 4R2GD 5I2IA 4QXUL 5KOMC 5IESL 2JJSA 5J56B 1B3JA 3LD8C 4QRUA 1R5WB 5GGSA 1R3IL 4G8GB 5IROA 1ZE3C 1QZ1A 3QO1B 4OZIF 1NEZG 3RA7H 1WEJL 5GGSY 3HPJA 5GHWH 3T2NH 2BNRA 4W4OC 1DUZA 3QEUA 2NXZD 5DUPH 5E03A 1ORSB 3ZE1E 5EBWA 5GS1B 2FHCA 4R4ND 1GVIA 5EC2A 4NUGL 5IB3A 5B22A 3SPVA 2VLME 3GMMA 3L7EA 4LKXB 4HS3B 4YIQA 5I17A 4X6CF 4RMRA 4PG2C 4P59H 2Y06L 5B38B 3TYFB 3HI6L 5GQBA 5C0CA 4OM0H 4KV5F 4YHYC 1F3RB 5DMIH 5BJTA 5I19H 2PW1B 3NPSC 5BXFB 4JFEE 1QYGL 3MV8B 4N0UE 4OCWL 3TH4T 4HXBL 1H3TA 1F2XK 2KPNA 4M3KB 3S37L 4RRPA 5MI0B 1A0QH 3NIFE 1T6VN 3ARRA 2QR0A 3AS0A 3SKNA 3GBLA 3F6IA 5FO7A 1JZ8A 1JVKA 2DI7A 4V2CB 1DP0A 1PY4A 1JV5B 4P4KC 2CKNA 4GBXA 1SBBA 1N7ML 4LEOA 3V5HA 1GZQA 3C6SA 4KGLA 3QRGL 1EEUA 5B3JE 5LXGL 1JI1A 3KDMA 4HH9B 1T80A 4YFEA 4XP9H 5IB5B 5F6IB 5IK3A 1NJ9A 4NNPH 4LLVA 4NQXB 3M07A 1ZEAL 5DJ6A 2H9GB 4H5SB 5ILTH 3QUXA 1RJZA 1NKOA 1T2JA 3QPQC 3VGBA 1QEWB 2ZSVA 4ZPVA 1QR1B 4Y1AB 2FGWL 2M2DA 1EEYB 3O3EA 3ETBF 2AJVH 2R1WB 3LVEA 4ZXBD 2YPLA 1ZA3B 2YKLH 1A5FH 4X9BA 5CILL 3WMSA 2J8UF 3ZHDA 5IHZA 5IKCA 4EQ3A 1FL5B 3ULUC 4N0FB 1YC8A 3GBNH 4OLWH 2HN7A 2DN7A 5KS9B 1RULH 2AKRB 1D6EB 1U3YA 4C83B 4JB9H 5E94B 3F8UB 3SE4C 3CPLB 3GK8H 3F7QA 4MCYA 3VH8A 1W72L 3VWJB 1CDUA 2I07A 5IEKA 2Z93B 5EO1A 3UBXG 3H3PH 4QXUH 4FQXB 5ESVA 5CZVL 5IESH 1HHGB 3WFZA 1WJ3A 1R3IH 4U1LA 4QHMA 5TH2A 1JPFB 4ODXA 1FYTD 3GIVA 4O5LL 3ULVC 3HFML 5DSCB 5DJCB 4P9HL 4NSKB 4NQEA 1WEJH 3UTSE 5ICXB 2P5WA 3RPKA 2VLRD 1BFSA 4OGZA 3RGHA 2MHAA 2Z91A 3N1QC 3QUMA 2VLLA 1IFHL 1U8LB 2NY1D 3CVIL 4FQPA 4S10A 1S9XB 2H6PA 2NY0B 4L4VB 4JFHE 2C7UA 4NUGH 1DLFL 4X0KB 2PYFA 1A6AB 4LNRA 2JJWA 5IB2A 1HEZB 4OT1L 3KPNB 2BOCB 2X70A 4YDLB 4FFYL 3OR6B 2Y06H 2KH2B 4P4RA 1BBJA 5I16A 3KPQA 2G75B 3PG2A 4OFKA 1R24A 4OCWH 1QYGH 4HXBH 4C56D 4ONFL 1R3KB 2M26A 3S37H 3D0LB 4H1LG 4LHUG 3QDGA 4V2BA 3LSOB 3U9PL 2YZ8A 3CFJB 5B39B 4GLRI 3V6OE 3PGCA 3SDDB 5I8KL 5JMRA 4KHXL 4PV9A 3QUKA 5E99L 3E3QA 3B9KC 5ISZE 5D5MA 2XFXB 3I75A 1MFCL 1QTYT 4KRPD 2BNUB 3JVGA 5JOPD 4PBXA 1N7MH 4GUPB 3KXFE 2BSRB 4G6KL 3QDJE 3AAZB 3QRGH 1IC1A 3O8XA 4MJ5B 3SEPA 1P2CB 3VMOA 5LXGH 4Y5XB 2BOBB 1TIUA 5HI5D 1VACB 4PJBA 3MJ8A 4RX4A 1WZ1L 2CUHA 4PJXF 3QEQE 4OAWB 5CFHA 4BFIB 1ZEAH 4R8WL 5C07A 4U3XA 3TPKA 4ELKA 1T3FB 2WV3A 3OPZL 1QFWI 1KJ2L 2WWMC 2BNRD 1H5BC 5EU7E 5K9JL 4OZIA 1EDQA 2VZSA 3DVGA 1TTFA 4HQQL 5BS0B 3L6FA 4IRJC 4NO2B 2NTFB 4NQVB 3IT8D 4XP4L 4F3FB 3O6ML 4FHBD 5C09E 5CILH 4JHAL 5IWLC 1WZLA 1MQKL 5EIIB 3BEVB 2BVOB 1CD1B 3B5HA 5C0CD 1FFPB 4R26L 4Y7MA 3H0TB 4CADA 4LLWB 4M03A 4JY6B 1S7QB 2P8PA 5F9JA 3I02B 3UX9B 3CMGA 1W72H 2PTTA 4X6FA 1QSFE 4Z6AT 1PX4A 4QNPE 5IOPA 5CZVH 3SKMB 4WW1A 5F7KC 1PEWA 5JPNB 3VXME 1XF4A 2H2PC 4PJGB 1MI5B 4O5LH 3HFMH 5GRZA 4GBXD 5JIIA 3QG6A 4P9HH 2IMMA 4YGVB 1U8HA 4HIJA 2C9AA 3A6BL 4OUOA 3C09C 1XF5B 1FNEA 1ZVSB 2NR6C 4OFPA 1IFHH 3CVIH 5K9QG 3NZ8A 3VGEA 1KCUL 3TBVB 1DLFH 3BP7A 3LKNB 4FQ1L 1EERB 4FZEL 1J0YA 5BRZB 3QIBB 3H8NA 4S2SA 4OT1H 2VE6A 5HDBF 4U2ZA 3LRGA 1JNJA 4FFYH 3MGAA 4P57A 2W9DL 5CD3B 1I1AB 1U8IB 3VXTB 1U8JB 4YDJA 4NZUH 2E9BA 4QWWD 3DBXB 4LCCB 3FFDA 1C16B 1T22B 2A6JB 4ONFH 5LGHL 5FHBL 3ISWA 1PKQA 2YPLD 3VI3E 3QXAB 5FECA 3OJMB 4GG8A 4XCEB 3U9PH 4LFHG 5CJXA 3MO1B 5I8KH 1X44A 4KHXH 3DTXA 3ES6B 5E99H 3BRFA 2X4PA 4K3EL 4JFYA 4ZFOB 3CXDL 1P7HL 3KPPB 2VDKL 4NRZA 5DJDB 4G6KH 1KLGB 1A22B 4LASL 3IDMB 4WO4C 1F6AB 3H3KA 2X4OB 2APBA 4XXDB 1QKZL 2E7LE 3WNMA 1WZ1H 1HCVA 2C4FU 4J8RA 5HHXL 3DMMA 4KQ4L 4R8WH 4NQED 5E9DA 4JFFE 1K4DB 3WFEH 2P5WD 1KG0B 3OPZH 3MJ7A 1HI6A 1KJ2H 4OGAC 3QDME 1MWAB 1CG9B 4JJ5A 5K9JH 5IMLA 4HQQH 1JZ5A 4RAUB 5E8EB 3BPOB 3FHAA 4QY8A 3I6KB 4ZYKB 4XP4H 3O6MH 5D71L 4JHAH 5BVPL 1MQKH 1ED3A 3SOBL 4PRPA 1NBYA 4R26H 2YS4A 1MCFA 5EZJB 5KS9F 1FNGA 5F7WC 3E6HA 1KJMB 3IU3A 1BVZA 4PD4K 5D9SB 3V5KB 2Z4QA 3F5WA 3QDGD 4PJ5B 5J11B 4OZGB 1U8NA 4FRWA 3TJHC 3FO9A 1LEIB 4XPFL 2GCYB 2W92A 3C8DA 5JIHA 2X4SA 4OCNC 3ZHKA 3FFCE 2YPKB 1JPSL 4X7TB 4Y89A 5CHNB 3MRMB 4J3SA 5IB1B 3CZJA 1KACB 2KQNA 3OQ3B 3A6BH 4WWID 3REWB 5E5MA 1NCNA 5IVZB 4LPTA 4XNYL 3UAJC 3O8XD 1DVFA 1OGAA 4NZRH 1CGSL 2EDNA 2ZNWA 1EO7A 3KG5A 1KCUH 2EYSA 5EC1A 5KVDL 1YY9D 3TIDA 1JHLH 4FQ1H 4LCYA 2D0HA 4M4RA 4PR5B 4RX4D 3O9WA 1JNHA 4FZEH 3V79C 2JJUA 1TVHB 2WLYA 4FA8A 4PUBL 5C07D 3IJHA 5GGUA 3W39A 3G6JE 3H9HB 2EIZA 2DDQL 2W9DH 1JJUA 5DRXB 3C5ZB 4AENA 2WIIB 4PJXA 3W81A 4X4YA 1F90L 1R5IB 5J3HD 2CRYA 5LGHH 4KPHL 1CT8A 4WGVB 5DC9B 1RZIB 4QEGA 1UFUA 2DF3A 4UIKL 2X6MA 3PHQA 2XWTB 2VIRA 3QZWB 4PY8I 1GRWA 3LOWA 1W8NA 1LK2B 4K3EH 3CXDH 5HYFA 5A2LH 3PL6A 2IFFL 1FBIL 2VDKH 2EEBA 1LGVA 4PGJA 1FO0L 3M1BA 2GEEA 4LASH 5HYJB 2V2TB 5SWQA 1IAIL 2P8MB 5IQ9A 1HN1A 5CGYC 3UPRB 1RZFL 1QKZH 1SEBB 1RUPL 3DRQA 1JTTA 1U58B 2MSPA 3SDYL 1I7TB 1S9WA 5HHXH 2HTLD 1AGCA 4KQ4H 5IHUH 4HK3N 2ZCHL 4JFPB 4APQB 1PGRB 3NCCB 1XIWC 1R5WA 1FP5A 4S0TD 1IGML 2Q7NA 4G8GA 3VGGA 3WN5B 3QO1A 3W11C 5CSBA 5I6XB 4K71B 3WNLA 4I3SL 2HH0H 3LB6D 1JWMB 2UVEA 4OIIL 2BZDA 5GGRB 4QRPB 5D71H 2Z8RA 1ORSA 2BNQE 5GS1A 1JGDB 4OGXL 4LKXA 4HS3A 1ZLWH 4GFTB 1N4XL 1YEGL 3S3SA 3T2QA 3BESR 5D1XC 1NCTA 3FHQA 4YEEA 3TYFA 5B38A 1VGEH 1TXKA 4PJCB 1QFPA 2VZUA 4XPFH 2VR5A 3WHE1 4OLYL 5BXFA 3MV8A 2GAZB 4LVHC 4PP8C 5ALBL 2OLDA 2MKLC 1JPSH 1T1XB 2QQKL 4PJGF 4U1NB 3VDAA 3E0GA 1FORL 4OZFB 4JJHA 1EZVX 2JCCE 4YJZL 2EE6A 5EPMB 43CAB 3EO0B 4K94C 4XNYH 2PXYB 1CGSH 3I3DA 2NY4C 1JV5A 4HMDA 3EYQD 1JRHI 4WI7A 5CJ5A 1HSBB 4D9QE 3SGDI 5KVDH 1MIEL 2LTQC 2ZUTA 1A8JH 2C3WA 4KI5C 5D6DC 3DMMD 4OD1L 5C0DB 2VLKB 4PUBH 4PLOB 4HH9A 1EGJA 5T3XL 5E9DD 5HGAB 5IBTL 2DDQH 3QFDB 5IB5A 3PP3H 2D4FA 4LU5L 5BMFL 4JDTL 4D9RE 2YN5A 4DKEL 3UBXI 1U3ZA 1IGCL 5EO0B 4NQXA 1CIUA 5JZ7C 2H9GA 2CKBL 4H5SA 1F90H 4DN3L 3MV11 2CJUL 3RQ3A 1A4KB 5I1KL 1QEWA 4UOW1 1QR1A 4Y1AA 1EEYA 1G7MB 4UIKH 4PRPD 5HVHC 2R1WA 4ZO7A 2VLJE 2NY7L 1ZA3A 1L9NA 1YPZB 2YN3A 4PRIB 5SV3A 4PBVC 2IFFH 1TQCB 1FBIH 1U8PB 2BHUA 2C1PB 4X5LA 3ZT5A 3VDCA 5K33A 3U0PB 3VD7A 5HHVL 1FO0H 1FL5A 5D2NC 4M00A 3HE6B 4N0FA 4W68A 4R96B 5KS9A 2AKRA 1UH4A 1WAAE 1OAXL 2WINB 1IAIH 1D6EA 4C83A 1CCZA 3HAEB 5E94A 2ATKB 1RUPH 3CPLA 3RAJL 3VWJA 4BSWB 3SDYH 5DTFB 5E95B 4MA7L 3SQOL 2Z93A 4FQXA 2ZCHH 1T0NB 1HHGA 4XNXH 3HG1B 1OGAD 1IGMH 1JPFA 3ARXA 2GKIA 1WZKA 1MHEB 4LSPL 5DSCA 2DJSA 5LBSL 5DJCA 4AH2B 3OB0H 4I3SH 3HN3A 1CXIA 3MLXL 4MZ2A 4NSKA 3U1SL 4K7PL 4OIIH 5ICXA 1BVLB 3O9WD 5C6WH 1E6OL 1U8LA 2JB6B 4I9WE 1S9XA 4L4VA 4IBLT 3CDFA 4X0KA 3VXUE 4OGXH 1XF2B 1A6AA 1X5IA 2ICWI 2B4CL 2A0LD 2P1YA 1N4XH 1CXFA 1YEGH 1HEZA 1NMCC 3KJ4B 1ITCA 3GSUB 3KPNA 2BOCA 1EFXB 3L3KB 3FZUD 3OR6A 4HEME 3HR5B 4AQOA 4PRNB 5FUCC 1N26A 5TQ0L 2G75A 4XVSL 4OLYH 4NFDA 4DWHA 5ALBH 1R3KA 1OARL 3VXSE 3D0LA 3I2CL 1ZVHA 4CMHB 2QQKH 1UWGL 3LSOA 4AEEA 3VE0B 1FORH 3CFJA 5B39A 3PL6D 5SV4A 3ARBC 3W2DL 2H32B 3SDDA 4WEMB 1A2YB 4HWUA 3BMVA 4PYGA 2XFXA 3FQTB 2HVJB 3VI4F 1MFBL 1IGIL 5I71C 2BNUA 3AC0A 3KWWB 3NCYP 3S3JA 5ENWB 3K4AA 4GUPA 1MIEH 2BSRA 3ZKMC 3AAZA 3VFTB 1WWCA 4MJ5A 3GJFB 1P2CA 4OD1H 3CLFL 1RURL 4UNVA 3QI9B 1CICB 1TCMA 2D7OA 5T3XH 2BOBA 2E7BA 3G6DL 5IBTH 1VACA 3B5GA 4J3UA 4O2FB 4BA8A 3IFPB 3RUGF 4JDTH 4LRNL 4TQEL 4DKEH 4G8GD 1DE4B 1IGCH 4OAWA 4BFIA 1U3HB 3TJEL 2CKBH 4DN3H 5IEHB 2CJUH 2OS7A 4NCC1 5I1KH 1T3FA 4RGMC 1WITA 4OQTL 3T1WA 1YN7B 4M7ZC 3UPCA 35C8L 4I3RL 5BS0A 2YD8A 2NY7H 5LVEA 4NO2A 2NTFA 4S1RL 4NQVA 4M48L 5K9QI 4F3FA 1C1EL 2ADFL 2OR9L 2EH7H 5EIIA 4PRBB 3BEVA 5HHVH 2BVOA 3QXDB 2IPUG 2R56L 1B4JL 1CD1A 2EE2A 1FFPA 3JWOL 4KC3B 3H0TA 3H9SE 4LLWA 3IJYB 1OAXH 2AJUL 4JY6A 2X09A 2GTZB 5J8OA 1MJ8L 3MV8D 1S7QA 1Z0MA 4YHPB 1MCIA 3I02A 4P2RB 1JFQL 1JN6B 3MLSL 3RAJH 1DL7L 5I74C 1PAMA 1OTTD 4MA7H 3SQOH 1RJLB 5IW6B 2DL2A 3SKMA 3Q6FB 4ONOA 4KGJA 5JPNA 2OL3B 2DTSA 1TZIB 4PJGA 1MI5A 1B0GB 4IRSB 1F45A 3FN9A 4LSPH 4WFFE 3KPRE 5LBSH 3T08A 4YGVA 1YY8B 3MLXH 3QAZC 3U1SH 3FQUB 4K7PH 1XF5A 3PWUB 4MHHI 1ZVSA 2HLAB 5JNYB 1E6OH 3F65A 4H20L 1M1SA 3V6FB 4GS7B 4K23L 3TBVA 3LKNA 2VDLL 4L3CB 3VGAB 4Y16B 5HYSB 2B4CH 4OJFL 5BRZA 3QIBA 2LVEA 5ESAB 4ETQB 3W82A 4XT1C 3ZTJH 2WK2A 3KR3L 5CD3A 1J0HA 4P3CH 4PJCF 2YUXA 1I1AA 1U8IA 4JFEB 4Y1AD 5TQ0H 3VXTA 1GSMA 4XVSH 1U8JA 3DBXA 1V8HA 4LCCA 5T1DL 1C16A 2A6JA 3SE3C 4K3JL 1OARH 5EBLB 3I2CH 4KAQL 1UWGH 3QXAA 2XWJB 4XCEA 2EC9U 3MO1A 2IQ9L 3W2DH 1RVFL 3WIHL 5I75B 3ES6A 3AB0C 4I48B 4X4ZA 1I8LC 1SJXA 1YEJL 1FLRH 3L5XL 4XCFL 5E70A 1IGIH 3CIQA 4Z0BL 4ZFOA 4L1DA 1YEEL 3VXNB 3KPPA 2GJ6E 5DJDA 3OV6A 3VWJD 1E28B 2Q87A 2BDNL 1KLGA 2GFBB 2HT2D 2Z31B 3MNVB 2ZJSL 4N8VB 5IG7B 3IDMA 3CLFH 1F6AA 1RURH 4M4PA 3UDWA 1PD6A 2X4OA 4FQXD 1WT5C 2FSEB 5T33L 2HMIC 1IC7L 3G6DH 4XXDA 3BEWB 4QHLB 2R2CA 1RIVL 5IBUG 4PJEE 4GW4B 4LRNH 4TQEH 3ZE0E 4PB0L 4WNQB 2BSTB 5GRYA 4FFWD 3VD5A 3TJEH 3BI9X 1L4IA 1KG0A 2K1MA 3U30C 4CU8A 1MWAA 4OQTH 5E2WL 1CG9A 2NY0D 4L4VD 4WUUE 35C8H 4NQCB 4I3RH 2EDJA 1BD2B 4RAUA 5E8EA 4URTB 5FO8B 5FYKL 4S1RH 1DFBL 3I6KA 4M48H 4ZYKA 1C1EH 2ADFH 2OR9H 5KVFL 5AAMA 2BHZA 5MENE 1FC1A 5JO5B 5F9WB 4KDVA 4BFEA 2R56H 4RCAA 2WY3A 3PV6B 3JWOH 1OWWA 2Y5TB 5EZJA 4LPUA 1KJMA 2AJUH 2LABA 4MXQC 1KEML 5C0BE 4F2MB 1MJ8H 3TPUB 2JELL 1JFQH 5D9SA 3V5KA 3MLSH 4MJIB 1DL7H 5EOTB 4PJ5A 4OZGA 1VCAA 3PDDA 5FDYA 1LEIA 3SDDD 5KVGL 1C5BL 2GCYA 4NJ9L 2IPTL 3MZTA 4U0QB 1SYVB 2YPKA 4X7TA 3ZZ1A 4H25B 5CHNA 3MRMA 5IB1A 4NO5B 3IDUA 3OMZA 1J8HE 1OOAA 3REWA 3V4UL 2HKHH 4XVTL 5IVZA 4WHYG 3KLHD 1AXSB 4AQ1B 5MEQB 3P4LA 4L8SB 2A73B 4H20H 3P4MB 2HFEB 4K23H 4M1DL 5D2LB 2VDLH 4PR5A 4U05A 4RMQA 4OJFH 3G9AB 1D5IL 1TVHA 4WCYL 5CBAB 2EO1A 3O6FB 1QBLL 3CU1A 3H9HA 2PCPB 5DRXA 5GGVL 3KR3H 1TFHA 4TNVF 2H41A 3C5ZA 1HDMB 1MCWW 3WUWG 2B0SL 2WIIA 3V8OA 1A14L 3BQUC 5T1DH 5J7CC 1R5IA 5J12B 4K3JH 5BS0D 2EDDA 3PDGA 1GGYA 1G9ML 3AY4A 1RZIA 2IQ9H 5C0AE 1JWSB 1RVFH 5DD0L 4TVPD 3WIHH 5J89A 3VW3L 1UJ3C 2XWTA 4Z7VF 3QZWA 4LBEB 1YEJH 3NIDE 2X4RB 1LK2A 1MNUL 3L5XH 4XCFH 4Z0BH 2PR4L 1YEEH 4HAGA 3IDYB 1G7JB 2H26B 2DQTL 5B3NA 2ITDB 5IFJB 4JO4L 2ZJSH 5HYJA 1GH7A 2V2TA 1NFIB 2P8MA 1D5XB 5T33H 4F37F 4B0MM 1IC7H 3RX8A 3UPRA 3MLVL 1SEBA 1RIVH 2UUDH 4PLJD 1FZMB 1MI5D 3OF6A 1U58A 4PB0H 5DK0B 1I7TA 4JFPA 1BFTA 4YFLF 4APQA 4P2OB 5HDQL 2OZ4L 5LWYH 5E2WH 3WN5A 1JWMA 5FYKH 1G6RL 1DFBH 5GGRA 4QRPA 5BRZD 3QIBD 4ZSOE 2X1PA 5KVFH 1RIUL 5IT2L 4DUXA 3HPLB 3NIGF 3X3GL 1I1AD 3NACL 5GGRY 3V6ZB 4D9LH 3QO0B 1KEMH 5FGSA 3C5SB 4JO3L 2JELH 4UI2A 3UBXB 2P47B 4OQ1A 5BW7C 1VEPA 1P9MC 4J2XA 4PJCA 1PSKL 4HEPG 5SWZB 2W38A 5ADPL 5KVGH 1C5BH 4NJ9H 2IPTH 2GAZA 2AJYL 4S0SD 4DZBB 1T1XA 4F7CA 1J0JA 5IQ7L 1HK6A 4U1NA 1WQVT 5M95B 4OZFA 5EPMA 2V7HB 5CEYB 3V4UH 5JW4M 4XVTH 3EO0A 43CAA 4QGTA 4GKSB 4CDGC 3DYMA 3PHOB 3ARFB 3LIZL 2PXYA 4Y88A 1P1ZB 1FG9C 4MWFB 3GSVB 2J1KA 1HSBA 1J12A 4M1DH 5T1KB 2GYSA 4S1DC 4YBQC 5JOFB 4ZMAT 2YEZB 4P23B 3VXOB 3HRPA 5TE7L 1B0RB 1D5IH 5C0DA 4WCYH 2VLKA 3N85L 1QBLH 4NYLB 3TVMC 5HGAA 3PP4L 1T83A 4P9HC 4P9ML 3QFDA 5GGVH 2Y07H 4Y2OA 2EKJA 1BJ8A 2B0SH 1FFQA 1NMBL 5B4MD 5EO0A 1A14H 3ORJA 4LHUB 4OLUL 1F4AA 1A4KA 2FEEI 1G9MH 4UAOB 4DJMA 1BQUA 2C3HA 2YXMA 5F44A 4ZAKC 4UINL 3QIUB 1WISA 3VW3H 1G7MA 5DD0H 3GJFK 1M71B 4F37K 2DB8A 1YPZA 4MLIA 2PR4H 4PRIA 3UEZA 3EKCA 1U8PA 2C1PA 3EGSB 3W0WE 3IGAB 2BSED 3U0PA 4I13B 2DQTH 2ICWB 3Q48A 4M9PA 4PJ5D 3HE6A 4JO4H 1CDHA 1Q9KB 4R96A 1JYVA 1KCVL 3Q5YA 1KNOB 1IKNA 2WINA 4DUVA 4POZD 6FABL 3HAEA 2ATKA 3MLVH 4FQQB 2XXCB 4BSWA 5DTFA 2W65B 1M6OB 4LP5A 1QVOB 3WJLC 3V7MA 1T0NA 5IJVB 3EJJX 1UACL 4Z7WB 1QSVA 2MQ0A 1WFOA 3U82B 1CXLA 3HG1A 5HDQH 2OZ4H 3IAQA 1MHEA 1WV7T 3ZLQC 2DQIL 5GZND 4XPGL 4Y2DC 4AH2A 4FFVD 1CN4A 4IEFB 5C6TL 3BP5B 1G6RH 1BVLA 4N5EA 2P5EE 1QRNE 3DLQR 2JB6A 1RIUH 3NVQA 5IT2H 3DXAE 4LCIL 4CNIB 1QFUL 1T66C 3C5ZD 3X3GH 1XF2A 3NACH 3RJQB 3HLAB 3RVTD 4X4ME 3GSUA 3LD8B 5BO1L 4HF5H 4GRWH 4JO3H 1EFXA 2FJFB 3L3KA 3HR5A 4PRNA 4NKDB 1PSKH 4MLSA 3P9MB 2FEDD 5ADPH 4XGZB 1IBGL 2I24N 2W0LA 1AC6A 2AJYH 5JR1L 4J1UB 3FRUB 5IQ7H 2EZ0D 4TYUA 3VE0A 1TTGA 1FFNB 1IEHA 3EO1B 2H32A 1VEOA 4UQ3B 2FB4L 4EZMA 1A2YA 3LIZH 3FQTA 5HYJD 1F3JB 2HVJA 3MJGX 5JW4N 3VXPB 3KWWA 2GHWB 1MOEA 4NUJB 3LDBC 5ENWA 3T77B 3MFGB 4P2QD 4PJ7F 3VFTA 4YHYB 3OF6D 3GSNL 4MQXD 5TE7H 1OAZL 3GJFA 3NPSB 3QI9A 4OCLC 2CDEB 5HHOB 1CICA 3N85H 3IB4A 3D39E 3LEXB 4APQD 3PP4H 1DQQB 1EZVY 4P9MH 4UILH 4FG6D 4O2FA 2YHGA 3FQNB 3SN6N 3IFPA 4MNHB 4Z7QE 1DE4A 2D7NA 1NMBH 1G7HB 1U3HA 2G5RA 3U0WL 4OLUH 5KTEL 1FZKB 5IEHA 1Y18A 1NANI 4NM8L 2YK1L 4QRPD 4P4KB 5L0QC 5DMGC 4LQFL 3N1FC 2F15A 4UINH 1YN7A 3C6LC 2IFGA 4NKQB 2R0KH 4L4TB 5A2FA 1WWWX 5DZLA 4E5XB 1T1YB 2OXGA 4NT6B 3ABZA 3UPAA 3CFEB 3TLRA 3ZDZE 4PRBA 4GXVL 1ZV5A 4U49A 3MLUL 3QXDA 2XT1B 4ZS6D 3U7WH 5GRXG 1KCVH 3IJYA 6FABH 2GTZA 2WP3O 4XCNB 4YHPA 2HTKC 4P2RA 1JN6A 3VG9C 4WU7B 1ZLVK 1I8IB 2NNAB 1RJLA 5IW6A 4HJ0D 2DD8L 1UACH 3Q6FA 2HP4A 2LV4A 3I85A 2PXYD 2OL3A 3QISA 1TZIA 4IRSA 1B0GA 1DJSA 2DQIH 4JCLA 4XPGH 1Q1JL 1YY8A 5C6TH 2ZZUT 3FQUA 3HTLX 3PWUA 1CFSB 4IRZL 4W6YB 2HLAA 5JNYA 3DVNB 2VLKD 4WV1C 4QKXB 1HILB 5IMMB 1EO8L 3V6FA 4LCIH 2OK0L 1YEFL 5F93C 2X1OA 4L3CA 2XWBB 4Y16A 5HYSA 1OGTB 4M7LL 1UKQA 5ACZB 5ESAA 4ETQA 4Y8AA 5BO1H 5ID1B 1JE6A 5F1KC 4Y19B 3IDGB 1PYWB 1QSZA 4XNQB 4HJGB 4JFEA 5C6PB 1KIQB 1IBGH 3GO1L 2GTWB 3H3BC 5J9PB 5EBLA 5JR1H 5JA9A 2I9TB 3TBTB 2D3VA 3TNNB 4PRID 1F4WL 3UZQA 1HINH 4BH7B 4LRIC 3KLDA 2FB4H 4NC0B 4I48A 4ENED 4C59B 5E4IA 3VXNA 3ARTA 4HLZH 4R7NB 1YEDB 1YYLL 3OX8B 1E28A 4BKLB 2GFBA 3GSNH 2IEPA 2Z31A 3MNVA 1OAZH 4N8VA 3P2TA 2JB5L 5IG7A 3MROB 4RRPG 4F57L 1U8MB 2FSEA 1MCOL 1C8PA 3V0AC 1R3HB 4ISVB 3V2AR 3BEWA 3HG1D 4QHLA 4P3DB 4GW4A 2E6QA 3A6CL 5SX5H 3C60C 3X17A 4WNQA 2BSTA 3LN4B 3P3YA 3U0WH 4DAGL 1GGIL 4QGYA 1FYTE 5KTEH 3EDJA 3B9KB 4AEHL 3L3JB 4NM8H 2OJZL 2YK1H 4N5ED 4LQFH 2VLRE 5DZNA 2YD3A 1BBDL 2X1WL 3IDJB 4NQCA 1BD2A 3T04D 4GAFB 5FO8A 2N7BA 5T1LA 3NPZB 2DQGL 5JO5A 4GXVH 1EFXD 4BQ9A 4EUPB 3MLUH 3PV6A 5DHXB 2XZCL 2Y5TA 3WDJA 5L7XL 3CDGB 3DJ9A 2D31B 4F2MA 2KL6A 3TPUA 5DYOB 2QADC 3QIWA 1MCCA 4MJIA 5EOTA 3SBWA 4C56E 4MA8L 1FQ9C 2RIKA 3L3GB 3U83A 1H5BB 2DD8H 3QB7C 1RV6X 2NY6C 3CSGA 12E8H 4OBSA 4IRJB 4Z7WF 2XA8L 2DQJL 4PB9L 1SYVA 2DKMA 4H25A 5IUSA 1D9KC 4NO5A 5GRVK 1I75A 2XNAB 1RZ8B 3GGWB 4PY7B 1Q1JH 5JOPE 1INDL 2BCKB 2APXA 4IRZH 3L3OB 3VH8G 3AVEA 5F7LB 1AXSA 4PJDF 3QI9D 4S1QL 5MEQA 4L8SA 1CICD 2A73A 3P4MA 4X9IA 1EO8H 2HFEA 5IP4A 5D2LA 2OK0H 5KVEL 4M7LH 1TTUA 1U3HD 5D6CB 3SJVB 4ZNCD 4LSDA 5TJWK 5CBAA 4XNUH 2G9HB 4CVUA 3O6FA 5DEFB 3OAZH 5D7IB 4OFVA 2PCPA 2IADB 1HDMA 5GRWA 2A2QT 3N0PB 2BNRE 3GO1H 4XHJD 5BOZG 3C09B 1FVEB 4X6DB 3OAUL 5F88B 5DQDL 3TA3C 2ZUWA 4MNGB 1I3GL 1F4WH 1FH5L 3MRGB 4YC2C 1JWSA 1JHTB 2AAVA 4G80B 3QUYC 1QLEL 4LBEA 1FSKC 2X4RA 5C0CE 3HE7C 3T3ME 4P2RD 1YYLH 1G7JA 3MRCA 2H26A 3NZHL 4YZFF 5I9QC 2ITDA 3O6LL 5IFJA 5INCB 1NPUA 2JB5H 4F57H 1S7SB 1NFIA 1D5XA 1MCOH 3OG4B 3F12B 1T21B 4ACPA 1NFDF 4OZHB 3A6CH 3QQ9C 2GT9B 3GSQB 1FZMA 4IRSD 5DK0A 1KIPB 4OIBA 5F1SA 2H45A 4DAGH 2XTJC 4F8TA 1OAQL 4NIKB 4AEHH 4JKPL 5CD5D 3U46B 2OJZH 3KJ6L 4JM2F 3MBXL 1FHGA 2FWOB 3L5WB 4P2OA 1DBKL 2DMKA 3MRIB 1WSST 1BBDH 3TC9A 3T0VA 1OD9A 3S96B 2IH1B 2ZKHL 4HG4J 2EXWC 2C4FT 2PTUA 4WO4B 2YUWA 4Y16D 1HKLL 4LPXA 4M93C 1BF2A 4ORZC 2RR3A 4G59A 4MS8A 2DQGH 3OKNB 1N59B 2IANB 3K4DA 3HPLA 2XZCH 5L7XH 4JFED 3V6ZA 3QO0A 5T3ZD 2R8SL 3C5SA 4HBCH 2DLTA 4PP2B 5EUOB 3UBXA 4MA8H 3U0TB 2YPLE 1DQLL 5EH1A 3D3VB 5SWZA 4HS8L 2IBBA 1F8TL 2XA8H 2DQJH 4PB9H 1X7QB 4DZBA 1OLLA 4OB5L 4G6MH 2Y36L 3BVNB 3V0WL 5JLZB 1JZ6A 2NZ9D 4N8CL 1INDH 2DICA 2V7HA 5CEYA 3TBYB 4GKSA 2Z31D 5FYKU 3PHOA 3ARFA 1X5FA 5GGQL 4JG1L 1P1ZA 2BVTA 4MWFA 4S1QH 3GSVA 2ENSA 1MCWM 5T1KA 1U0QA 5JOFA 2YEZA 4P23A 3VXOA 2MJWA 2V5MA 2RCSL 1B0RA 5FGCE 4HCRL 1KTKE 2FJGB 5J4MA 4NYLA 4NQEE 2NQCA 4W6WB 4JDZB 2P5WE 3ULVF 2CDFB 3DGGB 4NQCD 1H3XA 4LHUA 1BD2D 5IFHL 1J1OL 3IETB 3DX7B 3OAUH 5DQDH 2A6DB 3BZEB 3DURB 3RRQA 1I3GH 3WFDL 1FH5H 2B4CC 3QIUA 3MODL 5FCUL 1M71A 1QLEH 4ZUSB 5F7YC 4L1HA 1MVUB 2D7TL 2QQNL 5AWNL 3EGSA 3EAKA 4U7SA 3VRIB 3IGAA 4MJID 1M7XA 3NZHH 4M7KL 2ICWA 3O6LH 4MJ4A 1HYSD 2IGFL 3MCG1 1S7UB 3ME0A 5TE6L 3QDGE 1KNOA 1A4JB 4E42B 2E7LA 4O2CB 3STBA 2X4UA 4FQQA 5GRVL 3FMGL 1W2KT 3E3QE 3QFJB 5D5ME 4ZTOH 3U7AA 2W65A 1M6OA 5SWSB 5GZOC 1QVOA 4UBDC 3V5DB 1OAQH 1ONQB 2AJZB 5IJVA 3AREC 4JKPH 4Z7WA 3KJ6H 4PJIF 3MBXH 1DBKH 4KKCD 3BUTA 4LQ1A 4UIMB 5ALCL 1LO4L 3Q6GL 4MDJB 2ZKHH 3BP5A 2VZTA 3RWHB 2DIJA 1HKLH 1QD0A 3N1MC 4PJBE 3IDNB 4KRMB 4O9HL 2OBGA 3O6FD 5F9OL 5C07E 2FH6A 8CGTA 4CNIA 3BKCL 3U2SB 5I18L 5JQ6L 1QHOA 5E8DL 4NCDA 2R8SH 3HLAA 1XIWB 2FJFA 5A43C 4OZIE 1UM5L 3NBNA 1ZTXL 5DC4B 3TCXA 1DQLH 4NKDA 3P9MA 4Y4FC 4MA3B 4XGZA 1EMTL 4HS8H 4BUGA 4EJ1C 1F8TH 5DHYB 1FJ1B 4J1UA 2VDQL 3FRUA 4OB5H 4W4OA 2Y36H 1FFNA 1OP9A 1T7ZA 3EO1A 3V0WH 4AY0A 4N8CH 2CIIB 3AS1A 4UQ3A 3LKOB 1JI2A 2LU3A 3IVKB 1G9EA 1F3JA 4JG1H 2QBWA 4PG2A 5DVKA 1AC0A 3RVXD 3VXPA 4OTXH 5D1XB 1FL3B 4KK5D 4NUJA 3T77A 5FYLL 2RCSH 4GMSL 3VCLB 4HCRH 4LVHB 2CDEA 1EBPA 5HHOA 4GG6B 3LEXA 1TJIL 1DQQA 4LOUD 4P2OD 1GOFA 3FQNA 1M7DB 3HNVL 1LP9B 4MNHA 3RKDD 1G7HA 5IFHH 1FZKA 1GHFL 2YRLA 3D0VB 4J3OC 2NY4B 4XWOC 4P4KA 4W6XB 4MS8D 3MNWB 3WFDH 3ZYJA 1KF9B 1DDHB 1MRCL 3I6GB 3MODH 2LTQB 5FCUH 4L4TA 4MAYC 3Q0HA 1BOYA 5T1MB 4E5XA 4EVNB 1T1YA 2D7TH 4NT6A 2QQNH 3NCYS 4WFGD 3CFEA 4WFED 5AWNH 2HT3D 25C8L 4FQ2L 3TGXA 4M7KH 4HUKB 2IGFH 1PKQE 1HYRC 5TE6H 2PN5A 4KKLC 5SWZD 1RZ7H 3QA3B 5FV1L 5F96H 2BY0A 4V1DB 4LVNC 4XCNA 1KB9J 3FMGH 4OZHF 2VZ3A 4EN3C 4WU7A 3BN9D 1I8IA 2CD0A 2NNAA 3BT2L 5HVHB 4I2XB 3OJDB 3VGDA 1A6PA 2J8UE 1P7QB 1Z5LB 2E8ZA 7FABL 5KW9L 3ARFD 4NWTL 2LU4A 1J11A 2D7QA 4KJPD 3HI5L 5ALCH 1UT9A 1LO4H 3Q6GH 2G2RB 5T1KD 1SJHB 5D2NB 4XBGB 4P23D 1V7NL 5AZ2L 4ZSOB 1CFSA 4LLUB 1IAIM 3UC0L 4Y4HC 3DVNA 4O9HH 4CVZB 3SE4A 2DLGA 3AXLB 2FIKB 1HILA 5IMMA 5F9OH 5CZXC 2MTPA 5E9DE 1CGTA 5I18H 5JQ6H 2XWBA 2CXGA 5E8DH 4KDWA 1OGTA 4C58B 5ACZA 4TUJA 4LHUD 5ID1A 3STLB 2V5SA 4KMLB 4X83A 4P5TC 1UM5H 5EUOF 4DTGL 4Y19A 1ZTXH 3D6GA 2D7PA 3IDGA 4OFDA 1PYWA 4DW2L 1CLCA 4XNQA 1L0XA 3P0GB 2J5LC 4HJGA 4M7JL 5D70L 3MFFB 1KIQA 3QIUD 1T89C 1EMTH 2GTWA 4ELMB 4HC1L 1PY9A 4PRPE 5J9PA 2I9TA 3TBTA 3TNNA 3U7YL 1BGXL 5F6HI 3GSOB 4OBRA 4BH7A 5HD8C 1N8ZB 1NAMB 1FG2B 2F54B 2G5BB 5ECJE 3W5MA 2QHLA 1IGYB 3S4SB 5B38G 4ZOEA 1NMCB 1FAKT 2BSSB 3VD3A 4R7NA 1YEDA 3OX8A 4EI6B 5EBGA 4Y5VC 5FYLH 4BKLA 1DBJL 5GS3A 1N3NB 4P5KB 4GMSH 4QXGL 4ZDHB 3MROA 4AL8H 1U8MA 4ZFZB 1R3HA 1TJIH 4JANB 4ISVA 1BZ9B 3WUWB 5DT1L 4U7KA 5HPMB 1OTSC 4P3DA 3MRJB 1I7RB 4JR9L 3HNVH 4WI9A 1MCSA 1OGAE 3ARBB 1RI8A 3LEYL 3LN4A 3PWVB 1GHFH 3B9KA 3DHJA 3L3JA 5FYJU 4X9GA 3DX6B 5I71B 2XTLA 5CAYB 3IDJA 1N2RB 1MRCH 4JG0L 4MQTB 1UWXK 2DYPB 3WNNA 1TLKA 4PJXE 4KY1H 3F7PC 3RIAK 4DVRL 25C8H 5KZCB 2X89A 4EUPA 3KYAA 4RFOL 5ID0B 2GITB 4DQOL 1OQOA 3CDGA 2D31A 1KULA 4LMQE 1VSCA 5I8CB 3G5YB 5DYOA 5J6HB 1IL1B 3PNWB 2I26N 2AXFB 4RGMB 1WK0A 1XGPB 1JHKL 4KJYB 3HI1B 3D25B 3L3GA 4M7ZB 4U1HB 3BT2H 3UROR 1ES0B 1H5BA 1ULVA 4BZ1H 1HQ4A 3D48R 1GPOL 5D4QA 2WQRA 4IRJA 7FABH 5KW9H 3IRZA 4NWTH 4TVPL 3MUGB 4JQXC 5IWLA 3HI5H 1CZ8L 1DBML 2XNAA 1RZ8A 3GGWA 4PY7A 3BYYA 4F15C 2P5EB 1V7NH 3FRPA 2BCKA 4J23A 1QACA 3L3OA 2XQBL 1ZXQA 3UC0H 5IW1B 5HHOD 5HI4C 4KZDL 3RWJB 5I74B 4HGKC 1II4E 5D6CA 4G8GE 3SJVA 4S0UC 1RIHL 2G9HA 5DEFA 4XNMB 5D7IA 4DTGH 3BISA 4ORGB 2IADA 3TBSB 4P4KD 4DW2H 3FT3B 4M7JH 5D70H 1SY6L 5DF0A 2BVUA 3T0EC 3QAZB 4U6YB 1DR9A 1FVEA 4HC1H 4X6DA 5F8QC 5F88A 5D7KD 4L4TD 3RX5A 2F53B 2VUYA 3TT1L 4KMQA 5D1QC 5E2VL 4MNGA 3MLZL 3U7YH 2RB8A 1BGXH 4BJLA 3PV7A 4JFOB 4Q0XL 5E2TL 2P48B 2W60B 3MRGA 1JHTA 4H8WL 2I25N 2KBGA 4G80A 2QKIB 5DJYB 4HUXB 5A1AA 4OUUB 3QH3B 4DGVL 1TMCB 3QPQD 3MV8E 1HZHL 1DBJH 4HPYL 5INCA 1BZQK 5IVXB 3LCYA 4QXGH 3E6FB 1BWWA 1S7SA 2CDGB 1UB6B 3F12A 1T21A 3OJ2C 4GAJL 4GG6F 5B39G 5C7XL 1CLZL 5DT1H 4OZHA 2P45B 1BIHA 4JR9H 2GT9A 4CVXB 3GSQA 1ZGLM 4P0DA 1NUDA 1FVDB 3T8XB 1KIPA 3LEYH 2RAMA 3LS4L 2APTA 5FGRA 3ULUD 5FM8A 3S37X 5J57B 3U46A 3L5WA 2FWOA 2XZAL 1NGQL 3MRIA 3EO9L 4JG0H 3S96A 2IH1A 3EYUL 4WO4A 1JZ2A 4OV6F 4HULB 2AGJL 1T7YA 1KB5L 3OKNA 2VSDA 4DVRH 5HGGS 1N59A 2IANA 4RFOH 4DQOH 4Y19D 2OI9C 2WBJC 3ULVD 4NBYB 1I3RB 5DQJB 4R6UA 4JPVL 4Y1AE 1NBZB 4I0PC 4PP2A 1J7VR 5EUOA 3U30B 1JHKH 4YBLC 4Z7UB 3U0TA 4OF7A 1JGEB 3D3VA 1FYHB 1GPOH 5KSAC 5EOCL 2YD1A 3HUJB 3V0VB 1X7QA 4TVPH 4UDUB 5KS9E 5DRZB 3BVNA 1CZ8H 1DBMH 5JLZA 1CIDA 5CSZB 1PG7W 4WFHE 2J6EL 3TBYA 3D2UB 2XQBH 3FONA 4G3YH 3SO3C 2Q86B 3FO2B 4MVBC 5LJYH 4KZDH 3RWGB 5HYEA 4X7EC 3QQ3B 1BWMA 4A6YB 3OAYK 1UADC 3VRLF 1U95B 3TJHA 2R2BB 1RIHH 1S7RB 2UVFA 5MERB 2FJGA 3EJZC 3B9KD 1WFNA 4KRLB 3IDIB 5INDB 4JDZA 2CDFA 1SY6H 3DGGA 2JTDA 3RHWK 4ELMF 4L4VE 3IETA 3DX7A 4D0BB 2A6DA 3TT1H 3BZEA 3DURA 5E2VH 3MLZH 4OF6A 1E4XI 1UB5B 5E2TH 4Q0XH 4Q6IC 3BUYB 3AS3A 3WNPA 1RMFL 2X89D 4NHUB 1I1FB 4ZUSA 1MVUA 5LAXB 3LZFL 2CRIA 4DGVH 3VRIA 5F8RC 1R3JB 1HZHH 4MQSB 4HPYH 2WWMD 1S7UA 5CEXB 2B2XL 3BQUB 1A4JA 2F5AL 4X6BB 3X11B 4E42A 1JMXA 4GAJH 4O2CA 5C7XH 1CLZH 4IRJD 1ERNA 3SDAC 1G1YA 3ZE1F 3QFJA 3BSZL 5J06A 5SWSA 1KPRB 3LS4H 3V5DA 1PJ9A 1ONQA 2AJZA 2LQRA 3R1GL 2XZAH 2BX5A 3FB5B 5BV7L 3CNKA 1XEDA 3EO9H 4UIMA 5F71A 4MDJA 3EYUH 5DZOA 1A6TB 5KN5B 2F74B 3RWHA 3IDNA 2VQ1B 3SJVD 2AGJH 5DJZB 2HT4C 1KB5H 2H2PD 1Z3GL 3U2SA 2J8OA 2JK5B 1P84J 1NEUA 4PJHB 4JPVH 4PP1C 5FHAL 1C7TA 1XIWA 4XPTL 2NR6D 1MWAH 4NCC2 3DVIA 1CDIA 4YBHA 4NZJA 3KS0H 5BS0E 1OL0A 3GMLB 4WEUD 3RVVC 5KSBB 3QWOB 2A6KB 3GRWL 3V7AG 2NY3C 4MA3A 3PGFL 3QEHB 5EOCH 5B3JF 1L0YA 5E08L 4HWBA 4TVPE 5DHYA 1FJ1A 2VISB 3IKKA 5A40E 5I8OL 3GDBA 2CIIA 1Z9OA 1U8KB 2J6EH 1RU9L 5EZLB 3LKOA 4OSUL 1IC4L 3IVKA 1FGVL 5D1XA 1FL3A 3C87A 2IF7A 4P2CG 1LNUB 3MJ6A 4GKNB 3EHBC 2OMBA 3KYOB 5M94B 1XGTB 4PJGE 1MI5E 3VCLA 1G9NH 4OV5B 4GG6A 1RUQL 4Q7DA 4NQDB 1M7DA 1LP9A 3O11B 3PXJA 3SGEI 1NGWB 5TE4L 5KANI 3SGKC 1W72B 4WO4D 3D0VA 5ITFB 4V3DB 1IE5A 1XFPA 3O3AB 3MNWA 1F4YL 3TWCL 5BRZE 1DDHA 1RMFH 2IAND 3I6GA 4PJFB 4LL9A 5I1AB 5HVFB 2WWKT 1ZSDB 5D6DA 4I8DA 5A3IC 5T1MA 4EVNA 1JGUL 1X5GA 4PJAB 3LZFH 1IRAY 3TVMB 3BJLA 1N0LA 3ARQA 5E4EC 2AXJA 1JPST 3IYLW 4OGAD 2B2XH 5IVXF 1KBGL 4LVOC 3D3VD 2F5AH 3B2VL 2FGZA 4V1DA 2R9HC 1MLBB 4ZAKB 2YPVL 4LK4A 4BK5A 4I2XA 3OJDA 1DEDA 2YOCA 1P7QA 1Z5LA 1F97A 1AGBB 1NGZB 4WHCA 3R1GH 3PJSB 1C5DB 5BV7H 4XI5C 2G2RA 3SCMC 1SJHA 5T5FL 5D2NA 4XBGA 1V3KA 5KAQG 5GIRB 3IS0X 1IC5L 3TJHD 4LLUA 1SHMA 4CVZA 3AXLA 2FIKA 4CRPA 3ZKNC 5D7LB 1V05A 1Z3GH 1MFEL 2C3XA 2WLZA 5FHAH 3STLA 3GHEL 3MCKB 2CUIA 5FK9B 2ZUSA 2XZQL 4Z7UF 1UYWL 4PTUB 3GRWH 2DLFL 1P69B 3MFFA 3Q1SH 3LPGA 4Y2DB 3PGFH 2HVKB 5AD0B 2JLLA 4ELMA 5E08H 3BH9B 2L0DA 3OJVC 5DJAB 3S3PA 3HMXL 5H37G 5I8OH 2ARJQ 1AD9B 5HGDB 3O3BB 3GSOA 2H2SC 1N8ZA 1NAMA 2F54A 2G5BA 3RDTC 4OSUH 3UTPD 1IC4H 1IGYA 4Z77B 3S4SA 1BJMA 4PJ5E 2FX7L 3IS1X 1I1CA 1KJ2B 4OZGE 5DD6B 2EDEA 1FGVH 2BSSA 3T1FB 2Y7QB 4JKKA 4EI6A 3QFJD 4ESKA 5E5RB 1N3NA 5D7JC 4P5KA 3BDYL 4ZDHA 5SWSD 2GY7B 2LU7A 4ZFZA 4JANA 4OZFG 1RUQH 1BZ9A 3WUWA 5HPMA 2B5IC 4DCQB 3MRJA 1I7RA 5DA0B 4GAGL 3RL2B 2A77L 3ARBA 3L5JA 3PWVA 5F7EL 5TE4H 1P6AB 4NN5C 3HZYB 2VL4A 1KGCE 1WCBB 5E24E 1T6WA 3DX6A 5CGYD 3ARGC 2Q8BL 1F4YH 2RFXB 1EIBA 3TWCH 3LDBB 5EUKB 1N2RA 4QNPF 1A6ZB 2FECI 4EXKA 5CJOL 1B0WA 1A3QA 3KNBB 3VFPB 1CGXA 5DK2B 2DYPA 3E8UL 1JGUH 3M8OL 1XIWD 5CLTA 1TCRB 3QR2A 1PZUB 1H9VA 5ID0A 4NFCA 1FAIL 2GITA 2IMNA 3W11D 1KBGH 1VFUA 1YMHB 2J8HA 5E0QA 2C1OB 2EECA 4UOJA 2Q3AA 3B2VH 5I8CA 5T5NF 5K59E 3G5YA 5J6HA 1IL1A 3PNWA 3MV7B 3LAFA 2AXFA 5L0QB 1KC5L 1XGPA 4RDQF 3BPCB 4KJYA 3VRJB 2YPVH 3D25A 3HI1A 4U1HA 1LEKB 1ES0A 3C6LB 1I8MB 4J4PD 4KTDL 3MUGA 5HYJE 1A1OB 1AQKL 5IR1B 3CFIC 5D1XD 5F70A 1IM9B 4OF5A 5T5FH 3RBGA 4BM7A 2O5XL 2P5EA 4X5WB 4QOKB 3HAEH 1IC5H 2ARWA 1I9EA 1NDGB 5IW1A 4R90H 4KKAC 3RWJA 3MYJB 2NXYC 3VG9B 4QHNB 4U0RC 1MFEH 3B43A 3UTZB 2VKWA 3GHEH 1EHXA 4XNMA 2XZQH 2NY4D 4ORGA 2VYRE 4PG9B 1UYWH 3TBSA 5KSBF 3FT3A 2GIYA 2DLFH 4KHTL 4QRPE 1J8KA 4U6YA 5C3TA 4WI2A 4KI5D 3CJJA 2F53A 3O2WL 4X6CB 1AGEB 1NAKL 4WV1B 3OL2A 3HMXH 2F9BT 4JFOA 2W60A 3WFHB 5CEZD 4L4JA 1C5CL 2QKIA 3STZB 1JYXA 5DJYA 2FX7H 3CFDB 5J13C 5JZ7D 4PJCE 4HUXA 2Q1EA 4HGMA 1YMME 4V1DD 4OUUA 4OIAA 3QH3A 2BJML 3MLTB 2V5TA 1NCBL 1TMCA 3HB3C 4X99B 3K8LA 5GS2H 5IVXA 3BDYH 2CIKB 3E6FA 3PE9A 2CDGA 1UB6A 1KCLA 3SE3A 1P7QD 3HZVB 3CSYB 2V9RA 1X5XA 3DIFB 4GAGH 4CVXA 2R0LL 3EZ8A 3JV5A 1FVDA 3B9DA 5F7EH 4IIQC 1JZ3A 4ONHB 1ZHBB 1JF6A 4RGNC 1I8LA 5E5UB 1ZT1B 4Y5YC 2Q8BH 3B5TA 4PRHB 3BRGC 2VLKE 4PJFF 5CJOH 3HA0A 5ANMB 3E8UH 3M8OH 1WT5A 4BSVB 2Z8WC 2EH8L 3AS2A 1FAIH 3C60B 3OHXB 1FE8L 1I3RA 2FLRT 5DQJA 5CKAA 1LQVA 1NBZA 1F13A 1KC5H 4Z7UA 5JW4Q 3NFNB 4G8IB 1JGEA 1CFVL 1YPZE 2J8UB 1ZLSL 4PRIE 2EDHA 3TM6A 2F54D 4XH2B 3OSKA 4LSRL 3HUJA 3V0VA 3G5VB 4KTDH 4U1JB 4UDUA 3QEGL 2ZUUA 1AQKH 5DRZA 1V3JA 1LILA 3S88L 4OFIA 5CSZA 2VSCA 3PIQB 2O5XH 1EBAA 4CGTA 3D2UA 5ELIA 3FOMB 2ADGB 4MXQA 5L8LB 2Q86A 3FO2A 3U6RB 2VZ1A 2QADB 3RWGA 3QQ3A 1MHHB 2ZOKB 4A6YA 3HG1E 1U95A 1UKSA 3ARBD 2R2BA 1S7RA 5MERA 2NY6B 4HKJB 3VMPA 1T7XA 2IG2H 2VC2H 2Y23A 1ZAGA 4F80A 3IDIA 2ERJC 4HWZB 1J05B 5INDA 3QNYB 2EEAA 1D9KB 4KHTH 4KK6C 2EDTA 3ZKMD 3KPSB 1X6LA 2PW2B 1MCLA 4D0BA 2AJ3B 2DYPD 3O2WH 1JGLL 3VD4A 1NAKH 1UB5A 2NTSP 3BUYA 5ETUB 5KZCD 4K7PX 4NHUA 3TIEB 3WXWL 1UGNA 3ARZA 2APVA 1I1FA 5HHMB 1C5CH 4N0CC 5F1OB 5LAXA 1I85C 2BJMH 2JJVA 1NCBH 2K7QA 1R3JA 3RI5F 5CEXA 4GQPH 5FUOL 1O0VA 4UUJB 3BQUA 4X6BA 3X11A 1LO5B 2D9QB 1KPUB 3TA3B 1UZ8B 1DVFB 3OR7B 1JWUB 4XBEL 1A1NB 2R0LH 2HWZL 2QSTA 4NO0D 4XPAL 4YC2B 3BWUC 2Q8AL 1KPRA 1UJ3A 1JTOA 3G9VA 1MAML 3QUYB 5FOJA 1FSKB 2P5ED 4F33A 2BVYA 2E5EA 3FB5A 4TSCL 3ZHLA 1INEL 4TNWF 4XMKL 4N8VG 3RWCB 3T0BA 5I9QB 1A6TA 3UYRL 2F74A 5KN5A 3NN8B 1EAPB 4JZOB 1UZ6E 2MQ3A 5D7SL 2YA1A 4A2LA 2VQ1A 1X4XA 1TENA 5DJZA 4LSSL 2R0WL 1DN0B 2EH8H 1H0DB 4HKZB 2JCCF 4HW6A 1TDQA 1I3VA 1FE8H 1ADQL 1OSPL 3KS0J 2JK5A 4L9DA 3RIFF 2XTJB 3RWIB 3H7BB 4PJHA 5ABDE 4QTHB 3LPFA 3KPMB 5BVJB 2HJLA 4IJ3C 4XP5L 5EOCJ 4JZNB 2F53D 4RMTA 4FOMA 2D03L 1MQ8A 5KSBA 2R4SL 1CFVH 3QWOA 2A6KA 4NN6C 1ZLSH 1Z2KA 5I1JL 2D0GA 3QEHA 1JRHL 5IF0B 4JRXB 3RVWC 4ZODA 5ICZB 2NYYC 4M93B 2VISA 5CSGA 5FB8B 3NIGE 3UJIL 1BQHB 2IWGA 1AY1L 3S88H 2CKBB 2J7LA 3UYPA 4YXKH 1U8KA 5EZLA 4DEPC 3WHXB 4P2RE 3S6CA 3K2MC 3H3PL 2YD2A 3RWFB 3REVB 1D3CA 4XPBL 3GKZA 2CK2A 5BW7A 3BGAA 2PNDA 1P9MA 1LNUA 4GKNA 3ZYZA 4QRRB 3KYOA 1CQYA 1XGTA 4NN7C 4OV5A 1CGUA 1JK8B 4NQDA 3K1DA 3V4VL 4HD9A 2OXHA 3O11A 1NGWA 5AG8A 3QCTL 4IMLB 3CDCA 1W72A 5ITFA 1JGLH 1I7UB 4AIZB 1BZ7B 3O3AA 2HMID 3BX7C 5HJ3B 1W0YT 4DGYL 3WXWH 3RI5K 4PJFA 5I1AA 1ZSDA 3BPNC 3CXHJ 1HIML 3KLSA 5E8NB 4ZO6A 4PJAA 5C0FB 3VXRB 3TVMA 5T3ZE 1FFRA 4NQTA 4RMVA 4LSVL 1UEYA 4Z7OE 5FUOH 2EIBA 4FXLA 4HZLB 3U36B 3W9DB 2LAGB 1QFOA 4TNWK 4XBEH 1F4HA 1MLBA 4JM2C 4B50A 2HWZH 4ZAKA 1KLUB 3K2UL 4XPAH 2Q8AH 1MAMH 1DSFL 3D2UD 1AGBA 1NGZA 4JFQB 5GS0C 2FR4B 4MXQD 1U93B 3PJSA 2RBLA 4TSCH 1C5DA 1CTNA 1RSFA 5E6YA 1INEH 4XMKH 3H6JA 3RIFK 3UYRH 3MA7B 3MJ9L 4UT7L 1DANT 5GIRA 5TFSL 1RZGA 4KTEL 5D7SH 2BRRL 4OD2B 4MGXA 1CI5A 3IXTB 4LSSH 2R0WH 5D7LA 3QDAA 1VADB 3QNZB 1OSPH 1ADQH 4DFIA 4WTWA 3T0AA 3WJLA 4UQ2B 3AREB