4EN3C

Crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
257
Chain Sequence
FPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPLLLVCHVSGFYPKPVWVKWMRQQGTQPGDILPNADETWYLRATLDVVAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis for Recognition of CD1d/alpha-Galactosylceramide by a Human Non-Valpha24 T Cell Receptor Struct. Title
pubmed doi rcsb
molecule keywords Antigen-presenting glycoprotein CD1d
molecule tags Immune system
source organism Homo sapiens
total genus 72
structure length 257
sequence length 270
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4en3C01
5TF1L 3FQUB 4AT6A 1A6TB 5DFWH 4MCYB 5B38B 4U6HA 2V9TA 4HFUH 5T1KD 4G8FB 4RBPK 1EHAA 5C0AD 5B38G 3D85B 3NIGF 1B4RA 2AJUH 4BQ8A 3ULVF 3VFTA 4JJHA 3QWRA 3RWFA 3MCLL 4DVRH 5I8OL 4OFVA 5GGTL 3OJMB 4P2QE 1KIRA 3HCVA 2CJUH 2F5BL 4WY7L 1DLHA 5DC9B 5F7NC 4D0DB 2BVUA 5C7XH 2JCCE 3S34H 1QSVA 3TO2A 2JB6B 1ZKAA 5DK0A 1MOEA 5IHUH 2GCYA 4JO2H 3CU7A 4I4WB 5TDOB 4E0RA 5GGVH 3BESR 1CTOA 2MOVA 1BOGA 3MRJB 3VWKD 2X42A 4X7DC 1PKOA 2WAHA 3TT3H 3WUWB 3RZCC 2XNAA 4JN1L 5EOCH 4BM7A 3BRGC 3QIWB 4YHYB 3VFWB 3VG0H 5C0BA 3WUWG 2LVEA 5E2TL 5FM5O 4GAFB 3O11A 3T0ED 5CIPB 3NAAL 4TTGA 3RIAK 2Q6WB 1DUZB 3NIFE 3VCLB 1EAPB 1CICB 2WWMD 4LSDA 1UEYA 4PJ5D 4X9HA 2X7LB 5GGUA 3DWTA 2DKUA 4WI7A 4YZFE 1AKJA 1A6WH 3QZWA 3SE4C 5FHBH 5CEXA 3P77A 1W72B 4OZ4A 4XTRD 3VD3A 1BZ7B 4J8RA 4ISVB 5KZCB 5TQ2L 4M6NH 2X9WA 4RMSA 1M7DA 5SWSE 4F3FA 4P3WA 2G9HA 4N5ED 4KKAD 5FECA 4YDVA 1TJHL 1IC7L 4NZJA 2UZYB 2CGRL 2CMRH 4JY6A 4X99B 4FFYH 5T1MB 2I26N 2DQFB 4BH7B 1G9EA 3DMMC 1FZMA 4Z7NF 5C3LD 3MFFB 1ZXQA 4JRYB 3BWAA 2OXGA 4GRLA 4WI3A 1ZLSL 1Z3GL 5EC2B 4Z0BH 3OGOE 4QXGL 5IJVA 4QOKA 4JVPA 4Y5YB 1LQVA 2VLRD 1JYNA 2ATKA 3LHPL 2E6JA 4WHTB 3TA3D 3S96A 4LARL 2MPAL 4NC1E 4MQ7A 4NKQB 1VERA 4N0YL 1YYLH 1RZKH 3ARFA 4YC2C 2BRRL 5C08A 1DE4A 1PLGL 5D7LD 1VGKA 5TE6H 1BVLA 1CL7H 4TSBH 2DLFL 2JJTC 4NO5A 3FB6B 2N56A 2OQJA 3KLAB 3VH8A 3KHOA 3BRDA 2CKBB 2X5PA 2BP3A 3D48R 4U49A 5FYKH 3UC0H 4PD4K 4WCYL 5SV3A 1XCTB 3T08A 4LPYA 1D3CA 4XC1L 3THML 2O5YL 5C1MB 4HUXA 2FDBP 5LGHL 2YD8A 1LP9F 2VZSA 4L3EB 5DYOA 3W0WB 4JM4H 4PJEA 3PQYA 3NMEA 4JGUA 2PW2B 4QXTB 2V17L 3AAZA 1TMCB 4NT6B 2VXVH 1P2CA 2VE6A 3IGAB 5JW4M 4F7EB 5JHLH 4ENEC 2R0ZL 3LOWA 1DEEB 5EC1B 1BQHB 3K1KC 1P9MC 1H5BA 3DRTA 3O6FD 3RDTA 2X4QB 2AEIT 2F53E 1BFVH 1W8NA 3BPCA 3PNWA 2WZPD 1QBLL 2HFGH 5KSVA 4HHAB 3VXSA 1A7QL 1X7QB 3BPLC 1HNGA 4EN3A 2BVPA 5C0RH 2VLKB 4WVRA 4XP9H 3QIUA 3RA7H 4C83A 1XGRA 4KHTL 2YEZB 4PYGA 3M17A 4XC3H 1EO8L 2UYLB 1LK3H 3BW9A 2UWEB 4W4NA 2R4RL 2FECI 3OR6B 5F1NB 4CRPA 3HUJA 4ALAL 5I1AB 1VFMA 4L9LB 1NAMB 4V1DA 4C4KO 4GKSA 3U7AA 1HIMH 5I8EA 2BSSB 3ARGD 5CJQL 2IBZX 3O81A 3CDGA 2CR6A 1CDIA 1FE8H 1SJHA 2BZDA 4LKXA 2W9EL 1I4FA 2OBGA 5I71B 1K5NB 2MNUA 5MENE 1TQBB 5C9JB 1I3RA 3QNZA 4YQXH 4LMQI 4R0LC 2WUBL 3O3EB 3T0AA 5T1LD 3B3IB 2ITCA 4BSVA 4HUNB 3UYRH 1KIPB 1TJGH 4HMEA 2XN9D 3KYKH 4N1HB 3MGTA 2EC8A 3MV7D 1EFXD 4P46B 4XVJL 3X3GL 3RL2B 1BD2D 2G75A 4RFOH 2GIYA 4NWUL 1ZSDA 3PL6B 5T5NF 4PJHF 3B43A 4ZUVA 5L8KB 3KLSA 1J0JA 4F7CB 5EU6D 5BZWB 12E8H 1NUDA 5D5MB 1YN6B 3FB7B 1VACB 1NCUA 1MCSA 4WJ5A 3QCVH 1TETH 4GBXD 1EZVY 3NGBC 4D9RE 3L6FB 3IRPX 1NCBL 1LILA 2XY2A 4H25A 4MJ5B 2RCSL 2V9RA 4XPBH 2QHRH 4FA8A 3UTTB 4L8SA 1TNNA 5D2LE 5EN2A 5FUZL 1PG7L 4MNQD 4YXKL 2EEAA 3MV9E 1ZTXL 1T7VA 3GSOA 3UBXA 4AIXA 4ELMF 4GAGL 2BVOA 4G8IB 2ZOKB 1R5IA 2V5RA 5M7QA 3NIDF 1JL8A 3QUYB 4U1MB 4WNQB 5GJSH 5IEHB 1XF4B 2NY0D 5L2KE 2I5YL 3WNMA 4D2NA 1JF1B 1QLRB 4EUPB 4GG6F 3S36L 4LSPH 3T2NH 4DTGL 4P3CH 3NIGE 4EUPG 3ULVE 2BXZA 1TTUA 5IEKA 4APQD 5BV7B 1NMAL 3UTSE 3Q6GL 1I7TA 4ZS6D 2R4SL 4X7EC 3X17A 3TV3H 3VWJD 3KPLB 2FCBA 4JAMB 4NOBA 1NBZA 2OI9C 4PV8A 5DHXB 4E5XB 1A0QH 1YEDA 5FGBA 1RULL 4UQ2B 1MQKH 4OZFH 3ZYIA 1ZK9A 3L7FA 4K23H 3RUGF 1MHPH 2JF1A 2APWA 4J3SA 1AFVH 2XTJE 1HQRB 3DUUB 3HZYA 1ADQH 5IVXB 4I3GA 1AD0A 4PJCA 4JY4A 3S9DB 2LU3A 4HT1H 4LEXH 1QRKA 5E9DD 5BRZD 5HHMD 3LH2L 4LVEA 1SJEA 4FFZL 3GSRA 2GAZB 2H9GB 3K7UA 3H7LA 4PREB 4TSAH 4Q9BA 2YHGA 1OT2A 3LKNB 2GKIA 1FJ1B 5TE7L 4NNPL 3RWJB 3IDNA 1IAMA 1SYVA 4NDMA 4PP2B 4ZQKB 1JGEB 2LQRA 3G9AB 1CG9A 4KTYA 3DJ9A 1J7VR 1KT2A 1UJ3C 2ENYA 4FXKA 3WFDL 2OM5A 4R8WH 3WE6A 3QG7L 5DLML 4LGPB 5EBLB 5TGBA 2ZOLA 3X3FH 1JZ7A 1BBJB 3ARBB 2GJ6D 4U7MA 2Q86B 4HFWA 1ONQB 2VRAA 4GH7B 4KJQC 1HILB 2AJYL 3MRIA 5DR5H 3CIQA 1PQZB 1LEIA 1KCRH 1CE1H 3PXHA 1MRDH 3DXAE 1KNOB 4KMLB 5GRXG 4Z7NE 3BMVA 4X6CA 4DQOH 2YUWA 1NC4D 2FWOB 2IQ9H 1E4WH 4OM1H 2V5SA 3QRGL 5DD3H 1MF2L 1IEAA 4HIIB 4JE4B 3ARUA 1JRHH 4DVBB 4Q58C 1CBVH 5IK3B 4HG4K 4OI9A 1HHGB 1U3HA 2X1OA 1KUMA 4X6EA 5EOQH 4C58B 2A77H 2UZIL 1Z5LA 2Q8AL 3Q5YA 4EDWH 1CYGA 3M45A 2O5XL 4G9DB 2ADGA 5AAMA 3RQ3A 4ODHH 3MRKB 3U9PL 3UJTL 1RJZA 1XZ0A 4NM8L 5ISZB 3W82A 4QCIB 5JUEH 2PYED 1BLNB 1YNLH 2DM3A 4AH2A 3V6FB 5H37G 2F58H 2DWDA 4P0DA 4JANA 4FQQB 2DN7A 1S7XB 1RI8A 2J8HA 5DK3A 2VR5A 3MLRL 1KENH 5B3JF 4HUUA 3JTCA 2E27L 2ZUWA 3EO9L 3LQAL 3S37X 2V5TA 1XGQA 4WTXA 1U8OA 1YEHH 3RPKA 3P40A 3WYRA 1K2DA 5ICZB 5IFHL 4PRIA 3PWNA 2CIKA 1Q9OB 1QRNB 4WI4A 2I07A 5C8JB 1KC5H 4OFKA 1S7WB 1FH5H 2ERJC 1WAAF 5KN5A 5K9QI 4X4MA 5ESAB 3ARWA 4CADA 2YC1B 5AEAA 1UG9A 1BM3L 1JHKH 1FFNA 4ZUWA 3U6RA 1V7NL 2DQDL 4Z7QF 2WUCL 5K9KA 1W0WB 1Y0LB 1I1FB 4WFFD 4XPGL 3P9MA 3KS0J 5E8NA 4ZOBA 3C8DA 3HE6D 3KXFB 4MA1B 3DLQR 3B5TA 1B0RA 4MYWB 1NBQA 1ZLUK 1QEWB 3UPRB 3HNVH 3CSGA 4X4ZA 1MJ7L 3WV0A 3C08L 2L0DA 3GEWB 2XQBH 4LRNH 4CNIB 4PGBB 5B8CC 1KPUA 4U6YB 3O9WB 1NCAL 3QNYA 1IAKA 3RGVA 3GMQA 1K3ZA 4P4KB 1YA5A 2VITB 4PLNC 5H35A 1ORQA 5DQJB 2YBRB 1B0WA 3OXRB 3FOLA 1XMWA 3SDDC 5FF6A 4ZOEA 5K9JH 1F6AA 1VFBB 3CNKA 1MFBL 3MGAA 4ZO9A 3O8XA 4I1NB 1N6VA 1N8ZA 2VZVA 3QDJB 4XPTH 1FO0B 4HJJL 3RFZC 2F54B 4MCYA 4BSWB 4KK5D 1T7XA 5IB1B 3TIDB 4G8FA 4MAYD 1YY8A 4RAHA 4ZFOB 1J0IA 3D85A 2PXYB 4JFEA 4UDUB 4CN1A 1TVBB 1BFTA 2J88H 3GIZL 3MZTA 1WEJH 4WUUA 2XTJC 1K8IB 1EXUA 2BNQA 3D2UA 2YPLD 1ZLVH 1NLBH 2Z91B 1DSFH 2LTQC 4F37F 5FO9B 4Y19B 1UACL 5LGJA 1FCGA 3OAZK 3SDCB 3MOBH 3H8NA 2VLJB 4QHNB 4PJHE 4O51B 3RBSA 3MRMA 1MIMH 2JELL 4UB0L 4XNQB 4DK3A 2OZ4H 4FQ2L 4YK4C 3KNBB 3OAUL 2YOCA 3HMWL 1JFQH 4JFYA 4X9BA 1P4LB 1RJYB 5CZKA 4ZD3H 4JN2B 5GISL 3VFSA 4Q7DA 1IL1B 5IJKC 1DQLL 3EW3B 4I18C 4NFBA 3HR6A 1KB9K 5KVGL 2ARWA 5HYJB 5CIPA 4LSTL 3UAJC 3VCLA 1R24B 3BH8B 1AH1A 1JPFB 3MCG1 3QSKB 3AREB 1HE7A 5DSCA 3CPLB 3QT2A 1UWXK 1A4KA 4S1SL 4OGXH 5GS1C 3INUH 4OLUL 1A1MB 3TJHD 4ELME 5FAAA 4P9HL 4Z76A 1OWWA 3MRNB 1W72A 4ZO7A 5HYEA 5EZOH 4N68A 4HFUL 2P4AB 1QG3A 4JRXE 3AS0A 3E2HB 1X5KA 4X4YB 5MEQA 1RHHA 3OX8A 2BNRD 4ESKA 4LDLB 4PY8J 2HT2C 3M8OH 1IC5H 1MCIA 5IM7A 3I02A 3MA9H 5EH1A 2CJUL 3BXNB 2LVCA 5FB8A 2H3NB 4PJBA 4BH7A 3IETA 5C7XL 1MIEH 3S34L 4XBGB 4JO2L 3OKMB 3G08B 1OGAA 5GGVL 3RUGE 1JUFB 5DT1L 1MREH 3BSZH 3QBTB 1LD9A 3I3EA 1YUHA 4RDQG 4CUCA 2XWBB 3TT3L 1CGSL 5F1IB 4IRZH 4PJ8A 3P9LA 2DQJH 3RJDA 4AK1A 3RZCD 4NBXB 2LV4A 2P8LA 2XOTA 3AVEA 3ULSB 1XH3A 4OUUA 4ZYKB 3GJEA 4M48H 4HPYH 1WIUA 1LK2B 3KLAA 25C8H 2AI0H 4XH2B 2X1XR 4OKDA 2X6MA 5CSZA 2CKBA 4QKXB 4KRPC 3QUXC 3MX0A 1A6WL 1XCTA 3NCEB 5FHBL 1UWGH 3VXUE 3SDYH 4LLDA 3ARQA 4R7DA 1X5JA 1KG0B 3G5VA 5FYJD 4MA3B 4UTAH 1QQDA 3OHXA 4M6NL 3T0WA 4MX7A 1LO2H 3GSNB 4M7JH 4NQCA 1X5FA 3H9HB 2PW2A 1R3IH 4TPRL 1LVEA 3IGAA 4IOIB 2Y7QB 2BOCB 4F7EA 2CMRL 4HAGA 4FFYL 4L5FH 4PTTA 5EC1A 1JF6A 2OSLA 1Q1JL 1F2XK 1KYOJ 2X4QA 5LG1A 4WU5B 3RTQB 5ESVA 2MKLC 1II4E 4Z0BL 2J6EH 4N9GB 4NM4H 4CAGA 2JTDA 1PEWA 3NACH 3GI9H 4Z78B 2V2XB 4Z0XA 5GRVL 5T1KB 4PRNA 5C0AB 4LSUH 5BO1H 2XFXB 4M7LT 4NNXB 1Y6KR 4LCWE 5T3ZL 1MQ8A 2UWEA 1YYLL 4NHUB 1RZKL 4ODTH 1KIQB 5F1NA 2NW2A 3L3KB 5TE6L 3EFDH 3I50L 4PRHD 4OAWA 1EHLH 4TSBL 2AS5M 2WBJD 1SHMA 3SGKC 3GK8H 4HS3A 5FYKL 5I73C 4Z18A 1VKXA 3UC0L 1FLRL 1N5AB 4PJXF 4AJ0A 3VG9C 3VXPA 5B3JE 5E5RB 4KJYA 5IMOB 3VWKB 4FN0A 1H3XA 3MA7B 3WN5A 4MJIA 4I3SH 4I0PC 4JM4L 3OKEB 2VABB 4ZNEA 4PBXA 2WMPA 3FKUS 3T2OA 1WWWX 3IDGB 3T0EB 2VXVL 4TUKH 2YD2A 1QYGH 1MI5E 4S2SB 1OAYH 4DFHA 2FSEA 1HI6B 4Z6AT 4ONFH 4N90E 1N5YH 4PJ5B 4Z7QE 3NCBB 4ENED 1BFVL 9CGTA 2BMKA 2WWKT 4NPYB 2HFGL 5ACLA 2OMBA 5IT2H 4OCXH 4UV7L 4OKVB 3HG1D 4F7CA 1AGCA 4LPUA 3SGEI 4U1JA 1T0NB 1QBMH 1YN6A 1DLFH 1VACA 3MV8E 3C2SA 4GLRI 5C70A 5DJ8B 1LK3L 2LE9A 2C3WA 3DX7A 3R06A 4M3KB 5IROA 3IJHB 1HOCA 4MQTB 2EIZA 4NO3B 5JQ6H 3VGAC 4OLVH 1NBVH 2NY1C 1A6VL 1XR8B 3T65B 4FQXB 1NCTA 2ZJSH 1KN2H 1HIML 5GGRA 3RIFF 1PX4A 2J6EA 1MAMH 1CDCA 4HUWB 4G8IA 1MRFL 3O4LE 5A40E 4WNQA 2VQUA 2COQA 4HKJB 3T0XA 1FE8L 1Z6JT 4UV4H 1QLRA 2VLRB 4OI7A 1JPGB 4HV8B 2HN7B 4J6RH 5I0DA 4Y4KC 3TA3B 4KRLB 4M1CC 5DTFA 1DBJH 1MFAL 2CUIA 3WNLA 2FATL 4FQLH 1FFOB 2VB5A 3HZMB 1TJGL 1R3HB 2HLFC 1QFHA 1A6AA 4BUGA 2V6HA 5C07A 3TZVA 3HLAB 3KYKL 3NCCB 4HJ0C 4JAMA 5KSUA 4WTZG 1S9WA 1P69B 4ERSH 1RK1A 3EGSA 2APFA 4RFOL 4HUVA 1Q9WA 2EE2A 4LDEB 3F62A 1HQ4A 2D4DA 2VZ3A 5IHZA 2BJMH 1G7HA 3I3DA 1G7QB 12E8L 4MJ6A 3VMOA 5D2NB 3WFZA 4WHYG 2XZZA 1IAIL 3CFDB 3QCVL 1A7BA 1TETL 2ESVD 1SY6H 3ORJA 3BIKB 2AAVA 1CK0L 5J12C 1BIIA 3DX6B 2CRIA 3QXAA 4X83A 3RIAF 3H9SD 2QHRL 2PO6B 4Y4FC 3LKNA 5I8CB 3RWJA 2X4UB 3O6FB 4PP2A 4HGKC 4WGWB 3L9RB 2R9HC 3RPIB 4OGZA 3LQAC 3VFPB 3MCKB 2E8YA 4XB8A 2DM7A 4FS0A 3LKRB 4HZLB 4RISH 1CF8H 1E4XH 5EBLA 1K9TA 4BQ6A 4XNYH 2CLZB 4LSPL 3T2NL 2AQ1A 1BBJA 1INQB 4PG2A 3B4NA 1ED3A 4G42A 2XQYK 3JXAA 1F13A 4M43H 3MJ7B 1OAUH 5CJXA 1LEGB 1N6UA 3TV3L 2D9CA 3BP4B 4ZXBC 2A83A 4QRRE 3C09B 1HSBB 2RR3A 1OSZB 4NBZB 5AZEH 1MQKL 5IFJB 3VFNB 1X4XA 4MXQA 1JZ5A 4HIIA 4XXDA 1X6NA 4K23L 4YDKH 1WCBA 1MHPL 5GRJH 2MTPA 2BCKB 5C0DB 1AFVL 1NL0H 1I7RB 4RQQB 1OP5K 1ADQL 3OAYH 1NGWA 2M8XA 1GPOH 4HT1L 4LEXL 5JXEC 4O02H 5T1LB 1FC1A 4O58H 4DK6A 3GMPB 3MRKA 5F3BB 1C12A 2XN9B 3E6HB 1KGCD 4TSAL 5DMIH 5HHVH 2HVJA 4CVZB 2V2WA 1IFHH 3MV7B 1EFXB 3S3JA 3PHSA 3EKCA 5T3ZE 3G6JB 4D8PB 1BD2B 3FONA 4EDXA 2FEDC 1S7XA 3M1BB 5GHWH 4R8WL 2DRUA 3WHE1 5EU6B 4F57H 3P0VH 4JFHE 3DV4A 3JV6B 3X3FL 1PSKH 2IC2A 3UTQA 1EEUA 3LPGA 3TPUB 5KS9A 3L3HA 2YUVA 2GSGA 2FLBT 4GBXB 2WK2A 3P0YH 5C86A 5ICZA 5C8JA 5DR5L 1F42A 4H5SA 1KCRL 1CE1L 3TP4A 1MRDL 3IDYB 4UNUA 4KJQD 2YC1A 3V6OA 5I16A 4DQOL 1E4WL 5F1KC 4OM1L 5DD3L 2CLVA 5CP7B 2R2EB 2IANB 4JKPH 4MNQB 2R2BA 2IPTL 5I74B 5KANG 1T2XA 1QD0A 4AYFA 1JRHL 2NY0B 1CBVL 3HRZA 1BFSA 3C60C 1T6VN 1I75A 3UPRA 2ICWB 4AEEA 2DQGL 1A1NB 3WFEH 3D25B 3V52H 4APQB 5BZDA 5SX5K 5HHNB 4D3CL 4CNIA 2X4TB 4M4PA 4K3GA 3O9WA 5CUSL 1JPST 4P4KA 4DUXA 4P9HC 3VWJB 4GRLC 5JUEL 2RFXB 1P7QA 3BIAX 5IIEB 1JBJA 1GOGA 1KTDA 5D70L 4CJ1A 2ID5A 2VL5B 4PJXE 4LP4A 3QUMH 3BP6B 2X4OB 3BN3B 4IRJA 1I9RL 2R23B 3TIDA 3WIHH 3QEQE 1CDUA 4NRXB 4FZ8L 2L7JA 1YEHL 4UDUA 2APVA 4L1DA 5E9DB 1LNUB 4X4XB 5CILH 1EEYB 1FQ9C 5HHMB 2MJWA 1KC5L 3S5LB 1FH5L 4Y19A 1U9KA 2VISB 4KUCD 4G6FD 1MWAB 3S5LG 5BCAA 5HYSB 3WO4B 1IKFH 1NH6A 3AS1A 3SCMC 2J1KA 2P5WA 5I1DA 3DX8A 1VGEH 3N1MC 1HHIB 5JNYA 2VC2L 1U8NA 4OCWH 3C6SB 4Z7OF 1D7FA 3KNBA 4PJDB 3TBVB 3VXRA 2EC9T 4J4PA 2OTWB 2XZAH 1URLA 3HNVL 2GJ6B 1CFSB 4HK3J 5ENWA 1I3UA 2AK1H 3BMWA 1QTYT 4M3JA 5HYJA 3QDMB 1I1YA 1WIPA 3EJJX 3Q6FB 4ZDHA 5DJXA 3BH8A 1HNFA 2Z35B 3AREA 4HMCA 1UADC 3LN4B 3IJSB 5C0JA 1NC4B 1T04A 3HI1A 1UENA 4UT9L 5K9JL 4X6DF 2CH8A 1CD0A 5H94B 2G5BA 3B9KD 3DROB 3SDDD 4EN3C 4EZMA 5D7IE 5F6HJ 3AXLA 1QR1B 3KPRD 1YN7B 2W07A 1AHWB 1F58H 2OXHA 3ARDC 2J88L 2A38A 5E5MA 2IAMC 2Q3ZA 5KSBA 1WEJL 3WJJC 4WFHD 3FQNB 4YR6A 2BVQB 1N0XH 4OZHA 5D7SL 3SY0B 1MCFA 2NX5E 5D1ZD 4PLJC 2XTJD 2EDLA 1NFDF 3JWDH 4YIQA 1CFTB 2PYEB 3MOBL 3MRRA 3DRQB 3T0BA 4Z8FL 3E3QA 1ZHLB 4YUEL 1JUFA 3TFKA 2OZ4L 5DJDB 3WIHA 1YPZB 4LCYB 1S7VA 2KH2B 2YZ8A 1RZKC 4OQTL 2XWBA 3N1GC 2N4IA 3IDIA 1CCZA 4ZD3L 4Z7VB 1T89A 3ULSA 3GNML 2ZNWA 4ZYKA 3BEVB 4NGHL 3WFCH 1VENA 5FK9B 1WFTA 2W60B 1IEBB 2A6DB 1J11A 4PY7A 4HX1B 2V7NA 1HH9B 1TZGH 5DRNB 1BF8A 4OGXL 3INUL 1CLYL 4ORZC 3UAJD 4DKFH 2R56H 5ANMB 3BGMB 1FVEA 3OXSB 4HDIB 4NCC2 1EHXA 4L9DA 3LRGA 2BVYA 2C1OB 3DXAD 4NQSA 3W81A 3VFMB 2DMCA 5EZOL 4MA3A 4F7PB 3HE6B 4BSJA 2AEQH 3GSNA 3STLA 1JNHA 1LHZA 2AXHA 2Q76A 4Z5RA 3QO1A 4Z7UE 3H9HA 3IFPA 1IC5L 3MA9L 4XRCB 1J8HE 2HT2D 3G5YB 4XMPH 2VR9A 1TCRA 3ZT6A 4I77H 1CL7I 4KDVA 3BQUC 3VXMA 2APBA 1VEPA 3B9DA 1NFIB 4Z7WF 3HRPA 1ZGLA 1HXYA 5T1KA 2DTSA 1JTPA 4MAYB 3EYSH 2H32H 5C0AA 2HG5A 2XFXA 1SYSA 4IRZL 5ITBL 2M26A 2DQJL 4NNXA 4QTIH 5C9KA 5JTWA 4HKBA 3MUZ1 2FJFA 2YPLB 2P49B 1MH5B 1G84A 3L3KA 4M48L 4HPYL 2OLDA 3QAZC 4Y7MA 4FQJH 1XF2A 5FGBC 4XVSH 1OLZA 5D1QB 5DZLA 1X5LA 4L4TD 43CAB 1A6UH 3FQTA 5L6YH 4XP6L 5A2LH 3NPSB 1I7ZB 4X98B 3G6DH 5I1LA 3T2PA 1UXWA 4KRPD 3QUXD 4TULH 3SDYL 3ULUF 5DD1L 4UTAL 4MVBA 3MA7A 5F7FA 2NTSP 1DP0A 3UBXI 5F89A 1LO2L 1T21B 1EAJA 1ZAGA 1UM6H 1RZ7H 4KK9C 3ZMRA 5EUKA 1R3IL 3P4NA 1DQQA 3T0EA 2ZUVA 4S2SA 5F7EL 3DI3B 5TDPA 3HMXH 4L5FL 1HI6A 4OSUL 2VXTL 4RIRB 1TJIH 3L3OA 3WKML 3LS4H 1M05A 5DDHB 3WHXA 5HGGS 3U0PA 1XGTB 4UINH 4NM4L 1XF3B 5T33H 5F9JB 3C8KB 1OD7A 2LAAA 3LKOA 3NACL 3GI9L 3LQMA 4B41A 4XAKD 3VD9A 5IR1B 1A1OA 4B53A 2BNRB 4TUJB 4LSUL 5BO1L 3BH9B 3KPOB 3LV3A 1ZEAH 1E0OB 4ONGL 5A3IC 4N5EA 1AQKH 4YGVA 5GS3A 4DGIL 6CGTA 4UTBH 3ULUL 2NY6C 1G7IA 1UZ8B 3EFDL 2GJZA 3R0MA 3BDYH 1EHLL 3OKYA 4TVSa 5A1AA 2DM2A 1G6RB 3WLBA 3GK8L 4U1IB 3V79C 1XIWA 5C0IA 4PV9B 2YD9A 4FFVC 3EIFA 3WKNA 2YA2A 4OGYH 2EDDA 2ICCA 5B3NA 1IGFH 2GTWA 4HKJA 3L5WA 5CKAA 1U3HC 1D5IH 3K46A 2VLRA 2EKSA 2H32A 2J5LB 3SQOH 4HV8A 2YA0A 1KJMA 1SBSH 1T1YA 3GKZA 1YYMH 2GK2A 1BP3B 1N7ML 2FO1A 2R2HB 3RZCB 1H3PH 4R4BA 1R3HA 5C6PB 3GUTB 5D7LA 4I2XE 4TUKL 4I0PD 5IMKA 2R29H 1Z0MA 1QYGL 5F9OL 1UGNA 1OAYL 1RJCA 1F4WH 3FFCD 2DLTA 1N26A 3BD4A 4ONFL 3V5KA 1N5YL 1TZHB 4JFDE 1ZA3B 3O3DB 4J1UB 5I2IB 1C5CL 5IT2L 4Z7OE 4OCXL 1KEML 4OLYL 3T8XB 1G7QA 4XCCL 2AJVH 2C3VB 3RBGA 5ICYB 1DLFL 1TXKA 5EO1B 4RGOH 4N0RA 1YEGH 1PBYA 2X4RB 2DM4A 4ODUB 3KYOB 3LB6C 2FX9H 1MCWM 2AJSH 4Q0XH 1RD6A 3PWPA 3TM6A 1P84K 3HMXA 3HI6H 2E7CA 1HHJA 1JGLH 1VFAB 4MNGA 4JRXD 5DJ2B 3KPPB 4N0FA 4OLVL 1NBVL 4M8QA 3D1MC 3BYYA 2V2TB 2ZJSL 3O6FA 1HWHB 2WIIB 4X6DE 5EO0A 5EUOB 5AYUH 1MAML 2NY1D 4K2UL 1S9VA 5DS8B 3UTOA 4L8BA 3LKRA 1ZVSB 3L3IB 4QRPA 5JOFA 4V3EB 5ALCL 2DWEA 2CLZA 5DUBA 4XWOC 1FYTD 2J2ZA 4D9QD 1UH4A 1VHPA 3VDCA 3EYVA 1GSMA 5FHAH 1CXIA 1BGXH 4FQLL 2W38A 4LF3A 5HI5C 4N8PA 4M1CD 3RGVC 4BZYA 3OQ3B 5J6HB 3D0VA 4ODXB 5IGXH 3FQXB 1NFDE 1LEGA 4PRHB 3BP4A 4G9FB 5IBUG 4YC2B 2HLFD 1AO7B 5DEFA 1HSBA 2WBJB 1CDGA 3EDEA 3O8XC 4ERSL 3ARGA 2ZKHH 1X4ZA 5ICXB 1KB5B 4QTHB 2EICA 4HJ0D 3KPSA 1E27B 4LHQB 3RWIB 5I1KH 1G7JB 4HK0B 4O5LH 2YXFA 2BCKA 5C0DA 3WJLA 4MQSB 4LLYA 1V3MA 5EU3A 3BAEH 3V95A 4TOYH 4O2FB 1RZIB 4MGXA 1U8QA 3DGCR 1SY6L 1YJDH 1MCRA 5EIIB 5CLWA 5ALBH 5T3XH 2MFNA 4NN5C 2R2CA 4OF3A 3R4DA 1IEHA 2R0LH 1IGJB 2MSPA 3QUZD 3TYFA 4KHXL 3VFRB 3MV7A 1JTOA 5A2JH 3TBYA 4KRNA 4LASH 2IF7A 1T2QL 4Y4FD 4GAYB 5E6IA 5C92A 2EDTA 1MELA 5E03A 2R9HD 3M1BA 1T1ZB 3HG1B 4RISL 1CF8L 1E4XL 5EU6A 1AGEB 3SJVE 3S88H 4XNYL 2VAJA 5D6DC 4MHHI 1JRHI 2B5IC 1I8MB 2ITDB 3BPLB 3T1FA 3LN5B 3JVGC 2GITB 1R5WA 3A0OA 1OAUL 4K7FB 4K55A 1JP5A 2I9TB 3UP1A 4RRPA 4JFPB 3W5NA 4ZXBD 5FO8B 3SO3B 3W11C 3GSWA 4D0BB 4P57B 3LN9A 1W0VA 4GG8B 4Z7WE 5JDJA 4YDKL 1YQVH 1OW0A 4OCYH 5GRJL 1IQDA 1A6ZA 2J7LA 4JFFE 4ORGB 4GUPB 4U1LA 4N0UB 4PJFB 1GPOL 1A1NA 3KDMA 4QYOB 4JZOB 4O02L 5GQBA 3S6CA 2W92A 5EZLA 3QWRD 4O58L 5GS2D 3BKYL 3ARTA 4NQEA 5JXED 4PJ9C 4R0LB 2J8UA 4LIQH 3TO4C 3I6GA 1T4KA 4HS8L 4DGVL 5DMIL 4PGDB 3GRWH 2XZQH 2F9BT 4YHLH 4WW2B 5D72L 1S5HB 2XKSA 5FGCB 1UCBH 2VL5A 2VUOA 4J3WA 3BPNC 1HHKB 3BP6A 1MLBB 4OZGF 3ULUE 4QT5B 5GHWL 1XGPB 2DLEA 3P0VL 4PJ8C 2FEDD 1WWAX 3VDAA 1PSKL 3FO9B 5DUPH 3NN8B 4OZIF 5I9QC 1J86A 2ESVB 3EYQC 2AXGA 2OP4H 5BRZA 3D39E 1EEYA 1CQKA 1LEKA 4HIHB 3H9SB 2JJUA 2VISA 5C2BH 1KCGC 5HYSA 1R3LB 1MRCH 1KJ3H 4QEGA 2FEEI 3C5SA 3CVHL 4G80B 5FGRA 1X3DA 1RVFH 3CFEA 1L0QA 4FP8L 5I8KL 1NEUA 1EGJH 4PJGA 1G9NH 2DJ4A 2YK1L 2F74A 5JZ7C 1Q9KB 3WFEL 2GJ6A 4NKOB 3CSYB 3C60D 1MPAH 3F12A 5EU7E 3OWEA 3PWJA 3KLDA 3KWWA 3OMZA 2O5ZH 5LCVL 4QRUB 2Z35A 1T5XB 1PGRB 4R4NC 4KKCC 1UM5H 3S97C 4GRLD 3CLEH 1YY9C 3BEWA 3QUML 2OI9B 5E8EB 2YD7A 1ZWIA 1AP2B 5HHPA 1D5ZA 4QOKD 1R3KB 3FN3A 1CGWA 5IQ7L 2JJWA 1B4JH 1AHWA 1S7SB 3O6LH 2AK4E 3RL1B 4U05A 5CILL 3SDXF 2ZSWA 3GJFH 5C08D 5BJTB 5EFIB 2OTUB 3GRWA 3D3VA 2HJFA 3SPVA 4P49A 4QF1A 3QG6B 2ENSA 4X6BB 2PYEA 4NQDB 4AQ1B 3FOMB 4CVXB 4LU5L 1IKFL 1CE6A 2H26A 2APTA 1VGEL 3N9GH 2CQVA 4ETQA 4L8CB 5EA0L 5C6WH 2X44D 3SCMD 1YPZA 2IJ0C 1F3JA 3RHWK 2GT9A 1H8OA 2XZAL 1FZOB 2FL5A 5F3HB 3QDGA 5E4IA 2AKRB 4KDWA 3MV11 3P73B 4DOHB 5GJTH 1GC1H 3PQYD 4PRAA 3FT4A 4U1GC 3MLSL 5IUSA 4L4VE 2VO5A 5KAQG 2W60A 1IEBA 4JHWL 3QXVA 3P11H 3ES6B 5FFLA 1KJ2H 3MRHB 1NDMB 3HC0B 1CDYA 2WLYA 4H20H 5CCKH 1M7IB 2ZWLT 3TIEB 1NAMH 2W0FB 1EGJA 4PJAB 2C1OA 4XPFH 2Z8VC 1NKRA 3VXSD 1F2QA 3KJ6L 4EN3D 5F9AC 1FNEA 3HE6A 3QIUD 3NA9H 4XX1G 4Q9CA 1U41A 4CJ0A 3S8WA 1N0XL 3RWDA 5K9QG 3ARDD 4XRCA 2IAMD 5DHVH 1YMME 3G5YA 1AI1L 1FVCB 3GMOB 3JWDL 5L2JA 5E1AA 3O2WH 4V1DD 4X5WB 5JIHA 4PLJD 3BISA 2XA3A 2H2PC 3S35X 2VZUA 2YKLH 4GQ9H 4L3CB 2ARJB 2PR4L 3L3JA 1WZ1L 2HJKA 1WBZA 4L4JA 4JPIA 3OZ9H 1INDH 1CXLA 5DVOA 4WUKH 5IBTH 5GGSB 2AERT 4NWTH 2ATPA 4U31A 3VFUA 4PJIB 1DN0B 5DEGB 5DUMH 3ULUC 5KTEL 4CVUA 3GJFA 2R1XA 2KZ1B 4IJ3B 2NTFB 3L7EA 4PD4J 5CGYC 5J1TC 4JZJA 2D7NA 3TZVC 1MH5A 4XP5H 3WFCL 4JFHD 4DUVA 3F7PC 2NW3A 1TZGL 4RA0C 4G6FB 2P5EE 5FYKD 2D0FA 3N1PC 2ERJB 3DGGB 4DKFL 5CEYA 4R6UA 1A4JA 5IF0B 5CHNB 4LHUG 2R56L 4YPGB 1F90H 4X98A 2B1HH 1J87A 3IDXL 1AY1H 3MRPB 3MRFA 4X0KA 2IALB 1CTNA 1QR4A 1OAXH 2OMNA 4CKVX 1P4IH 4E41A 1A7NL 5BXFB 2AEQL 2SEBB 3MRDB 4TYUA 1Z9SA 3UYPA 4G43B 1PKQE 4NKMB 2E7LE 1ITCA 4OCRH 1DR9A 1ZA6A 2R1WB 2VDQH 2UVFA 2Z0BA 5HPMA 1KJ2A 4WI2A 4RIRA 3QCTH 3QCUL 3TJHA 4I77L 5DDHA 1U36A 1BPVA 4LQFH 4K8RH 4OCNC 5EBMA 3B9KB 4OF8A 3SDDB 3C8KA 3OSKA 1YNTB 2EE6A 1QSZA 3BQUD 4MWFB 4WRLA 2Q7YA 1D9KA 3CX5K 3KPRB 4UAOC 3EYSL 1FL6B 3NFNB 4OLXL 4TUJA 3KPOA 1FV1B 3MNWB 1FFPB 5MHSD 1JYVA 5ID0B 3G5XA 4NCDA 5DHVA 1GZPA 2CXKA 2P48B 1S9YB 3MRQA 3OGCA 5D1ZB 5IKCA 3VGGA 4X5XB 1TCMA 3PGCB 4U2YA 4XVSL 4Y16C 2ICEA 4GKNA 3OJ2C 2LTQB 3TF7C 3QEHA 1A6UL 3K3QA 2AP2A 3SOBL 4OZGE 2YD1A 3G6DL 1OPGL 4G8GE 3DYPA 5EU5A 3EOAA 5AD0B 4TULL 3Q5TA 1M7XA 4Y2OA 5C0BE 3IDUA 4WWKB 4OZIE 2FYYB 3BDBA 1DVFC 4YK4B 4R3SB 4ZFFA 4JREC 1RZ7L 2YWYA 2GFBA 3SKNB 2BRQA 3T3PF 4I18B 3ROLB 4KK9D 3MBXL 4I5BB 5DK2A 5D93C 1HHHA 1TJIL 3FB5A 3O3DA 1TLKA 1CI5A 3CLFH 3ZLQC 3B9EA 5T33L 5GS1B 3T8XA 1RUKH 3QI9C 3O2DL 2EO9A 1S5IH 3KS0H 4HBCL 4MSWB 5C0CE 1R3JB 4DEPC 2HTLC 4RAVB 1ZEAL 4RGNC 3H3KA 4GS7C 1QZ1A 4PR5B 4UTBL 3V6OC 2FIRT 4D0CB 4JDZA 1UKTA 5HYQB 1SVCP 5DJ2A 5A3ID 2VL4A 4BZ2H 1MCCA 4PRDB 2NY6D 5EUOA 1UYWH 2W0LA 3MNVA 4V2BA 4ZSOB 3L95A 3F7VB 4LAQH 3EDJA 4N9OB 5HGDA 4PLOB 1LO5B 1XGYH 3DMMA 4MXVF 4XT1C 4R90H 1IGFL 5IOPA 1VA9A 1D5IL 3CSPA 4FFVD 3SQOL 3UTPE 1SBSL 3HTLX 3MYJA 5JHDE 2YPKB 1U3HD 5FKPB 3VMPA 5IV2B 3U36A 4X9GA 1QUNA 3SDXE 1QA9B 1JGVL 1AD9A 4XP1H 3T4YB 3ZZ1A 4CL7A 5J6HA 5KSAA 3FQXA 2R29L 1UB5B 1F4WL 2K7QA 1LP9B 2VDLH 2UV3A 2EYRB 2JJTA 4L4TB 4M93B 3QQ9C 3BO8A 4HKXB 4IRJC 1PVHA 2EH7L 1PFCA 4PJ7B 1U92A 1G7JA 4FQHA 3QUXB 4KRPB 3WLWD 4PG9A 2C3GA 3GSUA 4P2YA 1UH2A 4KJWC 1T3FB 3UTZB 2AJVL 4S0TD 4JQIL 2AXFB 1RZIA 1DQJB 4RGOL 1E4XI 4EKXA 5D6CA 1T0MA 2VZOA 2AJSL 1ORSA 1KJVB 4Q0XL 4PRID 1JGDB 4I48A 4FXLA 3IB4A 1JGLL 3EYUH 3LB6D 1LO3L 1C16A 4Z9KB 1IGJA 3V5HB 3LSOB 4YEEA 5FYJU 1KBGH 2OL3H 1QSFA 4ZUTB 5AYUL 3FAXA 3SE9L 2XY1A 4IS6B 5SWQA 5BVPH 1P9MA 4IHOB 4LSVH 2C5DC 3QEUA 4JM2B 3IF1A 1T1ZA 4JLRA 4WI6A 1CIDA 4UDTA 4MJ2A 1AGEA 1Q72H 1MAKA 2GUOB 4JG0H 3LIZH 1BQLL 4F9LC 4BKLB 1EMTH 5ECJE 3HUJE 4LAJH 5FHAL 4TVPL 1BGXL 4G3YH 3W2DH 1TPXC 3LCYA 4XWOD 5LWYL 4J3XA 1IGTA 3OG4B 2NQCA 5IGXL 2ADFH 4HG4J 3IU4H 5HI5D 3V4PH 3BX7C 3DUSB 3RGVD 4U0QB 5F1SA 3PWVB 1KEGH 3BZEB 5FO8A 4KUZL 7CGTA 4D0BA 4I9WD 1DL7H 3O8XD 4P2QA 3VJ6A 5I1KL 1PYWB 5F7DB 5I73B 4ORGA 2JCCA 3ILPA 5DA4A 1EFQA 3VG9B 1TENA 4Y1AD 2DAVA 3CDFA 5DD5H 3ZL4L 1YJDL 2C9AA 4GW1A 4WUUD 4HKZB 5DJ6B 3D2UD 2K3TA 5ALBL 5T3XL 4P23C 1RQ5A 1J0KA 2AJ3A 2XXMB 1S7QA 2UY6A 3P4MA 4PGDA 3FFCB 4FG6C 4KJPD 2R0LL 1CDJA 4RWYH 1G7LA 4NBYB 3QDHA 4XGZA 1HDMB 4NUJA 2V5MA 5I1EL 1FIGH 4LASL 2CIIB 2JJVA 1EX0A 5I1JH 2NY2C 2RGSA 1MLBA 4RFEB 4QXUH 4C56D 1F02I 1KTRL 1BVZA 1F6LL 2ZUQC 5DD0L 3S88L 2DIAA 1ZANH 3FO9A 3VGFA 1T89C 3TNNB 2JIXA 5TF0A 4Y5VC 2HJLB 1MFEL 4QNPF 5ID1A 3VA6A 4P2RE 5DRWB 4AZ8A 5K59F 4LLWA 4GG6B 3TEUA 3QFDA 4HIHA 4X9IA 5HJ3A 4PTUA 3MACL 2OL3A 2Y1VA 1OTSC 3EZJB 4G7VH 4LNVA 3C9NB 3FO1A 4LSRH 1R3LA 4QHUB 1HKFA 2X1PA 5SWSA 4QRTA 3VGAB 2NY1B 3LEYH 2NR6C 2C1PB 1YQVL 5DC0A 4A6YB 3W11D 4OCYL 4QWWC 1H3TA 4LKCB 1RUMH 4JFOB 1FYTB 3PE9A 4NQUA 3RZWA 3DSNA 3PGDB 2XRAH 2DIJA 3BUTA 2MQ3A 3QJHA 4WI5A 5L88H 1FZKA 3LMJH 4U2ZA 1WBYB 1NGXA 5C0GB 4EIGB 4FQPA 1MVUB 3GRWL 4K71B 3DVGB 3TO4D 4YHLL 4PS4L 3RNQA 1KPRA 1K8DA 4YHKH 1UCBL 4NZTL 5J13B 1L9NA 5DVMA 1QO3A 5FO7B 2CDEB 4UQ3B 1IM9A 5INDB 4MMZC 3JTTB 2BOBB 4JFDD 5DUPL 3B8SA 1S7SA 4PJ8D 3JWDC 2NY3C 5ESQA 2OP4L 3PDGA 3EHBC 3N85L 1BIHA 3T3PE 5I8OH 4KDTA 1C1EL 5C71A 5C2BL 1CFQB 3X14A 2AJZA 2RB8A 3QUZB 1A7RL 1MRCL 3WNKA 1KJ3L 1KLGB 2NPLX 2OR7A 4OGAC 4X5LA 1KB9J 1JYWA 1RVFL 4Y4FB 4XNMA 4MD4B 4R4FL 3CFKB 4L8CA 2C4FU 5IMLA 4MLIA 4MVBC 4UU9A 3DETC 5IMMA 4HH8A 3HPLB 5JPMB 5D7KD 4D94A 4ZUUB 1UJ3A 3JTSB 4XZUA 3ARVA 3KPNA 5E2VH 5F3HA 4CBPA 4JN1H 4K3DH 1XCQB 4W81A 4MNHB 3C5JB 2X4PB 1MPAL 3VD4A 3PV6A 4LPWA 5JZ7D 4MD0A 4NKDB 3NAAH 2O5ZL 3EYFB 2GY5A 2IPKB 3ES6A 3VFVB 2QL1A 4BFIB 3MRHA 1NDMA 1D5BB 4HIXH 1RZJL 4ZXBB 3ULVH 3K2UH 3FHQA 3ET9F 1YEKL 3TIEA 1AGFA 2BNUA 3LQZA 4R4ND 3J7HA 4AT6B 1V3LA 1YY9D 3GM8A 3QUKA 4U6HB 1MJ8H 1T7WA 4TQEL 5TQ2H 1B4JL 3V5DA 4ZUSA 3O6LL 3OG6B 1S3KL 1B2WL 2L7UA 2OX5A 1P6FA 1CR9H 4N8VA 2CRYA 3DURA 3PDDA 1U8JA 2J8OA 4JQVC 1IC7H 1NUNB 3DO7A 1KIRB 3HCVB 3GMOA 5HI4C 4GW4A 1XIWC 1NBYA 1DLHB 2EDBA 3ZE2E 4TVPE 3DYOA 3ROOA 3TO2B 2ARJA 2RJMA 3UPAA 2PCPA 3AUVA 2GCYB 3GSQA 2HH0H 5HHOE 5LAXA 3N9GL 2PNDA 4OBRA 1F4HA 1A5FH 1PJ9A 2H2SC 1BOGB 3E8UH 3MJ8A 3QQ3B 4FFWC 3LHPH 1OP3H 2CSPA 4PJIA 1NEZA 32C2B 2XNAB 4MJID 2O26U 4LARH 5JR1L 5GJTL 4L1HA 1GC1L 2XTLA 4OV5B 4PRPE 3O11B 3U1SH 3P11L 1OAQH 1KJ2L 2FJGA 3B2UC 3FCTB 1G0YR 2V9QA 5C09D 5IF0A 4H20L 5CHNA 5B4MC 5CCKL 5GGUB 2DQUH 4IRSA 4YPGA 4F2MB 1H3UA 1NAML 1A3RH 1AKJB 4WCYH 3QZWB 5D5MF 1UVQA 2NY4D 3JV0A 5CEXB 3P77B 3C5ZA 4OZ4B 5FYLE 3HZVA 1OGTA 5HTSA 3QZWG 4XHJC 4KVNH 1D5MB 3ELAT 5D2LA 1QKZL 3NA9L 1F3RB 3MV9A 4XBEL 5TFSL 4NKMA 2ED7A 3MC0A 5L2KA 2G9HB 2V17H 4IOSD 3KPMB 5FECB 5FKAB 3GMNA 4M5YL 4JFFD 4MQXC 2Q87A 4CN4A 4NQXA 4JY6B 4W4OA 5SWZE 5B8CA 1ZHNA 2Z8WC 1BWWA 2ZG3A 1OSPH 1X6LA 2NNAA 1KSRA 1FZMB 4GQ9L 3BWAB 4GRLB 3UTSA 2X41A 3QO0A 4H1LH 3SDDA 3EYOA 2H2PD 3TJEL 4BQCA 1YNTA 2E7HA 3QIBC 4XWGH 3MR9A 1J05A 3LDBB 4UZGA 3OZ9L 1INDL 1WTLA 4MWFA 3OR7A 4QOKB 3RVVC 5IJVB 1A7QH 4WUKL 4XPHH 3CZFA 4TRPH 4NWTL 1FL6A 3S96B 3DECA 1FFPA 3BPOC 4RGMC 1EO8H 4JO1H 2A0LC 3ARFB 4XP5L 5C08B 3DI2B 1DE4B 3MLZH 2QQQA 1KACB 1VGKB 5CGYD 3T04D 2FH8A 4ALAH 2WWKO 1BVLB 2D31A 2GI7A 3TZVD 4AEIH 4WEUD 2OQJB 3VH8B 5I1HH 1JZ4A 1IE5A 3LAFA 5CJQH 4PGEB 4WFEE 3VH8G 1AGDA 5FDWA 1F90L 3F7QA 2B1HL 3CU1A 2GK0B 1AY1L 5IVXF 4IMKC 2W9EH 2MHAB 4HUXB 1JWMA 2BFVH 2D0GA 3V0VA 2R0KH 4JDVA 2AV7A 1UXSA 4QNPE 5DYOB 2WUBH 1N64H 3BVNA 4H88H 3PQYB 4OCRL 1U3ZA 3AAZB 5IJKA 1P2CB 2VE6B 1KLFA 1OAZL 5BV7L 3OTTA 3B83A 1ZLWH 3HFML 3QCTL 5E6IC 2HRLA 1F11A 3DRTB 3RDTB 4XVJH 3X3GH 4EXKA 2DBJA 1HYSC 1NLDL 1JMXA 4LQFL 4K8RL 4EI5C 5DO2C 2YRZA 3BPCB 4NWUH 5GS1A 3DNKA 4NSKA 5KSVB 3NBNA 3DXAA 4KQ4L 3VXSB 1NPUA 4EN3B 1IKNC 2BVPB 1R3JA 2J4WH 2D7QA 1CU4H 4HCRH 3FZUC 3QIUB 4C83B 2VDNH 3S37L 4P4RA 3M17B 2C3XA 1NCBH 3BW9B 5IB3A 4JRYE 4YNYA 4D0CA 4Q2ZB 4E42B 5HYQA 1D6EB 3EJYC 3VXQA 3FB8A 1XFPA 4PRDA 4V1DB 5DGQA 3C6LA 2GTZA 2XQYG 2AK4D 4H1LA 3F7VA 4P9ML 5I8EB 3EO0B 3PP3H 1OW0C 5F7HA 4DAGL 5JOPE 4NCC1 3CDGB 1M6OA 2BSRA 1WFOA 5HYIA 1SJHB 2NYYC 4LKXB 1JMZA 4Q74A 4ZPVA 1IGIH 3ALWA 3S36H 1J0ZA 3QFJD 2YD5A 4RCAA 3V6BR 3LVEA 3O41A 1I3RB 3DIFB 5DJCA 3QNZB 4F8TA 1QA9A 3VXTA 1EK3A 2ITCB 3ZKNC 4BSVB 1DVFD 3MRLA 3IAGC 4HWEL 4CW1A 4MMXC 3BZFA 2E9WA 2R4SH 3FAWA 2K1MA 3MGTB 1YQ2A 4L4TA 4BELD 1G1CA 2G75B 1P53A 3DHJA 1SVZA 1ZSDB 4CN6A 3SGJA 5I1GL 3QUXA 4ZUVB 1EUUA 4L3EE 1RUKL 4Y8DC 3W0WE 1FSKB 1YJDC 2NXZC 3RHWF 1H8NA 3BHBA 1S5IL 1RUPL 2AXFA 2EC9U 3LKQB 1AGBA 2P7TA 2WW8A 4WJ5B 1KCVH 3ARPA 3ARYA 3PGFH 4ELKA 5HVHB 4DZ8A 4FFZH 5IB4A 2HTLD 5D7JC 3QPXL 5B39B 4RGND 4BZ2L 2VSDA 3V5HA 5ADPH 4NO2A 5TE7H 5J57B 5HD8C 1RK0A 3W9EA 5I6XB 1IGMH 3MREB 5EN2B 4FOMA 2VLKE 2I9LA 3GSOB 3UBXB 5EWIH 2BVOB 3CGTA 4AMKH 4GRWH 1QACA 3QG7H 5DLMH 4HCRA 5D96C 3JWOH 2UWEE 3QDAA 1ZGLM 1F8TL 1YC7A 5HVFB 1UZ6F 2BVTA 5IEKB 3B6SA 4QHLA 2DKMA 4WI8A 3V7MA 5CEZL 1I7TB 1IARB 3LPFA 4U1HA 3DUSA 2VDLL 5DXWA 5J1AB 3D5OF 1P7QD 1NBZB 3QAZB 4PV8B 1YEDB 5FCSH 3H9YA 5F7DA 3QQ9D 4IDLA 5ETUA 3I6LE 3IJYA 4IRJD 3BKJL 4JKLA 3HZYB 2BC4B 3RX5A 1ZHBA 2RQ8A 1RHFA 4KJWD 1AD0B 4PJCB 4JY4B 4PJHA 1F4YH 2JJSC 1SJEB 3NCFB 4I0PA 3GSRB 3EYUL 5CZXC 1FVDA 1E6JH 5K93A 3U9PH 3UJTH 4FQIH 3SKOA 2Z93A 1CICC 4S1QH 5DI8A 1KBGL 1RFDL 3RY4A 2OL3L 3ARZA 2W9DL 3IDNB 1SYVB 4KKLD 4NDMB 2P5WD 4LSVL 3W39A 2ADJB 3B2VH 4XB7A 5D4QA 5D5ME 1OF2A 3AU1B 4WEMB 1CG9B 4RFEA 4X7SL 3REVA 1KT2B 1K4DA 4N1EA 2FB4L 4ONOA 4JO4H 2WM0A 3WE6B 4L8DA 2VH5L 1CD1A 3VXRD 3TNNA 1R6VA 2ZOLB 2CK0H 3LRHA 1FO0L 1HN1A 1EMTL 4M61A 4ELMA 5AYQA 5GPRA 1Q0XH 4G3YL 1E4KC 3W2DL 4HFWB 3UTTE 1G7MA 4M9OA 4ZFOL 3QHZH 2ADFL 4YEFA 3VI3F 1LEIB 4JRXA 3V4PL 3C9NA 2B2XL 4X6CB 5IB2A 1JPTH 5JDSB 2NY6B 1BM3H 1HH6A 2NY5L 2DI8A 2WUCH 1BREA 3V4UH 2UZXB 4KY1H 4Y5YC 5DJYA 1DBBH 4XPGH 5ITFA 4LLAA 2WANA 2XZCL 3J8F7 4JFOA 5GRYA 1RMFH 1U3HB 4NZUH 4PBWD 2DTML 1MCDA 3CFBB 3UCRA 1MJ7H 3RUGA 1Z5LB 4L29A 5FM8A 3C08H 1T2JA 4Y4KA 1GIGH 3CCHB 1QFPA 5GZNC 3HNSH 2ADGB 3P3YA 1RZJC 5E8PA 1W0YT 1XZ0B 1CDBA 4P23D 5LVEA 3DVGA 3W9DA 1GGIL 4RDQF 4OZFB 3GM0A 2ILLA 1FIGL 4AH2B 4FG6D 5MERA 3EAKA 2ED8A 2BSED 3QP3A 5I1JL 2DWDB 3IT8D 3ETBF 5IVXE 4JANB 3TFKD 4QXUL 3WFHA 4HJJH 2F5AH 2NY2D 3HI5H 4HUUB 1ZANL 2BOBA 3NZHH 3BD3A 1U8OB 3ILQC 1K2DB 4PRIB 3PWNB 2CIKB 1VB9A 1LGVA 5CBAB 1TZIA 3UJIH 1UACH 1RUQH 5KN5B 1CLOL 3SDAC 2Y5EA 4LSRL 4CADB 4I3RH 4WGVB 4XVTH 4K3HA 3RWEA 1FFNB 1OTSD 4ZUWB 3U6RB 3LEYL 4CGTA 5K9KB 3CFKA 1FAKT 3CZJA 3N06B 2IMMA 2YUXA 3REWA 2NR6D 3ZKSD 1GC1C 4ZUUA 3JTSA 3GO1H 3HMWH 5FUOH 2R39A 1RUML 1Z2KA 4M4RA 1IAOB 4JPVL 1B0RB 4GSDH 1FL3B 1L7IL 2G5RA 1T80A 4QWWD 2XRAL 4QGTA 5L88L 3MSPA 3RAJH 3IFOA 5DURD 1KPUB 2VIRB 3MRGA 4LSTH 1IAKB 3RGVB 3DVIA 3GMQB 5FDYA 2D0HA 3VFVA 1OQXA 1ORQB 1T66C 5FF6B 5BS0D 3FOLB 4LCWA 3KLHC 4ZXBA 1F6AB 3F7RA 4TSCL 3VXMD 1CQYA 1BJ1J 1MFCH 3O8XB 1D9KC 4P9HH 3S3PA 1N8ZB 3K1DA 4K94H 2HRPH 1QP1A 2X09A 4PP1C 4OD2B 1YY8B 3MLYH 4Q6IA 4Y1AB 4BZ1H 4K3EL 5ISZE 4JFEB 3MGOB 4QY8A 1EV2E 3B9VA 1QSED 4WUUB 4AG4H 1EXUB 2BNQB 3D2UB 3RVTC 5JXEA 2NY3D 1MFNA 4EOWH 3EHBD 3UO1H 1UM4H 5LGJB 1QFUH 3PWLA 1FC2D 3LEVH 4KFZC 2DS4A 3PL6C 3SKMB 5EIQA 1J0HA 1WAAA 1GAFH 3MRMB 2FX7H 5DT1H 1F3DJ 3KYAA 4YBLC 4OGAD 4BFGA 2Y9RT 5CEZE 2MCG1 4C56B 3MRBA 3TBTA 3DUHA 3D69A 3QQ3A 5SX4H 5A16A 4MVBD 4PRBA 1QRNE 3DETD 1TTGA 32C2A 4JFYB 5E2VL 1CGSH 4DKAA 1BQSA 1NKOA 4DZBA 4K3DL 4HWBH 3VFSB 1NGYB 3P30L 2B5IB 4OV5A 4KROB 2P8MB 1KLUA 2N7AA 4KI1A 1RZFL 5A2IH 5DJZB 3FCTA 5DSCB 3WS6C 1A4KB 4HIXL 5I19L 1RIVL 3ULVL 3K2UL 5D9SB 4HULB 4PPTA 4F2MA 5F7UA 1FRGH 3KXFE 2EE3A 3QUYC 3I84A 1SMOA 5EO9A 4Z76B 4JR9L 4M6AA 1J12A 1MJ8L 5FA3B 1D5MA 2HYMA 1AJ7H 5MEQB 1UZ6E 1RHHB 3OX8B 2LAGB 1JYXA 5BV7C 3S7GA 1HXMA 3O4LA 3C60A 1CR9L 1CXEA 1I1AC 3KPMA 2YN3A 5FKAA 1TDQA 5IM7B 3I02B 4TPRH 4K8RC 5JW4N 1NCDH 2YS4A 3OB0H 5FB8B 2VDOL 3QDJE 4PJBB 1GRWA 3IETB 4H0HB 1Q1JH 3TN0A 5E2UH 2F54E 5HI4D 1XIWD 2HH0L 1SEBA 1OGAB 1A5FL 5F7YC 1PDKA 1WBXB 3CMGA 3E8UL 1LD9B 4FMFA 3BPNB 1YUHB 3KGRA 2H2SD 4NFCA 4UOW1 4FFWD 4Y19E 5KSAC 4PJ8B 3P9LB 5T3ZH 4K9EL 4HQQL 3IXTA 2YSSA 2WSKA 2P8LB 4S1RL 1XH3B 2VLJE 4MDIA 4OUUB 1X5XA 3U1SL 5KVEH 3BGFB 3GJEB 2D03H 3I50H 3GMRA 3HC3L 4FTVE 4ZPTA 1OAQL 1R5VA 3B8YA 4KI5C 3CD4A 3SKJL 4JO3L 5CSZB 4P2RD 3H9ZA 1FNLA 4OCSH 1C08B 2DQUL 4PGEA 1A3RL 1FLRH 4J3TA 2Y07H 2GK0A 3SCMA 5B4MD 1XGUA 2YD6A 5JOEA 2QEJA 4LLDB 2MHAA 4R7DB 3G5VB 4KVNL 1QQDB 3OHXB 4NQVB 3V6ZA 5HYJE 4MZ3A 3SN6N 2IGFH 3ARBC 4MX7B 4XHJD 2VR4A 3GBMH 3HR5B 1UKSA 1A14H 4X7TB 4NQCB 3PWPD 2H41A 4ODSH 4LK4A 3VI3E 3PIQB 5HGAB 2P1YA 2R1YA 4PTTB 3K4AA 1OSPL 3UZVB 2OSLB 4MQXD 4F7TA 2XWJA 3VRIA 3DYMA 5FV2A 1FCCA 1BQHG 5ESVB 1KTLA 1LDSA 2EEBA 5LGKA 1UB6A 4XWGL 3MXVL 1XR9A 4UV7H 4AY0A 2Z8SA 4QRPD 1KB5H 4XPHL 4TRPL 4Z0XB 5EPMA 3QIBD 4KXZH 3O45B 4FNLL 1OD9A 3RVVD 4PRNB 2DF3A 2D7MA 2ZPKH 3FO2B 4JO1L 3ARDA 3MLZL 2IAMA 4Q2ZA 4QHMA 3WJJA 1NDGA 4E42A 1SJXA 3T77A 2NW2B 1D6EA 5DRZB 3E3QE 1E28A 4OAWB 4UBDC 2A0LD 3NTCH 4AEIL 4MS8C 4LLVA 1A6VH 3TH4T 5I1HL 2A73A 3QPQC 3EO0A 1FL5A 1KFAH 4HS3B 3K8KA 4O2CA 3KPSD 3D0LA 1VKXB 1C8PA 1MRFH 2VDRH 3T1WA 2ADIB 3U7WL 3VXPB 5IW6A 4KJYB 5DC4B 1MCOH 4Q6YA 2BFVL 3BWUC 1TVHA 3MUJA 1DUYA 2R0KL 3DIFA 3WN5B 3FHAA 4MJIB 3CFJA 4LFHG 1NC2A 2Q7NA 3N1FC 1MFAH 3QNXA 1N64L 2FATH 4H88L 5DD6A 2QQLH 3MXWH 1U8HA 3G6JF 4U1GB 2FSEB 1JWSA 2CUMA 2FX8L 3O2VH 1ZE3C 5C09B 2HVKA 1P84J 2BMKB 5E6ID 3DSFH 4M1GH 1HYSD 2NY4B 2FJHB 4EI5D 1ES0A 3O3AA 5DO2D 4WV1C 1AGCB 4MA1C 4U1JB 4OTXL 2J4WL 2DD8H 1CU4L 3LKQA 4HCRL 1FZJA 4HLZG 2VDNL 1IAIH 1UWEH 3N1QC 2JKXA 3FZUD 2YRPA 3DX7B 1CK0H 1FN4B 3R06B 5B39A 4WEBH 1HOCB 1UKQA 2EIZB 5ACMA 3U4EA 2E6PA 4RBPH 3I9GH 3ZE1F 5GGRB 3EJYD 3GI8H 3MREA 5C0AE 3BQUA 1C7TA 3TBSB 1U58B 1I7UB 2OTPA 1IGIL 5I75C 4NHUE 5LJYH 3Q1SL 1HSAA 2PXYC 5HHOD 2XACC 4PJXA 5DTFB 1A3LL 2H6PA 4NQED 4WO4A 1A6AB 3ZKND 4GRWF 3QEQA 4KV5E 4NC1C 5C07B 3TZVB 3SDCC 3L5HA 3OKDA 5J1AA 5KSUB 4J3UA 5CFHA 1S9WB 3K8LA 3EUUA 1RK1B 3MPCA 3EGSB 4HUVB 1Q9WB 4LBEA 3TYGH 2MCPL 1HQ4B 5F44A 4LVHC 5IHZB 1G7HB 4YFLF 1FGNL 3KG5A 2BC4A 4MJ6B 3T0EE 1EEZA 2NXZD 5FYKU 5T3XD 4XCNA 1KCVL 1YEJL 4KDTC 4URTB 1OB1B 3PGFL 4PJ5E 1BIIB 5CGTA 3FT2B 3QXAB 1JK8A 4XNUH 5AZ2L 4EEEA 1QLEH 5ADPL 4PY8I 3RNKA 1MAJA 1WVZA 2X4NA 5D7JD 5E95B 5E5UB 5EZJA 1IGML 2ADJA 4PJDF 3AU1A 3CX2A 3S35H 5EWIL 4HBQA 5HD8D 2FO4B 1R0AH 4AMKL 4P2OC 1LQSR 3X12A 2HKFH 4YXHH 3JWOL 3E2HC 1MHHA 5EU4A 3G5ZA 1N0LA 4WFGD 3WDHA 2WV3A 4AIZA 2AJXH 1ED3B 4G42B 3MMEA 4F58L 4LNRA 1N6QL 3MRCB 3ZKMC 4KPHL 1BX2A 5E2JA 2W65A 3MUGA 5LQBL 2A6JA 2A83B 3IRZA 4OFDA 5JDSA 2BHUA 2AK4B 1BZ9A 2IPUK 3P9WB 1XT5A 1YEFH 2VLRE 2XT1B 4Y4HA 2IPTH 4XXDB 1U8IA 4GXVL 5J6GA 3NZ8A 2YPVL 2CDGA 1WCBB 2B1AL 3QFJB 5EULV 4G59A 3GBNH 1OCWH 3RY6C 1NGWB 3CFBA 2DQGH 1MHCB 3IFLL 1GGCH 4OD1L 5DRXA 4F9PC 3CCHA 1F4YL 4ZAKA 1ZS8A 4D3CH 5J9PA 1TIUA 1E6JL 3D3VD 2AGJH 1C12B 4FQIL 1C5BH 5CUSH 3ZDXF 4S1QL 4X7CC 2HVJB 5CZXD 4OZFA 4AEHH 2V2WB 4J12A 5D70H 5I30H 3PWUB 2AXJA 3P4LA 4YDJB 3B2VL 5D93B 4Y8AA 1H9VA 3T2QA 5D2NE 3FONB 4JB9L 4NFDA 4JFQA 4EDXB 3WEXA 3MLTA 4R26L 1RIUH 4Z7VF 1ADQA 4JO4L 2FGWL 1I9RH 1CFNA 5C0FA 1X5GA 3TBWA 3DV4B 2CK0L 4E9LA 2WINA 1GHFH 4FZ8H 3QDGD 3UTQB 5KS9B 3L3HB 1Q0XL 5E94A 2HFEA 2GSGB 2HAZA 1EIBA 2WQ8A 5DFVC 5HY9B 1O7SA 1WT5C 4DEPB 5CBAA 1WGOA 4LRIA 3QHZL 3IS1X 3OJVC 4H5SB 5CD5C 4RGNB 4PBVC 4IM8A 5I16B 1JPTL 4IRSC 2VWEE 5L8JB 1ZMYA 2CLVB 1XF5A 3WNOA 4PLKD 2OJZH 3U82B 3RKPA 1W2KT 3C5ZC 4JRYD 2R2BB 3V4UL 1T22A 1J8HA 2VC2H 4KY1L 1DBBL 2DDQH 2ZCHL 3IAQA 3CXHK 3HRZB 2UUDK 5IW3A 1RMFL 4ODBD 1IAOA 4NZUL 1FL3A 3B9AA 1ITBB 2C4XA 2D7PA 4TNWK 4W6WB 1AR1C 2H8PB 1GIGL 3BJLA 5BZDB 3HNSL 4IMLA 4W4OC 2VIRA 2W0PA 3ULVC 3LKPB 1PY4A 5GZND 5J06A 1PX3A 1MLCB 1ODAA 1P7QB 5ADOH 4UT9H 1KTDB 2VSCA 4YBHA 1E6OH 3MO1B 4LVNC 1T20A 4P5TC 4OD2A 2F5AL 3GIVA 4IRJB 3HI5L 2EXYC 5HYFA 3MROA 3OKNA 3NZHL 2BHZA 4P99A 2UY7A 4Y1AA 1E4JA 3MGOA 2PTTB 2XN9E 4GXUN 1UQSB 4L3ED 4KAQH 5D7SH 3MV7E 3ILQD 4NUGL 3TGXA 3UJIL 3G6JE 1BD2E 1RUQL 5GSVA 3ZKXC 3FRUA 5B22A 4I3RL 4XVTL 4NHCH 2UVEA 1N2RA 3TNMA 4Z8FH 3SDAD 2P5WB 3SKMA 5I1DB 1WIOA 1TQCC 3DX8B 4YUEH 4XBPB 5JNYB 3TPUE 4JRWA 4C56A 4XTRC 1U8NB 4P3DA 2FBOJ 2OS7A 2C7UA 4H0IA 4OQTH 3GO1L 5FUOL 3GB7A 3VXRB 5L0QB 4E41D 5JO5A 4OJFH 4GSDL 2RBLA 1NGYA 4M00A 1B90A 5D6DA 3RAJL 3JBG7 5ENWB 3GNMH 2P8MA 4NGHH 1I1YB 2IANE 1TPXB 4ZDHB 5DJXB 5IFAH 4MNQE 4FQXC 3JVGA 1DN2A 5F70A 4MDJA 5DJZA 1U3JA 3ZE1E 4IEFB 5C0JB 3HI1B 1T04B 1FBIL 1B6UA 1CLYH 5D9SA 4HLJA 1MUJA 5IBLC 1MFCL 1T66D 2G5BB 5JA9A 2QSCH 3KLHD 2AABH 4RFNC 4K94L 1L6XA 2HRPL 1CDHA 3ISWA 1IJ9A 3AXLB 1D9KD 5FA3A 5GS0H 2MWCA 3L3DA 5L9DH 1K6QH 3MLYL 4BZ1L 1YEIL 4GXUM 1G9MH 4LEOA 5E5MB 5KSBB 4AG4L 4YR6B 3JZ7A 3CH1A 4OZHB 4GRWE 4EI6A 3MNZA 3UJJL 4EOWL 1U93A 3C6LC 4G6AC 1FNFA 3UO1L 1UM4L 5E4EC 3RVTD 1S9XA 4PJ9A 4YIQB 1QFUL 2H45A 2LABA 3I6KA 3TO4A 2W1NA 2Y6SC 3HC4H 15C8L 3LEVL 4LHUA 3QUMB 3MRRB 4HXAL 4JEGB 1FFRA 4I2XA 4KKNA 4FHBD 1GAFL 4RMWA 2FX7L 3NPZB 1WBXA 2EECA 4IIQC 1WTGT 2NY2B 1S7VB 5E9DE 3PUCA 5TH2B 3JV5A 5HHME 4JFDA 2XPGA 2ZUQB 3IDIB 4HWUA 4HWBL 1L0YA 5CINL 2YZ1A 5ITBH 3ZHLA 1NUGA 1FG9C 4HMDA 1AXSA 1OAKH 4YHOH 3RWCB 4MJ4A 2PO6C 5DQ9A 3FTGA 4PY7B 1JFMA 1MCEA 2V7NB 3P4OA 2A6KA 2DI7A 4HUKB 4PJDE 3SGJC 1C08A 4ZMAT 2OZ4A 2W59A 1BECA 1FRGL 4XP6H 1FVEB 4OQTA 3U79A 4NQSB 5DD1H 3WXWH 3QUYD 4F15C 4X6DA 4NQVA 1NANH 1O7VA 3QDME 1AJ7L 3VI4F 4KMTH 3STLB 1JNHB 3HR5A 1V5JA 2Q76B 4X7TA 4Z5RB 3QO1B 2ZUYA 4GMSH 3IFPB 3QJFA 4QRSB 4R96B 5DURB 3PIQA 4X80H 2AVGA 3CX5J 5F7EH 5HGAA 1CLZH 1NCDL 3IU3A 1I1AD 5F8RC 1Y6MR 4OSUH 2VXTH 3LS5L 5E2UL 4K8RD 3WKMH 1TCRB 5I18H 5BS0B 2E8ZA 5HGHA 1JIBA 4M8VA 4RMTA 3DMMD 4UOJA 2DQEL 3L3GA 3VXMB 4LPXA 5AG9A 1NFDA 5C3TA 3WIIL 4EBQL 4POZC 1PZUB 4GFTB 1ZGLB 1HXYB 5AUMA 4D9LL 4DJMA 3O45A 1N4XH 2HG5B 1S7RA 2CO6B 3BIBX 1SYSB 4OB5L 2PYEE 1QSEB 3FO2A 4JZNA 1NCCL 1I8KA 4LLMB 4ONGH 4HKBB 5FYJL 2FJFB 1JVKA 1G7PA 5KSAD 3ZDXE 4DGIH 5KVEL 2NY3B 1ZT1A 3ULUH 2D03L 5DRZA 3U4BH 3OKLA 4U3CA 3HNTL 1XF2B 3ESVF 5F97E 1WQVT 4U1KA 4R97C 1YPZE 3AS3A 4O4YL 4PGZA 4U1SA 5HDBF 4KI5D 4ETYA 1LWRA 4OCSL 3FQTB 4OT1H 5E8OA 2VN7A 1Q9LB 2Y07L 5I1LB 3GGWA 4Z7VE 1UXWB 2ADIA 5F88A 4NO0A 1U8LA 3OF6A 5INCB 1GGBL 3MJ9H 1EPFA 2IGFL 5F89B 5IESH 1JHLL 3GBML 1N7MH 4WENB 1A14L 4YAQB 3ARBD 4ODSL 5EUKB 3P4NB 1DQQB 2X4SA 5DMKA 4XMLL 5F9OH 4CMMA 4DN4H 5ANME 5TDPB 2D2OA 1ZLUH 1JI2A 3L3OB 1QSFD 4WFFE 2OK0H 1HZHH 4HW6A 5C09A 1IRAY 1M05B 1CVSC 3BZDA 3WHXB 3U0PB 2C4FT 1C5CH 4MCZA 1KEMH 4OLYH 2FJHA 3BE1H 1KB5L 3LKOB 4XCCH 1WK0A 1V3JA 1FNSL 4P5KA 4QHKJ 1A1OB 4AM0B 4APQC 2PUQT 3U48A 3LV3B 2ZPKL 4G7YL 3NFPB 4Z7WA 3G6AA 1GZQA 1FN4A 1RIHL 4U3XA 4RAUA 4YGVB 3G9VA 4CMHB 4JFFA 4X8JB 3SO5A 3DVFA 1G7IB 2GJZB 1GGYA 4DN3L 3NTCL 1T1XB 4F37K 5ISZD 3F8UB 2QKIA 1YECL 3IKCA 3WLBB 5EOTA 4UBDD 1CVRA 1KFAL 3JWOC 2HMIC 1XIWB 5C0IB 5E0QA 4MS8D 3QQNA 1SQ2N 4K2UH 2VDRL 3AFLA 4P2QD 2GQHA 3QPQD 2GTWB 4LLUA 4PJFF 4LSQH 3L5WB 5KG9A 3TBSA 1NJ9B 1U58A 1I7UA 5ALCH 2EKSB 2H32B 4PGCA 3UDWA 4B5EA 1MCOL 3LRSB 2YPLE 5D7IF 3OAZH 2HFTA 1KJMB 1T1YB 4YE4H 3MYZA 1IMHC 3MLXH 2AQ3A 1KTKE 2VXSL 5JMRA 5J0BA 5F9DC 3GMLB 1U8KA 4R4BB 2QQLL 1H0DA 5GRWA 3MXWL 3K80A 5D7LB 2HKHH 4WW2F 5IMKB 3NCYP 4KK6C 3WDJA 2DI9A 3CVIL 3TCLA 3V5KB 1OOAA 2JE8A 3O2VL 3D39A 1DQMH 4W70A 5CP3H 2ZUSA 3DSFL 4M1GL 4WU7A 4M7LL 3FT3A 2WNGA 3EJZC 4BFEA 5F7MC 3H7BA 4U33A 2KDGA 1UWXH 2DD8L 2JIXD 4KGJA 4A6YH 1UWEL 5F6HI 1OB1A 3BUYA 3PWPB 1HHJB 2L4OA 3FT2A 4WEBL 5JW5A 2Y25A 1KPVA 3EFFB 4MNGB 4XCYB 1SMAA 4N0FB 4M8QB 5KJRL 3I9GL 4KHXH 5SWSD 1ETZA 2DOCA 5EO0B 3BN9C 3GI8L 3NABL 1T2QH 2FD6L 3GSXA 1S7TA 1QBAA 2XKNA 2BNRE 1S9VB 2FO4A 4L8BB 5IB5B 4QRPB 5JOFB 2DWEB 3T0DA 4PDCE 3KPQA 5DUBB 4F33A 5CSGA 3WS3A 3EYVB 2CK2A 4YO0B 4MB4A 4LF3B 2PXYD 3MRCA 5AWNL 4P59H 4M5ZL 4Z7UF 3SE3A 1K4CA 3D0VB 4RGMB 3AS2A 2EXWC 3K0WA 5DEFB 5EBWA 3OJDA 1EVUA 2AK4A 1WUNT 5GXBB 1MCKA 3ARGB 5GRVK 2VLLA 4Y16A 3KPSB 1XF1A 3TF7A 5MP6L 3TYGL 3MOAH 4KTDH 4FTVD 1IM9D 5C6TH 1CT8A 1VADA 2CUHA 2EDHA 5JPNA 4Q6IC 2XG4A 3QFJA 3U30B 5KOMC 4LLYB 5EU3B 3HAEH 1MHCA 1U8QB 1WWBX 1DVFA 4RMVA 5DGRA 4RZCA 3BKYH 3O0RH 5SWZB 3UMTA 4XNUL 4HS8H 1QLEL 4DGVH 5CBEA 1MJJA 3TYFB 4V2CB 5CP3A 2DQHH 4M9PA 3TBYB 3PWUA 4Y2DA 5D72H 3BD5A 4YDJA 5FYJE 4CU6A 1LO0L 4L4VA 5E6IB 3S35L 1R0AL 5JW3H 2HLAA 4WHCA 2HKFL 4YXHL 5KAQF 5TDNA 2VDML 3VI4E 1SY6A 3QI9A 4NRYB 4P2OD 2F53D 1J18A 2AJXL 1WV7T 3T1FB 5HY9A 1Z9OA 2V7HA 1R5WB 3ZTNL 2PTVA 1OP9A 2X10A 3HE7A 3ZKMD 5F9WC 1GJIA 3BRFA 3EDFA 1U95A 4PJAF 1YEFL 4FQ1L 3CVHH 3GSWB 5BMFH 1BQUA 5I17A 1YMMA 1W0VB 4FP8H 5I8KH 1IQDB 1A6ZB 5FOJA 1NAKL 3GBNL 4U1LB 1OCWL 3NVQA 1T5WA 2YK1H 4AL8H 4B50A 5CJOH 4PRHE 4G9FE 3KDMB 2H8PA 1GGCL 1AO7E 1GL4B 4YHMH 5EZLB 4B7LA 3BKCL 3LKSA 3NA4A 3F65A 4NQEB 1FG2A 2AV1B 3LKPA 3TN0C 2AGJL 2J8UB 3F7YA 1C5BL 4ODVH 1NQBA 3I6GB 5LCVH 1T4KB 5MEND 4UUJB 5D1QC 4LCCA 4K94C 3T09A 4AEHL 5HDBE 1MLCA 4XNXH 4RNRB 2E9BA 2EDJA 3BZ4B 5I30L 3NPSC 4TNVK 2IEPA 3A67H 3MO1A 3X13A 1RIUL 2P5EA 3HAEA 5MEOA 5IQ7H 4N5UA 1GHFL 3A6OA 2NXZB 2PTTA 4XAWH 2HWZH 2AXGB 5BRZB 2ORBL 5GZOC 5T1DL 1LEKB 1J10A 5DFVD 1A02N 4LMQE 5D7JB 4DGYH 1QLFA 3TVMC 1MFDH 5CD5D 4LU5H 3HG1E 5IQ9A 1P1ZB 2GW5A 4D9RD 1PKQA 3G04B 3KPTA 2OJZL 3C5SB 2P44B 4MA7H 5HYSG 4IRSD 3CFEB 4XBPA 1N3NA 5EA0H 4XMKH 3DO3A 2VDPH 4WHDA 2DDQL 3C5ZD 4JPKH 4PJGB 5DF0A 1F97A 3RWHB 5E00A 3PG2A 2F74B 4MD5B 5TPWH 3VE0A 2FR4A 3MV9D 5D96B 4HK3N 4F9LA 4ZOAA 3F12B 5L2KD 2ICWJ 3MLSH 3PWJB 3IDJB 3H3PL 1AR1D 3KWWB 4JHWH 3CAFA 4M1DL 1BMGA 3CVHA 2XIDA 3ULVD 5GIRA 4XHQA 5ADOL 1NCWH 2QR0A 1KIUA 3JV4A 3UTSD 4N0UE 4PJFE 3BEWB 1E6OL 3VXNA 2J5LC 1ZWIB 3AROA 1D5ZB 5HHPB 2YR3A 3VGBA 3ERYA 3KJ6H 2DLIA 3QULA 1KXVC 2AEPH 3GSVA 4P5TD 5SX4I 1BVKA 5E2WH 3VW3L 4OZGA 2EXYD 2R8SL 2W0KA 1IM3B 4G8GA 5JORA 3JUYA 4NYLA 1A3QA 4KAQL 2ZSWB 1OTTC 2F15A 5FGCE 3D3VB 2HJFB 4OZIA 3SPVB 1AI1H 4P23A 2KPNA 4QF1B 4NHCL 2G60H 2X40A 1CE6B 3QUMA 2PR4H 2H26B 2NMSA 1WZ1H 4ETQB 5DEZA 3DTXA 2ESVE 1F3JB 4EJ1C 5TH2A 1N59B 1CFVH 2GT9B 1H3WM 2FL5B 4OJFL 2XICA 3QDGB 5KTEH 3H9SE 1JPSL 3T4AA 5HHQA 5F6IB 4JCLA 2EDOA 3FT4B 4PRAB 4Y5VA 5E6YA 3RWCA 4KTEH 3HZKA 5IFAL 2QV2A 5FCUH 5C0CA 1YZZA 3R8QA 4K7PY 1VSCA 2NCMA 1KELL 4FQXD 1RPQA 3DX9B 5H2BA 2QSCL 2AABL 2AQ2A 2Q1EA 4DKEH 3IDXH 2O61B 5IBLD 3LEXA 5GS0L 2N7BA 1A7NH 1FNEB 5L9DL 1K6QL 3DV6A 1G9ML 3WDIA 2IH1B 2EH8H 3AM8C 2I60H 4QRSA 4R96A 3RWDB 5L7XH 4O2EA 4WW1B 5JHDA 2WBJC 1OP5H 3Q48A 4C55A 5CLTA 5L2JB 2EKJA 5E1AB 3C6LD 3WHE0 3SDXA 5BS0A 4JY5H 4G6AD 4HC1H 3HC4L 3QCUH 3D18A 4JG1L 1G0DA 2GY7B 3L3JB 3QH3B 2HJKB 2Y6SD 1WBZB 3EZ8A 4JPIB 2JK5A 3CUPA 5FA4A 1YMHA 4HGWB 2QQKH 2ATPB 3VFUB 4OLXH 5KVFH 1U6AH 4WO4C 3GJFB 1KGCE 2R1XB 4I0KA 1LE5A 1QSEA 3L7EB 4LLMA 4NQDE 1NGZA 4NN7B 4JZJB 1NSNH 3QEGH 1ZT4B 3V7AE 1OAKL 1JN6A 2BSTA 4YHOL 4HS6A 4WTWA 2P42B 3BGAA 2NW3B 4R2GC 4EQ2A 4PJ7F 2PO6D 3RWGA 4YHPA 4HWZA 5CEYB 3SDAB 1A4JB 4KRMB 5J11C 3SOBH 1Q9LA 5F72S 4BA8A 1OPGH 2E9IA 4KK8C 3MRFB 4X0KB 4DOHE 3WXWL 3V2AR 3GHBH 4FZEL 5INCA 4E41B 4O9HH 3TLRA 4BK5A 4KMTL 4KXZI 2FHFA 4YAQA 1I3GH 3UEZA 4GMSL 4DCQB 4OIIL 5JLZA 1ZA6B 4P5MB 4EXPX 4X80L 1CLZL 3MBXH 5HPMB 1KJ2B 3Q3GA 2DIBA 4PJAE 4R9HA 5BOPA 1JHTA 4JM2F 5I18L 3SO3C 4G8EB 2VKWA 4XX1E 1G6VK 1NGPH 5SX5H 5I76B 5EBMB 2YA1A 5CSBA 5FGSA 3O2DH 3RJQB 2Q7YB 1D9KB 1T1WA 1U91A 1N4XL 4HBCH 4AM0A 4JFXB 4POZD 4TNWF 1DANU 2Y5TB 3DOSA 3NFPA 3FQWB 3G5XB 3WBDA 5DHVB 1GZPB 3ECBA 5KBNC 2VXQH 1IGYA 4X8JA 3MRQB 3OGCB 1UT9A 5IKCB 3U4BL 1FORH 1T1XA 4HC1A 1WFUA 4WW2C 4HWNA 1FFQA 4JQVA 2ICEB 4GKNB 4Y4HC 4YXLH 1S9KC 3EOBA 3QEHB 1KULA 4ZFZA 2IADA 4OT1L 1U8MA 2I25N 4PJIE 5EU5B 3EOAB 3I2CL 4HSQA 1NJ9A 4NJAL 3LRSA 4WWID 1ZLVK 4YBLB 3MJ9L 3DHMA 1I85C 4ZAKC 5IESL 3DVNB 1X5IA 4QRQB 2D3VA 4ZFFB 1JGVH 3H0TA 5HVGB 3GMLA 2A6IA 2GFBB 4LGRB 1NMCC 1IAII 4DN4L 3UPCA 1A22B 3BFOA 3NCJL 3V8OA 5DK2B 1HHHB 3FB5B 2CXGA 2OK0L 1HZHL 4P2RA 4NKIH 3U2SB 2Z31A 2B0SH 3PABA 3PHOA 1WZLA 4HIJA 2EH7H 5F93C 1WWCA 3WNPA 2IAND 1T83C 3BE1L 3FQRA 5FIEA 1IT9H 3ZHKA 2XWTA 3DBXB 4UI2A 5IG7A 4JQIH 4YFEA 1I1RA 5DWUH 2Y36L 4LRIC 1FHGA 1C5DA 4RSVA 1OWRM 1H8SA 2H1PH 4FXGA 4JDZB 3EFFA 2OYPA 1LO3H 4XCYA 1UFUA 1I1AB 2OR8A 1OARH 3CC5A 3MNVB 3IFNL 3L95B 3SE9H 4OCMC 5BW7C 5HGDB 1LE9A 4ZFGH 3VMNA 3KPRE 3DMMB 3O2DA 1BJ1H 2FHBA 4GW5A 4LDOB 4LSQL 5IB5A 5IOPB 2HMID 4NRZA 1FAIH 4WFHE 3QIBA 4YE4L 1BQLH 3MYJB 3MLXL 3OKOA 4JVWA 1WJ3A 2LU4A 5D8JL 2EDWA 4YO0A 3U36B 4TVPH 4U0RC 1AIFA 1PEZA 4HUMB 5LWYH 4Y4KD 1AD9B 1NFKA 1L9MA 4JDTH 3FRPA 4G6KH 5KSAB 5LXGL 4ONHA 2HKHL 2GSIA 2X70A 1P7KB 1A2YA 2VKXA 3ALXA 4Z95H 3IXAA 3H6JA 3X11A 4HIEA 4Y5XC 4KK6D 1DQML 5EORH 3AMKA 1UA6H 4KUZH 4EVNA 3U46A 3BO8B 2DQTL 1P5VA 1U92B 1F3DH 4FQHB 4BQ9A 4PG9B 3GSUB 1U8PA 5HDQH 3RX7A 2Z4QA 4A6YL 4IMKA 3EJZD 4GKZB 3VGEA 3ZL4H 5D6CB 2Q3AA 2F19H 1T0MB 4ZO6A 1ORSB 1A7OH 3VXUD 4I48B 2WIMA 2FIKA 1ACYH 5FYLH 1C16B 3QDMD 1CGXA 3IDMA 1S7UA 3U7YL 2HFFA 1QSFB 5BQ7A 4DW2L 5I1EH 4S1DC 5SWQB 4F7MB 3QEUB 3IF1B 3BN9D 3K81A 4K7PX 4JLRB 4EI5A 5MEPB 5J4MA 4UDTB 5DD0H 2Z92A 3EO1A 3QRFM 3S4SA 4ZS7L 4NRYA 4IDJH 4NNYA 5MI0C 1IKNA 1MFEH 2VMFA 3C8HA 4P59L 2QBWA 2VUYA 1IGTB 3CXDH 5ILTH 1QHPA 4ZSOE 5IVOA 1PD6A 3MACH 5CD3A 4GT7A 2P24A 4WDIA 2DYPA 2EXWD 1X4YA 4GMTL 4LCWD 3Q0HA 3EDKA 1OHQA 4YX2L