4EUPA

The complex between tcr jkf6 and human class i mhc hla-a2 presenting the mart-1(27-35)(a27l) peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
267
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural description of how different MART-1 antigenic peptides influence JKF6 T cell receptor recognition
rcsb
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 76
structure length 267
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4eupA01
2DQEH 3LHPH 2VDRH 4XXDB 4DCQA 1H9VA 1EFXB 4YNYB 2Y5TA 1Y6MR 4X6FB 1A7RL 4WRLA 4XBPA 2GT9B 2FX7L 1HEZA 4GSDH 1CFNB 4YBLC 1MQ8A 5KOVC 4M1GH 1GGBL 1SMAA 2HLAA 4IEFB 1IEAA 5E2TL 5BXFB 4UQ3B 2CRZA 3ROOA 5C9JA 4TSAH 2J5LB 1UH4A 5TE6H 4FQLH 5EU6B 4LCUB 3U4EA 2V9QA 3AAZA 4KQ3H 3VFGL 1FL3A 3NBNA 4HKZA 3S4SA 2ZUQB 2VLJD 2EH7H 2DLGA 3I75A 3GMNA 4GT7A 4F57H 4AY0A 3PG2A 3LOWA 1L6ZA 1YEJH 4OZFG 1UZ6E 2ZNXA 5J6HB 2PTVA 3AU1B 2BNQA 2YD3A 2VDML 5D2NE 3QEQB 4QKXB 5TF1L 5CBEA 1INDL 4LEXH 4WW2C 1IGYB 3S34H 2IG2L 3WUWG 2R29H 1MRCL 3MOAH 1B0GB 1U8IA 3QPXH 1ITBB 5ANMA 4G8EA 4ODBD 4YPJA 4FQXB 2GHWB 2AK4E 3DX9B 4P46C 5T1KB 2VLMD 1HXMA 1T0NB 2B1HL 4DEPB 4RDQG 2NY0D 3F12B 3QJHB 3JWNC 3O2WL 1DQQB 5FM4A 5HD8D 5T1MA 1OARL 5HGAB 4EI6B 3KPQA 5MHSE 4ZS7H 1IGML 1LE9A 3MJ8B 3QDGE 4G8GE 1S7WA 5E8OB 3CFKB 3SQBA 4H8WH 2KQMA 5FCSH 4WUUA 1A7OH 3PWVA 2HFFA 1ZLSL 2VZUA 4JRWA 3CVIL 2YEZA 5DUPH 3O6LL 3QG6A 4N0CC 2IBGA 4KMTL 3QXUA 3DX8A 1A7QL 4QF1A 4RDQF 4JDVA 4HUUA 5DURB 3K1DA 4NO2A 4GMSL 3HNSH 3V6OC 1MI5E 2RBLA 1LP9E 43C9B 2ZCKL 4MAUL 1NC4D 4LSPL 1U8MB 2IGFH 4HJJH 4U1MA 2JJTA 1IQWH 2GTWB 4X8JA 4QHNA 4WHTB 4XVJL 1G0YR 3CFJB 1GHFL 4PJEA 5DMYA 3K1KC 4LLVB 3DV4B 3DUSB 4L3EB 3RPIB 4ZOCA 3QIBC 3LKOB 3QJFB 3CFBA 1JGVH 2VDLL 1IBGL 3DVNB 1AQKL 4H0IA 4OLUH 3QIUD 2QADB 1N8ZA 2QSCH 2XZAH 2EDDA 3FQTB 4Y2OA 4KK9D 5CP3A 2ZKHL 4H88H 5IW1B 1RUAL 3PL6B 4APQB 4XRCB 2CLZA 4HV8B 5SWSA 2R4SH 3B8YA 4JJHA 4OD2B 5IV2A 3MNWB 3R1GL 4MNHA 3RA7L 4UNTA 3W82A 3GJFA 5ITBH 4LBEA 4XBGA 4PJ5D 4DN4H 5KS9A 5BS0B 2YA2A 1G7LA 3FFCA 3UTSB 1X4ZA 4YE4L 4NN6C 1GYAA 3BGMA 5B3NA 5MEOA 4JFFB 4K94L 4FZEH 4LCCA 2A2QT 2YMXH 4JPIB 3I6GB 1JFQL 3E3QA 1KPVA 3VXQA 3KYOB 4AG4H 4MXQD 3G9VA 4POYA 1A6PA 4NSKB 4FG6D 1F45A 4XNZB 3VRIB 2UUDK 3MV9B 4B53A 4BH7B 2Z93A 2Z31D 3DO3A 1NJ9B 5CJXC 4NHCL 1CLZL 3ARFA 1HOCA 3ABZA 5DJ6A 3TN0A 3WMSA 4G8IB 4CMMA 1KSRA 2R69H 5E9DA 2XWTB 1P4IL 4L3CB 1MAML 3H7BB 3RKDD 2VSCA 2RQ8A 3QDJB 4JO4H 4P0DA 3PGCA 2VWEC 4QLRA 1QEWB 5DWUL 3L3HB 4M5YL 2VIRB 2XZQL 4X9GA 4O5LH 5GS0D 1TXKA 1K6QH 1LK2B 1RZKL 5TE7L 3ZKQD 5CCKH 5SWQB 1EGJL 5D1QD 2YXMA 3C9NB 4F7PA 5I19L 2NY3D 5I1LA 2W9DH 4ISVA 3QG7L 5DMJB 5JOPD 4YZFF 2HN7A 1BF8A 2E9BA 2J8HA 1DN0B 4MA3A 1FFOA 4JY5L 4UV7H 1DSFH 3RX5A 3WS3B 4HWZA 1G9ML 1B0RA 1IARB 5BRZD 1I9JH 1XH3A 3WLWD 3QFDB 2YWZA 5HYQA 4EN3C 3SKOB 4X83A 1W0VA 1JBJA 4H25A 4JQIH 1BREA 2Q86B 1D5MA 3DMMB 2P44B 2YPLA 3PP3K 4X7TA 2P5WB 1V7MH 2OK0H 3KJ6H 5F7WC 4XTRC 2F15A 1A1MB 1T21A 3JV0A 1UXWB 3BD4A 3OF6A 4FQCL 3PABB 3ARPA 4WEBL 4LSRH 1ZT7A 3W0WE 5HHMD 1JF1B 4N68A 4P5MB 4XB7A 3GMOA 3SDAA 5IOPA 2F54A 3STZA 5FGCE 5EBMA 5DLMH 4ZUSB 2V2TB 4TOYH 5IBUB 1A0QH 4JZJA 1UM6L 1MSPA 4PJ7E 4P3DA 3HC4L 5J1SC 1J18A 4P2RB 1G6RL 3VWJC 5DMIL 1NPUA 4XP9H 3IXAB 2FHCA 2AI0L 2YRLA 3BVNA 2ZPKH 4YK4B 5IK3A 5LG1A 2AS5M 3VE0A 3DTXA 4UQ2A 4NJ9L 3MREA 3IFNL 2CKBL 4PR5B 3V7AE 3X3FH 1RUPH 2IBZX 1MF2L 4HKXA 3EO9H 1YEGH 5D6CA 5I30H 12E8H 3T0ED 5H2BB 4WCYL 2DI7A 5T3ZL 5IWLC 1NCBL 4OLEA 4RBPK 2IWGA 1S9YA 2Y06H 4MDJA 2VDQH 4MD4A 4W6XB 4DOHE 2NX5D 3D18A 2F8XC 1OGTB 2JJUA 4JPWL 3QQ4B 4OUOA 4AEHH 5FK9A 2P5ED 3MLZH 5CSZB 4WWKD 4JFXB 1XAUA 2GY7B 3U9PL 3FN0H 4DAGL 3V8OA 2M1KA 4TQEH 1RZJC 2Y25A 4G7VL 3L3OB 1FZKA 1O5DT 3O3AB 2QR0A 2H26A 4Y1AD 4KXZH 2BNRD 1DFBH 3FJTA 5E2UH 3DETD 1AP2B 4AIZB 2EDEA 4N5EC 4YWGH 3FAXA 1JJUA 3JTTB 2P8PB 3B9VA 4TTDC 3GSVB 3WV0A 1JIBA 4R3SA 4YDKL 1EUTA 5F6IB 4X6CE 2Q8BH 4WNQB 1OLLA 1L7TH 1RI8A 4L4TE 1K85A 3CIQA 4BFIA 4PJIA 1CU4L 1FVDA 1BD2D 3IDIB 5JW4Q 1MY7A 2P43B 3V4PL 1DBMH 2PTUA 2H2PC 4QRPD 5DRNB 3QWOA 1YZZA 3LEXA 3AC0A 1BZ7A 3ZL4L 5IB1B 1U3HC 5CWSA 1JWUA 3PP3H 1XR9A 2I5YH 1JVKA 1ROWA 4PTUA 4LSVL 1T2QL 5CILL 3RL2A 4HKJB 2AJUH 5FO9A 4OB5H 1UXSA 3TIEA 2VXVH 3WIHH 4JO3H 2VR5A 3E6HA 3BZ4A 1LE5A 4WU7B 2AK1H 1G6RB 5CJBA 3MLUL 3NCFB 1GVIA 3MRBB 1XGPA 2VMFA 1JGUH 5MEPA 1DLFL 3E6FB 2WINA 2VXQH 1XZ0B 3OKLA 4ZTOH 5C0IB 4NZUL 1NAMB 2CKBB 4FQJH 1L7IH 3B5TA 1CZ8L 4XVTH 3BAEL 5DQDL 3W9DA 4F15B 3VXUD 3HUJF 3B5HA 4EXPX 2CQVA 4YPGB 1Z3GL 2E3VA 2HVKA 1B4RA 2XA3A 1W0YT 4JM2C 1MRFH 4NOFA 2AV1B 5KOMC 4Z7NE 1RUQH 1IQDA 4GAJL 4MGXA 1PBYA 5DJZA 2FH8A 4NOBA 1KEGL 2CLRB 1RZJH 1H5BA 1HXYA 3RNQA 1H3UA 1E28A 1WBXB 4PJEE 3FMGH 4TRPL 3H3PL 5I76A 1QNZL 4RBPH 4YR6A 4L8SA 2WBWB 3PV7A 2XFXB 1UZ8A 1X44A 2CDGB 4JFHE 2MMXA 2D7TL 4OLZL 1NGQL 2XZCH 4Y5VC 3UTTE 5I1DA 3TZVC 4GG6B 4HFUL 3F58H 4X99A 2WQ8A 2XTJE 3OAUH 5F6HJ 3S36L 5FAAA 3JTCA 3GB7A 5INDA 2OR7A 1CF8H 2QQKL 3WXWH 2EDKA 1R5IA 3GSQB 3K4DA 7FABH 5D7KE 5HYIA 4D9LL 2Z92A 1TITA 4LVOC 3NABL 3W5NA 2DDQH 3F7YA 3NPSC 3U36A 4HK0B 4GQ9L 5IMOB 4HT1L 1WAAF 2IH3B 4M7JL 5F7EH 1MWAA 2NY4D 3T65A 5CJ5A 3MNVA 2ZUUA 1NGPH 3E8UH 1T04B 2CIKB 4QCIB 1ZHLA 3QNYA 1IJ9A 1FYHB 3VW3L 2X4QA 2JK5A 4RISL 1AGBB 4P2OC 5D8JH 5HHQB 1EX0A 4ZFGH 1F97A 3O2DL 4MD0B 3RL1A 3WJJA 3GRWH 1MCRA 4JGMA 4XCCH 3QIUA 4Y4HB 1Z9LA 4JRYD 4LQFH 2NY7L 4LGRB 2EDHA 2VXSL 4Q0XL 1GC1C 5T5FH 4NQDA 3QULB 3FOMA 1MJ8L 4K3DL 2DMCA 1WQVT 3LN4B 2VH5H 3BZEA 1OM3L 2VL5A 3RVWC 2YK1L 4MA1B 2Q76A 3IFOA 3KYAA 4O9HL 1YNKL 1U9KA 3MJ9H 5ECJE 3HPJB 2OTWA 4HBCH 2OR8A 4PJ5A 5IB3A 4BQ8A 3KDMA 3L7EA 3RX7A 4W6YB 5TQ0L 2A9NH 4RGNB 3BH8B 1WFUA 2WSKA 1HNGA 2EDXA 4B5EA 4IOFD 5KZCD 4OGZA 4JKWA 3NGBB 4K71C 4MXQA 3S7GA 3FQRA 2I26N 3LKPA 1D9KB 2IQ9H 4YJZL 5CD3A 4KKNA 1FGNL 4QRRD 5HXMA 3ZTNH 3I6LD 2Z31A 3GI9L 5I18L 3HG1E 4PJCB 5GHWL 3IKCA 3S37X 4K07A 5KSVA 5DD5H 1DUZA 1K4DB 2LV4A 3GSRA 4WFHE 5B39A 3ARUA 2EYTA 5FYKE 4QXTA 5GJSH 1NBVL 3QIWB 4YGVB 3EDDA 2E7LA 2VABA 1F4YL 1Q1JL 5I1HL 1GZQB 4PRBB 2XICA 5D1QA 1JTTA 2APWA 5IB5A 2OMNA 5HYSB 4NQEB 4D0DA 3FB7A 5DK0B 4LRNH 4DKFH 3QFJB 4PB0H 1CDCA 5C0EA 1UENA 2ZCLL 3BP4B 3HE6B 3I3BA 4XCYA 3V5DB 4U7KA 4CVXA 4YXKL 4NKMB 1X5JA 4ORGB 1G1YA 2J4WL 3HNVL 3PQYA 2GSIB 4U3CA 3B9KC 3CC5B 4OTXL 1NANH 1ZLVH 1GC1H 1FZMB 1F42A 4L5FH 5BRZA 4ELMA 2DLEA 2BX5A 5CGYC 3MRFB 1YEEL 4GKSB 3U7AA 1GGUA 4JN2B 2B1AH 3T77B 1H15B 2CUHA 2DQIH 2L0DA 3DHJA 3V0WH 5JA9A 3FO0H 1WWAX 5F44A 4FFYL 3O4OC 4JZOB 2NY1C 4Q6IA 1VPOL 5JZ7C 5D1ZD 2AQ1A 2H9GB 3LS5L 4WENB 2DLFH 1AQDA 4ZPVA 5F3BB 4HQQH 5HHMA 3GMMA 1CGSH 3K7UA 3P9LB 1HH9B 4LU5L 3TV3L 1Y0LA 2W91A 2CO6B 5EU3B 1FAIL 1YYML 2CGRH 1MCWM 3AB0C 5FA3A 2Y7QA 3LKRB 3WXVL 4HWNA 3REWA 2IPTL 4Y5YB 4OLXL 1ONQA 2ED8A 3DO7B 1B88A 3N1MC 4Z7QF 3ERYA 5HI4D 2C5DC 1JNJA 4WI9A 3LPFA 3MACH 4U0RC 1KXVC 2JELL 3T0EA 4AENB 4DN3H 3LB6C 4GBXB 5C0AB 4P57B 1KTDB 1FLRH 2NR6D 2BY0A 3CX2A 4MCYA 3S8WA 4F2MA 4OCSH 1EDQA 3SCMA 3LKQB 2VISA 3VFTB 3OJDA 1FC1A 5A2IH 1RPQA 4NM8L 3SE3A 3FQWA 2OR9H 2E6PA 4H5SB 4NKIL 4Q2ZA 5DURD 2LTQB 2A6IA 2P5EA 2AXHA 5FGBA 1MHPH 4I3SL 2PXYB 4H1LG 4WWKA 4NP4L 5KVFL 1TJIL 5HGHB 1N5YH 5CAYB 2UY7A 2JCCF 4KI1A 1RU9H 5SX4I 1WWCA 1XCQB 4NCC2 4NC2B 5FF6A 3X11A 4PLKD 3RY6A 1A3RL 4Y1AA 2BNRA 2FYYB 1GGTA 1ES0A 3RWHB 1WUNT 5CKAA 2XRAL 4JANA 1NDMB 3MRHA 2X1QA 1CGVA 2VLJE 3PGFH 4OV6F 3LPWA 4PRPB 2QADD 5DI8B 3BZFB 5E4IA 5C9KA 1FFQA 3O3EA 2A73B 2GAZB 1CIUA 3CU7A 5TJWK 1OGAB 4NNPL 1BD2A 1SJXA 5F72S 4XP6H 1R5VB 3HNTL 1W8NA 1NBZB 2MOVA 4EIZC 3V52H 4QRPA 4M61A 2IH1B 4K55A 2Q7YB 3MBED 4KJWC 2VLME 4OV5A 2OI9B 5DMKA 4YDLB 1KCUH 3S4SG 5BS0D 2YC1A 2VE6A 3QRGH 4DZBB 4XHJD 1R3LA 1SVCP 3OKKB 4PGBB 4WV1C 1YEHH 5E4EB 1EK3A 1FBIL 1K8IA 2V7NB 4UDUB 5DRXA 1J7VR 3DURA 1GOGA 2X7LB 3FAWA 1KPUA 2W92A 5DVMA 4OF0A 2FO1A 4BELD 2XQYK 1CGXA 5H37G 3D2UB 5EA0H 1QRND 5ENWA 3DVGB 3VXUA 4MSWB 2AJZA 3EOTH 4PGDB 4NKQB 3QUZA 2DQJL 3MZGB 4O2EB 2J88H 3ZYJA 3E2HA 1Y6KR 2UYLB 4X5XB 3PP4L 2FGWH 1EAJA 5T33L 1DL7L 2DQFB 3FQNB 4RNRA 3U6RB 1CFTB 2Y1VA 3NMEA 5GPRA 2FX7H 5GGTL 2W60A 1S5IL 3IDXL 4L9LC 1GGBH 1PKQB 1M7IA 1LO0L 2AQ2A 1AD0B 3CMOH 1DP0A 5E2TH 3LD8B 3CFDA 2JE8A 2B2XH 1U93B 3GMLA 1Z9SA 1Q8MA 5DUBA 4OZIB 2DQDL 5I17B 5F9JB 4JO1L 4YO0B 3TCLB 4MB5A 3H3KA 1YEFL 8FABB 4OM1L 2VLRA 3KPMA 4OCRL 3G6JB 4UU9A 3X13A 1RHHB 3VFGH 1X5KA 3DMMD 2VR9A 3IAGC 1KIQB 5IVXA 1XCTB 1KPRB 3MJ7B 4RZCA 3VFNB 5FOBB 3SDXA 3H42L 5EFIB 4PJ5E 1XF5B 1VESA 3OJ2C 4ZSOA 4RSVA 1BOGB 4K9EC 2VDMH 2V5YA 2C4XA 2V5SA 3WHXA 1X6NA 1INDH 1MHHA 2IG2H 4MQ7A 1J0KA 2NXYC 2R0WL 4UIMA 2I9TB 2XTJC 4FN0A 2PN5A 2JJSA 3BX7C 2B1HH 4PRAA 1L6XA 5DZOA 3IAPA 4NBZB 1JUFB 4JRYA 4ENED 3BPLB 1I7ZA 2B5IC 1OD9A 2H1PL 2HLFD 4HFWA 2X41A 4P49A 3VFVB 1OARH 4K94C 2JF1A 1FVEB 3CDCA 4IRJB 5D70H 3U30C 1P4BL 5JPMB 4UOJA 5HHNA 2A77L 1QLEH 1OSZB 1YYLL 4R4FL 4LCCC 1U2HA 3VD3A 3AGVA 1TCMA 2ICWB 1ZLSH 4NUGL 3ARBD 3QI9B 2BOCB 2K1MA 1SJHA 4FFVC 5J12B 2ICES 4M7ZC 4KDTC 3C5JA 1NMCB 4O2CB 1IAKB 5IG7A 5KJRL 5EH1A 1A6UL 1BZ9A 3NIDE 1FIGL 1AGCA 3AUVA 1CDJA 3TT3L 5BZWB 3ARFC 5JOPE 5JNYB 4KQ4H 1A6ZB 4X6EB 2YPVL 1XGRB 5KS9F 4HX1B 1UQSA 1YN6B 2ZCKH 4MAUH 1LVEA 4LSPH 3VJ6B 5FHBL 5FUOH 3CZFB 1J05B 5GGVH 3NFSH 2H6PA 1S7XB 4ONFL 5A2KH 4UOW0 4XVJH 2L7UA 1GHFH 1JPGB 2ITDB 4RMTA 5F6HI 4J8RB 2J12B 1AGFA 3SEPA 3S37H 2OZ4L 4MJ2A 4JG1L 4PRIB 1F8TH 3O41B 4NPYA 5B3JF 2DMKA 4LLMA 1D5ZA 3PNWB 1F13A 2YOCA 4M6OH 4ESKA 3EOBA 4BZ1L 4HS8L 3VFUB 1NC2D 1KTLA 2YD6A 4OLWH 1G9MC 4ODSL 3QEUA 4XZUB 1RUML 3HA0A 2HYMA 4BSJA 4K9EH 2R9HC 2ZKHH 4P2QB 1Q9LA 1HDMB 4OGYH 4JPKH 3VRLE 2IAND 2P8MB 5BO1L 4XXDA 5HHME 1BQSA 1CIDA 3NOIA 2O5XH 4H0GA 2AEQL 1OTTD 4YNYA 5B22A 4YAQB 3CH1B 4QHLB 4X6FA 4LDLB 3R1GH 2GT9A 2FNBA 1CFNA 2AXJA 1FVCB 1HHJB 3FONB 1MIML 1U8JA 3THML 1JPTL 4UQ3A 4Z7WB 1CDUA 1LQVA 1PD6A 2EE3A 1FAKT 2DBLL 1PFCA 5D7IA 5BQ7B 4K94H 4NKDB 2WIIB 5EU6A 4LCUA 3DPBA 1JFQH 4WGWB 3FT4B 4KRPD 5CLWA 3RI5F 2V9RA 2B7DT 2OL3B 4XP5L 4L3AA 1CDHA 2YSSB 1I7RB 3CK0H 4HCRL 4KFZC 1S7TB 2DLIA 1T7WA 3IVKB 4NHCH 5J6HA 5D1XB 1CK0L 3J8F7 4HLJA 4PFEA 2R56H 3AU1A 4G5ZL 4MXVF 1AGDB 1F4WL 3WD5L 3C60B 1MAMH 1YY9C 4ZNCD 3RWFA 2NX5E 1IGYA 1NGWB 2UZXB 1QKZH 4U6VL 1B0GA 5FGRA 2P5EE 3HZYB 5F1IB 5DWUH 1WT5A 4MCZB 3KAAA 3DX9A 4M5YH 1BEYL 3T2QA 2XZQH 1T0NA 4XWOD 1K8DB 2HTLD 1EGJH 1CG9B 5I19H 4FQPA 2EKJA 1J87A 3GO1L 4FQ1H 1DQQA 1KCRH 3QCVH 2QQLH 5HGAA 4KJYA 3Q6GH 4EI6A 2BNRE 3QG7H 1PLGL 3UYOD 5DVOA 3CFKA 3MRIB 4KRNA 1JHKL 3V4VL 3GIZL 3IS0X 5EIVA 2HT4D 5C09B 2CIIB 2FATH 3QH3B 3BD3A 3AS3A 2HT3D 2XKNB 4OGXL 4GRLB 1EZVX 1G9MH 3PJSB 4BYHA 1IAIL 3X14B 5ID0B 5DHVB 4YHYB 5L6YL 1NCUA 2J7LA 1BD2E 5I73C 1LEKB 2HRPL 5EU7E 3S5LB 5DQJB 4QRPE 4Z5RB 4K3JL 43C9A 4HXAH 1U8MA 1T5WA 3QO0A 5FYKH 4K3EH 1EHAA 2C1PA 5HDOA 1P7QD 2YWYA 4WHTA 1FL6B 5JO5B 4GG8B 1A6TA 4FQCH 3A6BH 3L5JA 4WEBH 4JFYB 1JNHB 4AMKL 4OCYL 5JQHC 1T1WA 3QWRD 4QRQB 5GGSB 4J3XA 4LLVA 1AR1C 3DV4A 4YDVA 3DUSA 3RPIA 1QRKA 2BCKB 3IDNB 4KZDL 4G42B 3LKOA 3QJFA 3OB0K 1AY1L 5AWNL 4P9HL 3HC4H 4K8RL 1OAKL 3CZJA 5DMIH 1A14L 3WUZA 3TFKA 3FQTA 2AI0H 2LAAA 2VYRE 4ZTPL 2E7CA 5IW1A 4HJ0D 4APQA 4NJ9H 2FJHB 4XRCA 4JVUA 3IFNH 2A83B 4HV8A 3CVHL 3HTLX 4RFNB 4OD2A 4EVNB 3ZE1F 3WNMA 1IGIL 4WCYH 1CE1L 4I18C 4AIOA 1YPZB 4PJIF 4OZHB 3MUGB 1KCSL 4S1DD 4LSTL 5BS0A 5IW6A 1NCBH 3UTSA 4POUB 3MJ6A 3DX7B 1QP1A 2ZSVB 3IKKA 4JFFA 4RGND 4BFGA 2WIMA 3I6GA 5FCUL 1E4JA 3BDYL 5I1JH 1S8DB 5CD5D 1S9VB 3U46B 1J1XL 3U9PH 1ZGLM 3VRIA 4DAGH 5IIEB 3MV9A 4BH7A 2X4UB 1JYWA 3VFPB 3UJIH 4ONHB 4JN1H 4G8IA 2NY0C 1YJDL 1NFDF 2YZ1A 5FYJD 4L3CA 2EKSB 3T04D 1L8JA 1H5BC 3H7BA 5CZVH 1IC5L 1LHZA 3GKWL 5IVXE 1RFDL 4LP4A 2D4FA 4YDKH 1E4KA 4NN7B 1QEWA 3TBTA 2DQUL 3L3HA 1MY5A 3FB5B 4KV5E 2VIRA 1E4WL 2UV3A 4ZSOE 1LK2A 5SWQA 3C9NA 1KLUB 3DXAD 1CU4H 4LSDA 3O8XD 1I1YB 4NFBA 3ARSA 2CXGA 1M6OB 2Q7NA 1S3KH 3M45A 2VO5A 4JY6B 1KN4H 1DN0A 4V2CB 3VXRD 4NRYA 4BK4A 3D39D 3DROB 1FO0A 1MFAL 3VXNB 4JRYE 1T2QH 1JZ6A 5ELIA 5M94B 1A4JB 1KJ2H 4GS7B 3O45B 1NCCL 3QFDA 3FT3B 5I75B 5E8NB 1DE4B 3O11B 1NLBL 4A2LA 2DM2A 3TA3B 2DOCA 2Q86A 3DMMA 3MLUH 1I3VA 4X6BB 4F58L 1PX4A 5I8KL 1I7UB 3T2NL 4OIIL 1EJOL 4PGZA 3OB0H 1A1MA 3N85L 4NZUH 4U1LB 4MWFB 1HKLL 1UXWA 3HMWL 3RTQD 1CZ8H 3N1PC 3MLRL 2EXWD 4I1NB 3QCTL 5DQDH 3SJVD 4PP8C 2UVEA 3QIUC 1WZ1H 2YD9A 3PABA 1JF1A 1UWXH 4P5MA 2GIYA 4OBRA 4LFHD 2Z8WC 3O0RH 4LGSB 4KK9C 3VRJB 5AG8A 15C8L 2OCFD 1X9QA 1J5OL 3KXFD 4M8QB 5FB8A 5IJKA 1AFVL 4GAJH 3WFEL 1CCZA 3QRFM 4QRRE 5E08H 1KEGH 4DZ8B 3RUGB 4I0CC 3I6LE 1IM9D 1ETZB 1T20B 1UWEL 2O26U 4OFVA 4PGEA 2FRGP 5E8PB 3IXAA 3PHOB 1QNZH 2G2RB 5IGXL 4PR5A 3ARBA 3KPLB 4OLZH 5H2BA 5C0AD 4MXQC 5F9OL 4KROB 1FNEB 3ROLA 4ZFFB 4F8TA 4HFUH 4Z7UA 5JTWA 1H3WM 3S36H 4JKPH 1AI1H 4EI5D 2Z31C 2QQKH 2WV3A 5I1EH 2QSQA 5E95B 1DLHB 5K93A 4FOMA 4KAQL 4D9LH 4JCMA 1OGTA 4KTDH 5B39G 3QQ4A 3L3GB 1JK8B 4GAYB 5JW4N 4KWUA 3RKDC 1SMOA 5CSZA 4GQ9H 1LQSR 2LTQC 4OQTL 2NW2B 1TQCC 3FT2B 1QSVA 3LN5A 3V5HB 1YECL 3L3OA 3MMEB 5D7IE 5CMAB 3PWPE 1WV7T 2OJEB 3O3AA 5F7MC 3T3PE 3QBTB 5D1QC 1UACH 4WO4B 1AP2A 2HH0H 4AIZA 1YC8A 1NBQA 4ZOBA 3S88L 3VW3H 2JB5H 4B7LA 5DK2B 4PJBE 2D9CA 5DHXB 1LD9B 3JTTA 2P8PA 5LWYL 5IBTH 4GRWB 3GUTB 3BMWA 3M8OH 4WNQA 4Z7OF 1IC7L 3QXAB 5JDJA 2VXSH 3R4DA 1IGFL 1YMMB 2FX9H 2VXTH 1MJ8H 2EE2A 4LCYB 2PYEB 5C71A 1HQRB 1OM3H 5KW9L 1OGAD 2VLKB 3IDIA 5EORL 2YK1H 1U6AL 5K59F 4MA8L 5EO1B 1M7XA 4HUXA 4M1CD 5HPMB 3WJLA 3EAKA 4RMSA 3WBDA 5IMMB 3C5SB 3G6AB 1A47A 3KPPB 2IAMB 1N3NB 4Y4FB 5FKAB 1W72L 4G9FB 3QP3A 2QEJA 5TQ0H 4UB0L 4HKJA 3F6IA 2VQUA 2VSDA 3BIBX 1KV3A 3WN5B 4CMHC 1S7QB 4WU7A 4YEEA 2QL1A 3HI1A 1G6RA 4MJIB 3MRBA 1I4FA 5E2WL 2KKQA 2PO6B 1A6VL 1RSFA 3EYVB 1YN7B 3E6FA 5IJVA 5GRVK 2R23A 2FJFB 1XZ0A 32C2B 5C0IA 5I9QB 5I18H 2ZOLB 1NAMA 3H2WA 2DQTH 3TVMB 1O0VA 5I1KH 2DI8A 4ODHL 3GSNA 1UM5L 1NBVH 3RVTC 1KULA 4K7FA 2AV1A 3HB3D 3WFCL 1FN4A 1P69B 5TH2B 3SOBL 5CZXD 4NZDA 1CE6A 1BVLB 2CLRA 3QEHB 1BWWA 5K9QG 5IEKB 4OAWB 5FM8A 1WBXA 4XX1G 1H8NA 3RU8L 2ARJQ 4UTBL 3O9WB 4PTTB 3KPRE 1PEZA 3HAEB 1I9IL 2XFXA 3VI4E 2J4WH 3SDDD 3ZE0F 2CDGA 3PE9A 4OTXH 3NAAL 5FGBC 4WI6A 3ULUD 4QXUL 2HA1A 4CVZB 2H41A 4GG6A 2ATPA 3QSKB 4JKMA 3T4AB 1A2YB 1X3DA 3FN9A 1S9KC 4XP1L 3DETC 4FFYH 3V6BR 1LO3H 1E27B 4LKCB 3VXME 4PJHE 4HK0A 3QNXB 1BVZA 1VPOH 5D2LB 3D25B 5IMOA 1J8KA 2IH3A 3ESUF 5KAQG 3LAFA 3LS5H 4CL7A 4NC1E 1VENA 3N9GH 1T04A 1ZVHA 4G6MH 4XMKL 1HINL 2CIKA 2FBOJ 4QCIA 3TV3H 1W72B 2HJKB 4K7PX 4YDJB 4V1DB 3OPZL 5T1DL 2E8YA 1AGBA 5HHQA 4PJDB 4MD0A 3VXTB 5EU7C 5DEGB 3TBSB 5KG9A 1A7PL 4KHTH 3BN3B 4Y4HA 1BBJB 1SYVA 1WTGT 4E42B 4QRTB 5D5MB 3IDUA 3L3IB 2IPTH 1A1NB 3MGTB 2D0FA 2VZ3A 3QULA 1ITCA 1WBZB 2MHAB 4LHUB 4OLXH 5D72H 5JXED 1QRNE 3LN4A 4BM7A 1ZK9A 1NGZA 4BFEA 3MV7D 5CS7A 5KAQF 3TJHA 3V0AC 2YUZA 3ARED 3HPJA 3U4BL 3HR5A 5DJ2B 3DRQA 2DQCL 4NNYB 5B8CB 1AKJD 1NAKL 4NM8H 3BH8A 5D9SB 1IEHA 3VG0L 1U8LA 1NKOA 3TO4B 4ZUWB 2GUOB 5C08D 2BVUA 1DEEB 2ZJSL 4I3SH 3IDMB 4NP4H 5KVFH 1GZPB 4XPFL 1D9KA 4JFOB 4ZFZB 4GRWE 2R1YB 3L3JB 4M6AA 4JHWL 4XPHH 2O5ZH 4R90L 4DUWA 1T1XB 4PJCA 4MJ6B 4OZ4B 2XN9B 3HI6L 4MHHI 4PRID 3ARXA 1EO7A 3WO3B 2FJGB 3WSQL 1I1FA 4S0TD 4YFLF 1KC5H 3QB7C 3TEUA 4XNUL 3T2PA 3QIWA 4YGVA 4OJFL 5DJCB 1GZQA 3T1FB 4PLNC 1U3YA 3FZUD 3LDBB 3BQUD 4QRSA 5HYSA 2J6EL 5DK0A 1EJ6A 3QFJA 5HPOA 5T1LD 1DVFB 1EFQA 5K9OB 3HNTH 3O6FD 1DUYB 3BP4A 2C4FU 1BFSA 2BNUA 3HE6A 4NKMA 4ORGA 1J8HD 3K8MA 1SJEB 4U1KA 4PS4L 2GSIA 4NNXA 3CC5A 1ZAGA 1XIWD 1T03H 4ODTH 2CSPA 1FZMA 2KDGA 2APFA 3AS1A 3MLWL 1FBIH 2NY4C 4DQOH 3J7HA 3MRFA 4L1HA 4JN2A 5SWZB 3T77A 1H15A 1VEMA 3KYKL 3DVFA 1CYGA 3WHE1 5E7FA 5BV7L 3KHQA 5FA4B 1BQHB 5D1XD 4S1SL 1LO5B 4Q9RH 5HHPB 5HYJD 4Z7UE 1NLDL 1T83A 4TULL 3C60D 3HFMH 2D7QA 3RJDA 1VGEL 5I1CH 3SDXF 4RIRB 3P9LA 4AEIL 1HH9A 3QISA 5D7LB 5D7JB 1QSFD 3PP4H 5EBGA 5EU3A 1RZGB 4IOIB 3CFIC 5I16B 3LKRA 4RQQA 2PNDA 3QCUL 4F7CB 4N0YH 4KJPD 3UZQA 4QY8B 1WTLA 1ZT1A 3P0VL 2X89D 4NC0B 2IPKB 5D7SL 5HDBE 3FOLB 2X44D 4I2XB 4Y5YA 5C0ND 1GXEA 1I1AB 1MQKL 4CUCA 3DO7A 4J3TA 1VFOA 2DWDB 1CFBA 3Q3GB 3VG9C 3IDXH 3FB6A 4R0LC 4GW4B 2LABA 4KUCF 5C07D 5TDNB 4CBPA 3U7YH 3FQXB 1JF6A 2Z9TA 4MNGA 1FYTB 2OJZL 4IOFC 4AENA 1UKSA 4GBXA 2DQDH 5C0AA 4P57A 2NMSA 1DDHA 5E6IB 4JO1H 4FZ8H 1YEFH 2FEDD 4HHAB 1SEBB 4C56D 3LKQA 1HHIB 4OCRH 4OM1H 3VFTA 4G80B 5CP7A 3QNZB 4Q6YA 1GCFA 2IANE 3TH4T 4H5SA 3ARGB 5AZEL 5EO0B 1O7SA 1ZWIB 1OHQA 2PXYA 1T7XA 2QTEA 4J4PD 4TUKL 5HGHA 1SY6L 1SEQH 5DVKA 1ORQB 1KFAL 3MLXL 1BHGA 1XCQA 2CRYA 1UVQA 4TVPD 3HZVB 3KPSD 5M95B 1K5NB 5C7XL 2P1YA 3MLYL 3RWCB 4ETQB 2BRQA 5DD6B 3HR6A 3RWHA 5IFAH 1FNGB 1NDMA 1FZJB 4AT6A 3WE6B 1WK0A 3VD9A 4RA0C 4CJ0A 1ZTXL 3TWCL 5DI8A 1CXLA 2A73A 4DGYH 3H9SD 1P4BH 2GAZA 5DJ8B 2P47B 2A77H 5IQ9B 2J8UB 1OGAA 2SEBB 3FB8B 1CD8A 3T2OA 1R5VA 3VGBA 5GGQH 4G6FB 4R4FH 1QVOB 3SGJC 4NUGH 2F19L 4I48B 4IS6B 5H8DA 2Q7YA 1B9ZA 3NTCL 3SDCB 2OI9A 4HGMA 3U0WL 3PWJA 5A2FA 4DZBA 1EZVY 1A6UH 2DLHA 1OW0C 1IMHC 3OKKA 1FIGH 4PGBA 4N0FB 5DGQA 1X7QA 1KLFA 2V7NA 2YPVH 5D1ZC 3K8LA 3MXWL 4LLWB 1QFUL 5DMGC 1GOHA 2X7LA 5A43C 5CEYA 4HMCA 1DBAH 4ONFH 3TBYB 2B4CL 1P84J 1MCWW 4NQVA 3NZ8B 2BFVL 2HRLA 3MRKB 3UBXA 4V3DB 3D3VB 3D2UA 1JZ7A 1CXEA 1DBJL 5F7YC 4KTYA 2HMID 4M7KL 4MDIA 3RHWF 4LSSL 4MSWA 4PGDA 2RCSL 4U2YA 4NYLA 4BZ1H 4P3CH 1G7MB 3EYSH 5HI4C 4ODSH 1JRHI 1RUMH 3TIDB 4OIAA 2DYPB 4IJ3B 2DQFA 4ZAKB 3FQNA 2Z0BA 2BVTA 4NN7C 2NR6C 1CFTA 2YUWA 1ZEAL 2AEQH 3ZHDA 4LPUA 4QT5B 1JF5A 5J06A 5GS1C 4MJ5B 2AEWA 1PKQA 1MIMH 1KBGL 3SDDA 4BA8A 1AD0A 3G08B 1JPTH 1U93A 3P30L 4F9LA 1IAOB 4IM8A 2DQHL 4OZIA 5I17A 4YO0A 2QJDA 3TCLA 4QTIL 2NZ9D 8FABA 5E2VL 4YHZH 3G6JA 3TLRA 2BC4B 3ULUL 4DKEL 1RHHA 3KPNB 4EZMA 1HHGB 4PG2A 1KIQA 4XP5H 1CI5A 1XCTA 1KPRA 4Z0XA 3LEYL 4M43L 4P9HC 3OHXA 3QAZB 3TJEH 3NCJL 3TNNA 5FOBA 4MXWL 1EPFA 4HCRH 4K8RC 1IGTA 3OG4B 1IC1A 3CCHB 3P73B 4G5ZH 4F3FB 3IDJB 3HHRB 1YMHA 4UNVA 4FFWD 3MRRB 2DKUA 2D03H 3FKUS 4JRXB 5J9PB 4U6VH 2WBJC 2I9TA 4K7PH 5MEND 2GJ6D 2M2DA 1BEYH 3EFFB 1Q0YH 4U1NB 3DNKA 4LSQL 1JUFA 3EZ8A 3GO1H 4ZXBD 1N4XL 1O7VA 3MBEC 3WDHA 4JHBA 3VFVA 5IVZA 2CK0H 1FVEA 5JXEA 4IRJA 5FYJE 1PLGH 3KJ4B 4HS6A 3EIFA 5JPMA 4XHJC 5HTSA 3GK8L 4DKDC 1JHKH 2HTKD 3V4VH 3GIZH 4KMLB 4D0BB 4NC1C 1OSZA 1G0XA 5DFWH 5TE4L 1FP5A 3MODL 3QI9A 2J3SA 1PZUB 1T2XA 3MXVL 3I2CL 1MVUB 2C7UA 1IAIH 1IAKA 4O2CA 1AKJA 1RD6A 2EEAA 3WO4B 1TZHB 4Z77B 4EKXA 1WITA 3RWJA 3DXAE 5HSFA 3ARWA 4X7EC 1OQOA 2HRPH 3JBG7 5JNYA 1A6ZA 4XNYL 4W4OA 4OZGB 4X6EA 1Q38A 4K3JH 1CICD 2CUIA 2ZCHL 4JFPB 3VJ6A 3VXRE 3D39E 4O4YH 3EJZC 3CZFA 1J05A 2C26A 5ALCL 2A6JB 4PY7B 5GGTA 2FL5B 4AMKH 4OCYH 4J8RA 4LPTA 2AV7A 1I1CA 4DVRL 4PRIA 3MRNB 3O41A 4WO4D 5FYLD 1G7HB 4KZDH 1T3FB 3ESVF 3DHMA 2CO7B 3ILQD 4B41A 3M1BB 3OAZK 4R2GD 1R3IH 3QQ9D 4P9HH 5CLTA 1HIML 1T89A 1MJUH 3HRPA 1N2RB 5B21A 3VFUA 3QXTA 4K8RH 5K9QI 4L4VD 1A14H 3ULVF 1MEXL 1Z0NA 4MNQB 4NFCA 3H9HB 4N5UA 4UIKL 5AYUL 1ZGLB 3BQUA 4Z7VB 3SJVE 1HDMA 3MSPA 1NEUA 5CINL 2P8MA 1F6AB 2VLKD 5BJTA 1G9EA 3LS4H 4DTGL 4KKLD 3CVHH 4YAQA 3CH1A 1IGIH 3KXFE 3UJJL 1FVCA 1HHJA 3RP1A 1J8HA 3LHPL 2VDRL 4QXGL 1IGCH 4LSTH 2XWJB 4Z7WA 3SE8L 3WNLA 3L7FB 3X12B 4NWTH 3HCVB 3RWDB 5FCUH 3BDYH 1JFMA 5A40E 2Z8RA 1JWSB 3GJEB 1A5FH 1JHTB 5FECB 2OL3A 1QFWL 1J1XH 3ARDB 5ICZB 1UEYA 5HGDA 1A9BB 4MNGE 1I7RA 1F11B 4FTVB 2GKIA 4LOUD 3IVKA 5IBUG 4R97C 1BFTA 5D1XA 3L95A 1PGRB 4PJ9D 3NN8B 2ADJB 3G5VB 4ENEC 3C60A 2EIDA 1Q9WB 4HIHB 2HLFC 1IC5H 1EHLH 4F57L 1P1ZA 3GKWH 5J13B 4P23D 1RFDH 2Z8VC 1FE8H 5EWIL 3HZYA 5F1IA 4WHDA 3G5ZB 2DQUH 4WI3A 4MCZA 2FLBT 3NFNB 3KLSA 1K8DA 3S34L 3MOAL 1CG9A 3ARBC 3QPXL 1MCFA 1LDSA 2EYSB 2BVQB 5TGBB 1QFOA 3UJTH 4G6AD 1A6WH 1KB9K 2R1WB 2Y6SC 2BSRB 5C07A 1NMBL 2D0HA 5C09A 2CIIA 3HE7B 3QH3A 4FQ2H 4K3HA 2OZ4A 3MRLB 1G7JB 1CLYL 3O4LD 5KSBE 3ZKXB 4GRLA 3ZDZE 4MQSB 4JFDB 1A7OL 3DUUA 1NCCH 3PJSA 4NCDA 4C56A 5I6XB 2NY6C 5C0CD 4YUEH 4GRWH 5DHVA 5ID0A 1NLBH 3KG5A 4TSCH 3EW3B 1H0DB 1LEKA 1GGYA 3S5LA 5I8KH 5DUPL 3GHEH 3T2NH 4Z5RA 2WWMD 2LVEA 4H0HB 4U1HB 1JI2A 2FD6L 2GJJA 2G60L 1BAFH 3QUMB 1QHPA 3B9EA 4XH2B 1DJSA 1I7TA 1HKLH 4ZUUB 3HNSL 3MA7A 3QUXB 1FL6A 3IJSB 4JFYA 3K8KA 2BSSB 4HJJL 4QRQA 5DJYB 5GGSA 4OUUB 4PJAB 3SO3C 2X4RB 1IQWL 1DQJB 3GI8L 4Y16B 3IDNA 1J5OH 2F53D 2HJLB 4Y5XB 3WFEH 1OTTC 4YBHA 1HH6B 1MFNA 5HHVL 1Z5LB 2FBJH 1REIA 1UWEH 4NO5B 5GZOD 1C1EL 1X5XA 3V5KB 5JW4R 3H9SA 4OZFA 2XY2A 4QNPF 5F96L 4ZMAT 5IGXH 1YA5A 2FJHA 2PYFB 2DKSA 5CEZD 4ZOAA 5IKCB 2A83A 5KVEH 2O61A 4KRPC 5FM5M 3WUWA 4RAVB 1I8LA 1RJYB 2EIEA 4P5TB 4E5XB 4UAOC 3P4MB 3MUGA 4AJ0A 2R4SL 3DX7A 2UWEE 4HPYH 2ZSVA 4O51B 4IRSC 4I0PB 4CN6A 1FZOB 4URTB 5ITBL 5ISZB 3TPUE 3FO9B 4KAQH 3OKMB 3W11C 1KXTB 1WFTA 4YDIH 1XR8B 4AQOA 2DICA 3V6FB 1S8DA 4AIXA 1S9VA 3U46A 1QD0A 4FZEL 3IU3B 1HILB 1C8PA 4OQTH 5ETUA 5IIEA 4C4KT 2X4UA 3LRGA 3ULUE 1YECH 1AHWB 3OZ9H 3VFPA 1TENA 2R0KL 4UI2A 4XWOC 1VGKA 2HTLC 4FXGB 4JLRB 2EKSA 3S88H 3UP1A 1KACB 4MAYD 4ZUVB 5LWYH 4K7PY 2N7AA 3ECBB 5I1AB 1M71A 1IC7H 3F7VB 1IGFH 1NSNH 4M8VA 4S11A 2HT3C 3MV8D 1KLUA 1MOEA 5KW9H 1U0QA 4UUJB 1I1YA 2ZG1A 1M6OA 4O5LL 1OAYH 1K6QL 3F7QA 3L6FB 3L9RB 2IJ0C 1FG9C 4JY6A 4YBLB 4OCMC 3DROA 3OKDB 2W9DL 3MFFB 1BBDH 3VXNA 5HI5C 4ETYA 2JJVA 2PW2B 1W72H 3T0AA 1Y18B 3MV01 3B43A 5L2KD 2B39A 3O45A 2ESVD 4BKLB 4ZYKA 5MEQB 5E8NA 2EXYD 1DE4A 2XV6B 1N0LA 3TA3A 1CR9L 2GYSA 3MV7E 5CHNB 4X6BA 4E41B 3JVGC 5J11C 3MX0A 1I7UA 3QQ3A 5E2WH 1KIPB 4PRHB 1X5AA 1A6VH 4RMQA 4GG6F 4X4MA 3CSBA 1ACYH 4WW1B 4HJGB 4LDOB 4U1LA 4PRNB 2NYYD 3MROB 3PWNB 1OAXH 2R8SH 4JJ5B 5IT2L 1F3JB 2OK0L 1VFAA 5DDHB 4CKVX 2DB8A 4WHYH 4ODHH 5E99H 4WW2B 4KC3B 4NN5C 1UM5H 3ALXA 5C08E 2VR4A 2E6JA 5MENA 2GJ6A 3QDMB 1NCAL 4Y8DC 4HJ0C 5D7JD 2X70B 3U2SB 1H8SA 4M8QA 1BMGA 1CFQA 2CR3A 3CXHJ 4P46B 4LSRL 3GSNH 2OBGA 1EBAA 3RUGA 3OKNB 4ZXBA 5CGTA 1RJLB 1ETZA 2K9UA 5DLML 3L3KB 3RU8H 1ZLUH 4TOYL 4S1DC 4OF5A 3TF7A 2CDFB 2G2RA 1DQTA 4YX2H 1MREL 5AUMB 1P5VA 4XP9L 3ET9F 3KPLA 3T0VA 3NAAH 2ZPKL 2ITCB 1EO8L 2EH8H 3D69B 5CD5C 1FNEA 1F4XL 5I8CB 4ZFFA 1XF4A 2LAGB 3MRJB 5FUZL 1WF5A 5FDWB 3X3FL 2MKLC 4XCFL 4F9PC 12E8L 5JHDB 1X5GA 4Z95H 2BSTB 1DLHA 4LCIH 3TO2B 3FO2B 5CJQH 2X9XA 3L3GA 1JK8A 4Z0BL 5C0DB 3I3DA 1J8HE 1WZKA 2VDQL 4W70A 2VN7A 1C5BL 4PJFB 3FT2A 5JPNB 3V5HA 2Q8AL 4XAWH 3MLZL 1I3RB 5CMAA 1F90H 2OJEA 2A0LC 4XMKH 3T09A 5HYSG 3K81A 1MUJB 4WO4A 1P2CB 3WNNA 3HMXL 3QIBB 5T1DH 3EHBD 5DK2A 4PYGA 3O8XC 4M7LL 4HUVB 1EERB 1IAII 4JAMB 3JUZA 1DFBL 4PJXB 5E2UL 1A3LL 3QXAA 4V3EB 2APTA 4L4VA 2R2HB 3C6LD 4NQCB 1YMMA 3CPLB 5FUCE 4YWGL 5HYJE 1RZFH 5JIPA 4N8PA 4LCYA 2EE9A 3KS0J 5GZND 2EO9A 4JB9L 4ZG1A 2VLKA 1L7TL 2OSLB 5EO1A 4M6ML 2N1KA 3K3QA 1QSFE 3T3MF 5BV7C 5I15L 2WY3A 5IMMA 3G6AA 5ACLA 5HHOD 3KPPA 2IAMA 5AZ2L 4DWHA 1FH5L 1N3NA 1ND0B 2LFGA 4Y4FA 1DBML 4G9FA 5FKAA 3PGDB 4NN6B 3B3IB 3RQ3A 1BWMA 4D9RD 3UEZA 2YXFA 5EULV 1RULL 5IMLA 3RTQC 3G6DL 5IHZB 4FXKB 3LH2H 2EXWC 2BVEA 2I5YL 2ZJSH 5ICXB 3VGAC 5C07E 4LFHG 4MJIA 2AJUL 3CNKA 4XPFH 1EXUB 3EZJB 4HIIB 2PO6A 5C0BB 3WIHL 1YN7A 2CPCA 32C2A 4R90H 4R7DB 1JHLH 4YHNB 3H3BC 2ZOLA 4C56E 4PJ9A 1G84A 3TVMA 3RFZC 1QA9A 2VXQL 5HGBB 1HSBB 3WSQH 4N1EA 3KS0H 1EH9A 5FYJH 3DVIA 5HJ3B 4OJFH 4ONGH 2DIAA 4L1DA 4JG0L 1T5XB 2FZ3A 4X4ZA 5TH2A 2D7MA 4N0UE 1BVLA 2I07B 4ZAKD 3ZT5A 2J6EH 1IT9H 5IEKA 4OAWA 3BW9B 4KKAD 1MRFL 4TVPE 4QOKD 4HC1H 3KPSE 4UDTA 1RUQL 1P7HL 3AM8A 3O9WA 4PTTA 4IJ3C 2IQAB 1TJHH 1RZJL 4EI5C 3D9AL 4PS4H 3JTSA 1ZHBB 5C3TA 1OWRM 3O4LA 5ESQB 2YHGA 2H32H 1XT5A 3JWOL 1ZHKB 5T3XD 2WK2A 4CVZA 5C0CA 1QR4A 3V79C 3RGVD 3SKNB 3H9SE 4EN3B 3K46A 1QLFB 4FQQA 4HMDA 2HFTA 2XZCL 3T4AA 1A2YA 3KYKH 5H35B 1YUHB 3GSWB 4ZD3H 1E27A 3OAUL 4LKCA 5BV7H 3EYQD 1I3GL 4C54A 3D25A 4S1SH 7FABL 3DWTA 1NLDH 3HUJA 4TULH 4I0KA 3UAJC 2DDQL 2VKWA 5IFJA 1VGEH 4AEIH 4AEFA 4M00A 3VXSB 3C8HA 5F7EL 2HJKA 4YDJA 4PJGB 4V1DA 1TVHB 5GRJH 2BNQD 3MOBH 2F53A 1MCEA 4PJDA 1NGPL 3QCUH 3TBSA 3E8UL 4EUPH 4K23H 2FGZA 1BBJA 3OXSB 5EO9B 1TCRB 4E42A 1OAZH 3MGTA 1A1NA 3VWJB 1WBZA 2MHAA 2AXGB 1CD9B 4LHUA 5D6DC 4ZFGL 4C55A 1MQKH 4EBQL 3D5OF 3BHBB 5DK3A 2FR4A 1EA9C 3UTQA 2OJZH 3BEVB 2VH5L 5I1IL 5DJ2A 5F7FA 4C59B 5IVOA 1Z0MA 4NNYA 5B8CA 5KBNC 1P9MA 3UBXG 1JV5B 2V7HA 3GMRA 1AO7E 3MJ9L 5LGHL 5D9SA 4PD4K 4HBCL 4UT9L 5EZLA 3TO4A 2EICA 4ZUWA 4JFED 1SJVA 5AZEH 3CSPA 1DEEA 3IDMA 35C8L 4TUKH 4L29B 4DFHA 1GZPA 2A9NL 4JFOA 1ULVA 4ZFZA 4G8FA 2R1YA 4IIQA 1T1XA 3HB3C 1NEZB 3W2DH 3LKSB 4OZ4A 2AP2A 4G43B 2XN9A 2BMKA 3LIZL 3ZTNL 4LVEA 2FJGA 5DJAB 4MAYA 4IDJL 4LCWB 5C0FA 3HKFA 2MWCA 1N5AB 1ADQL 1BIIB 3FFDB 4OFDA 1ZTXH 5DD5L 3V8CA 4IDLA 3O3UN 2EDNA 3TWCH 1ZT4B 2BRRL 5GJSL 2HWZH 4MVBA 1I85C 2VDOH 3ULUC 4NHUE 1DVFA 2X4TA 1H8OA 5K9OA 4XXCC 2ID5A 1DUYA 1VADB 2EYRB 2F19H 2GJ6E 1QPXA 4F80A 3NTCH 3JV4A 4QHUB 3H0TB 1U3HB 1QACA 1TNMA 2F58H 4DKFL 3ELAT 2NXZD 5EUOB 3SBWA 4HH9B 2CDEB 1JE6A 3NIGF 3EBAA 4PLJD 4OI8A 4YZFE 1KG0B 1XGUB 5J89A 4JR9L 3MXWH 1X6LA 3UTZB 1MVFA 3FFCD 4JHAL 5SWZA 3G5XB 1QFUH 2Y9RT 1GC1L 4X4YB 3BJ91 1HQ4A 2BFVH 3VFWB 1YEDA 3C6SB 3G6JF 1BM3L 4LLQB 5DR5H 2R0LH 5FA4A 2B1AL 1BQHA 1LO5A 5AAWA 4YHOL 5HHPA 1DBJH 1L0QA 4JQXC 4M7KH 3WNKA 5EIIB 4LSSH 3IXTB 2RCSH 4WY7H 5D7LA 5D7JA 5E9DD 1OTSD 4JM2B 1RZGA 1OCWL 2XQBL 4IOIA 3AROA 5GS2D 5GIRB 5C0RH 5I16A 2DLFL 1KCKA 1CGSL 4F7CA 4QY8A 2DM3A 3DRTB 3AREC 1PY9A 2A74A 2Y72A 4P59H 2WBKA 3FOLA 4I2XA 9CGTA 4J12A 5EUKB 1I1AA 1LMKA 5FYLE 2WUBL 4N1CA 2DWDA 3Q3GA 5D2NB 4MQXD 1BPVA 4XI5D 4GW4A 5MI0C 5TDNA 1KBGH 2OXGA 1MFBH 1D6EB 3BP6B 1BECA 4I5BB 2X4SB 2DQHH 5EB9A 5AG9A 4Y5VB 4L4VE 5E6IA 4GKNB 2AK4B 3KR3H 4QTIH 4XAKD 4HHAA 3TZVB 1SEBA 3RIAK 1HHIA 1YNTB 5E2VH 2RR3A 3MACL 4G80A 3RX8A 3ULUH 3VDAA 3EKCA 4DN3L 1JYXA 2Q1EA 5EC1B 1EEZB 3S35X 3LEYH 4LVOB 3ARGA 1I8KB 5C6TH 3NCJH 3QDGB 4MXWH 3SN6N 1UCBH 3NPSB 4KKCD 4U1IB 3BP5B 1UGNA 1H3PL 2XXMB 1ORQA 2YPLD 4WFGD 5I66B 4OGAD 4BZ2H 1MHPL 3HZVA 1K5NA 4UINH 3UO1H 4AK1A 1CTNA 2D7PA 2JIXB 4P4RB 1LILA 3BQUC 4ETQA 5FHAL 1UJ3C 4I3RL 2EDOA 5DS8B 3OF6D 3LSOB 5F3HB 4P2OB 3BGFC 3BYTA 1MNUL 1FZJA 1VCAA 3MR9A 3O6FC 2AJSL 3W39B 3GSXA 1MI5B 4P3WA 1LP9B 4RMUA 4LP5A 1N4XH 3SDAD 3C6LA 2F54D 1U95B 4AZ8A 2ARJB 3P4NB 3UYRL 1U58A 1XIWC 3GK8H 5IQ9A 3WL9B 2YA1A 2EDQA 1F3DJ 2J8UA 2SEBA 3FB8A 4WEMB 5A3IC 5TE4H 1QVOA 3MODH 1W2KT 2DN7A 1JYVA 4I48A 4IS6A 5D96C 2C3XA 4P5TD 4E9LA 3SDCA 3MXVH 1FQ9C 5J6GA 3I2CH 4XP6L 2GW5A 4J7RA 3B2VL 4BQ6A 3EO1A 1D6VH 4N0FA 4MA7L 3MRCB 4X98A 4XNYH 2GK0B 5C6PB 5FUCC 1LK3L 2GTZB 5J4MA 2FB4L 4PREA 4LLWA 2ZCHH 4K71B 4OI7A 4KU1A 3EJYC 2CMRL 4PJ8D 4XMLH 4Y2DD 3MUHL 5ALCH 1HNFA 3TBYA 3O4LE 1ZLWH 3VMPA 3NZ8A 3MRKA 3N0PB 5FO8B 5I2IB 3D3VA 1CDBA 3U1SL 5C0CE 4KJPC 4JCLA 4KJQD 1CQKA 4P4KB 5GGUA 1F3DH 1HIMH 1CVRA 1DCLA 2MQ0A 1G7MA 4YHIB 4WJ5B 1BX2B 1MEXH 3TIDA 1BJ8A 2DYPA 4UIKH 4ZAKA 5CINH 3HUJE 1VFUA 2FGWL 4QOKA 1PG7X 3RDTC 1SY6A 4DTGH 2FEDC 4I3GA 3L5IA 3ZYZA 1DZBA 3WLBB 4QT5A 4HPOH 3STBA 4HZLA 3RZCC 3S5LG 2F53E 5IP4A 4QXGH 2HKHH 3G08A 3B9KB 1UT9A 1IAOA 1WZLA 4CN4A 1S7UB 3SE8H 4J4PC 1FORL 3UDWA 2V2XB 4KKBD 3RGVA 5DC4B 3CMOL 4YEFA 4U3XA 3OR7A 2B2XL 2BC4A 1RZ8A 3KPNA 5CEZE 1HHGA 3B5GA 5T3XL 3MLVH 4E41D 1QFWH 3CDFA 5CKGA 1E6OH 3CFEB 2I27N 4UOW1 3O4OB 5EBWA 3SY0B 2Q3AA 3RAJL 2NY1B 3KLHD 3CCHA 1F00I 4HK3J 3P73A 4F3FA 2LVCA 1ED3B 3IDJA 1XGTA 1T4KB 3MRRA 3LQAL 4JRXA 3KVQA 4WTZG 3ISWA 5EWIH 2AKRA 4D94A 2YBRB 1FNLA 2VQ1B 1WAAE 3AB0B 1FIEA 1ZXQA 4U1NA 1GL4B 3GMQB 3L5XL 3MRGB 2HG5B 1NGYB 5F1SA 2BJMH 2NW3B 5CFHA 4YXLL 1QSEE 2FHFA 2RJMA 2A1WH 4PV9B 5CJ8A 3IJYB 4P5KB 1NMBH 4D0BA 3W0WB 3KLAA 1EVTC 3GSUB 3VH8B 1ZSDB 5IROC 4M62L 5D70L 4U0RB 1CLYH 3AY4C 3TYFA 5FGCB 1MVUA 3PXHA 5DYOB 4N0CD 4Z77A 1YQVH 1QLEL 1TZHA 2WWKT 2GJZA 4PJ7B 3MV8E 3P4OB 2A6KA 5I0ZA 1JL8A 2QLVB 4LF3A 2HJFB 2I9LA 4JFEA 4U6HA 4OZGA 3BE1H 1YPZF 4OZHF 2FD6H 2HMIC 4JFPA 1S7SB 2G60H 3MTRA 4EOWL 2N56A 4KQ4L 3DGCR 1KN2L 2A6JA 1MH5B 1R24B 2FL5A 5L2KE 2G9HB 2XWBB 2ESVE 3ZYIA 5FUOL 5E6ZA 2Q6WA 4ZNEA 3MRNA 5GGVL 3NFSL 3GI8H 1G7HA 3MGOB 1T3FA 4TVPH 1JI1A 3M1BA 4DOHB 5JIKA 3S37L 3NCYS 2H8PB 1Q0XL 1KF9B 3VWKD 4J2XA 5HHVH 1F8TL 3BXNB 3F7PC 1C1EH 3NZHL 3R8QA 4A6YH 3H9HA 1FJ1B 2HLAB 1RUKL 1ZGLA 4M5ZH 5F96H 1CT8B 4M6OL 1F6AA 2DJ4A 4OLWL 2NZ9C 5GGRY 2VRAA 1I8IB 4NQDD 2X4PB 4K9EL 4OZFH 2DBJA 1B4JL 2HKFH 4NKOA 5F7HA 5C8JB 4OGYL 1K4CB 4UTAL 4JPKL 3M17B 2D31B 3T0WA 4HGWB 2O5XL 2XWJA 1JNNL 2VZTA 4HKZB 3SE4A 4OCWL 4X6CB 4WV1B 2BY2A 5C0JB 4LL9A 5E24E 4L4TB 1GPOH 1MPAH 3RBGA 3FRPA 5D93C 4JREC 2R2BB 3GJEA 3BWUC 4L8DA 4FFWC 3OR6B 3QUYC 4M3JA 5FECA 3ARDA 4N8VB 5ICZA 4U6YB 4YHKL 5E5MB 4FTVA 4PRDB 4HULB 2R15A 5EOTB 5LVEA 1FC2D 1C16B 2R0KH 3E1F1 2H3NB 4POZD 2ADJA 3G5VA 1V3LA 4ZXBC 1OL0A 1Q9WA 4QRUA 4JM4L 3CK0L 3D6GA 5T1MB 3HC0B 3VDCA 4Q97A 2D7OA 1NH6A 3TF7C 3G5ZA 2R56L 5GRXG 4KY1L 1B3JA 4WUUB 3NFNA 3X17A 4YC2C 1IL1A 1QKZL 2RGSA 5CEXB 4X5WA 1QYGL 2Q20A 1DEDA 1IZKA 2P4AB 4AM0B 2BVQA 3EOYG 3JWDC 3KWWB 5DRWA 1Q94B 5TGBA 4ODXB 1QR1A 1EMTL 2R1WA 2CH8A 2BSRA 4L9LB 4KVNL 1AE6H 4FQ1L 4GLRH 1KCRL 3QCVL 3RUGF 3W5MA 2QQLL 3HE7A 4NO2B 3Q6GL 1LDPL 3MRLA 1G7JA 2JJWA 2IPUG 3VXOB 4HWBA 1CICC 3UBXI 3V2AR 1S5HB 2UZYB 4JFDA 4U1MB 2FATL 3OWEA 3PQYD 4Z7QE 3BO8B 2X4NA 4QHNB 1H0DA 1CR9H 2AJYH 2ARWA 5EZIH 4MS8A 5DT1L 4OBSA 4B50A 4PJEB 4WI4A 4NO3B 4DVBB 5CSGA 3JUYA 3QHZL 4XTRD 3QUMA 1SBBA 5HHOE 4R2GC 3CFBB 1QBLH 3DX6B 3QQ9C 3S97C 4ZUUA 3TM6A 3NFPB 4D9RE 5IT2H 2W9LA 3IJSA 3WNOA 4HXAL 2BSSA 3AS2A 4X6DE 4IMKA 3UTTB 4OUUA 4PJAA 4U49A 3T0XA 5FYKL 5BW7C 2NXYB 3VXSD 4K3EL 1DQJA 4Y16A 1NCAH 2XTJB 2JCCE 3A6BL 2HJLA 5DJ0B 4Y5XA 4X0KB 4KKLC 2F9BT 3DLQR 1N59A 5FDYA 5SWSB 3B83A 5IV2B 2B5IB 4NO5A 2COQA 2DL9A 3BISA 4HIEA 4JDTL 4JHZA 4XBGB 3UPCA 3V5KA 3U30B 1U2CA 1IILE 1C12A 4Y19D 1MJJB 4GRWF 1MREH 2PYFA 3ZKNC 4U7MA 4FMKA 5MEOB 1ZGLP 4LCCB 3BN9C 2RIKA 4LEOB 3MQIA 1KPVB 4P5TA 4S0UC 2GCYA 4E5XA 5SX4H 1DQMH 1EO8H 3SGEI 1IKNA 1U36A 5C6WH 3P4MA 4M7ZB 1F4XH 2AJXL 2AXFB 1AC0A 4X7DC 5FUZH 4XCFH 3C2AL 4O51A 2FEEI 4I0PA 4LOUC 4QOKE 3JWDH 1TQBC 4WFED 3ARFB 3FO9A 4QYOB 3OKMA 4PJ9C 3SCMD 4Z0BH 1XR8A 1S9XB 3V6FA 2IFFL 4M4PA 2XKSA 5B38B 2RAMA 5F21B 2DL2A 4PJ8A 3C5ZD 1HILA 3IU3A 4J3WA 4P23C 4Y2DA 1C5BH 5EG6C 2OQJB 2Q8AH 1AHWA 5I1JL 5T3XE 4TPRL 1TZIA 2X40A 3S9DB 4FXGA 3TNMB 4JLRA 5GXBB 3HMXH 2NY2D 4M7LH 4ZUVA 1X5FA 3UJIL 4JN1L 3ECBA 4G6AC 4OCXH 5I1AA 2AW2A 2XNAA 5FYLH 1A3LH 3F7VA 3JWOC 5CZVL 5C2BL 3DYMA 5FIEA 3N1FC 4JB9H 1PG7H 4HWZB 4F7MB 4UUJA 3QR2A 4NBXB 5DZLA 3HG1B 4M6MH 3L9RA 1P6AB 5HYQB 4G6KL 4LGPB 2BNQE 5I15H 4H25B 1ZA3A 3OKDA 1RY7B 3MFFA 5AZ2H 1FH5H 2PW2A 2WWMC 4LAJH 1S3KL 1Y18A 4KK5D 5ANME 3CSGA 1KN4L 1NFIB 1PKOA 3NIFF 5MEQA 4PBWD 1RULH 3G6DH 1OP5H 3DI3B 4NO0B 3VU2A 1TVBB 1UJTA 3JV6B 5CHNA 1F6LL 5EC2B 4E41A 1ZT7B 2E27L 1KJ2L 1KIPA 4PRHA 1IAIM 3ZZ1A 1AGEB 3WYRA 3GMOB 5ESAB 1OB1A 5I71C 1JZ5A 5IOPB 1HHKB 5TDOB 1NFDA 4WW1A 4HJGA 5GRUH 4WUUE 3SKMA 3QO1A 4EJ1C 3MROA 1IEBB 5AAMA 4JZJB 4Q9CA 1F3JA 4P3DB 5DDHA 5GZOC 4LHUG 4WW2A 4JFEE 4P9ML 5D2LF 3QZWB 5IK3B 3QDMA 2X70A 3U2SA 4CRPA 3BEWA 4JG0H 1WZ1L 3DTXB 4P46A 3QUZD 3O0RL 4IOSD 2M8XA 3OKNA 5LXGH 1CBVL 3OJMB 1RJLA 4KI5F 5D6CB 5I8EB 1FRGL 3L3KA 1KCLA 1QFWI 2XPGB 1SBSH 5SV3A 4PJDF 5E08L 3D9AH 3ZYOA 3IYLW 5AUMA 4MDJB 4LDEB 4MD4B 5D5MF 5E5RB 1II4E 2Y36L 3H6JA 3VGFA 3JWOH 2ITCA 5D2NC 5F1KC 5JOEA 5T5NG 2C4FT 4N0CA 3MRJA 3BPNC 4IIQC 2F5AH 4FQIL 2G5BB 2GK2A 4HZAA 5JHDA 5I73B 5DZNA 3PV6B 4HLZG 5F9AC 3FO2A 3VGGA 3V6OA 3ZHLA 1TDQA 1MRDH 4RFEB 4MX7B 5EPMA 2VLRD 4G8GD 5C0DA 4JKPL 1AI1L 5GS3A 1I3GH 3BPCB 3MLPA 4MAYC 3HRZB 5BVJB 2YD7A 4FXLA 2AEIT 5I1EL 1JNLL 4PJFA 5SWSE 4KTDL 1ZLVK 5JPNA 1VSCA 4X8XA 1I3RA 5JW5A 5KS9E 1MUJA 3RNKB 2R4RH 1P2CA 3FFCE 1CFVL 5T5NF 3QIBA 1WSST 3P4LA 4Y4KC 5DQ9A 1HCVA 4BQ9A 1G7PB 4PJXA 5DVLA 1MWAL 3E3QE 2WZPD 3VWKA 1UACL 5HY9A 2HH0L 2R2HA 2JB5L 1EEYB 4NQCA 3CPLA 1KJ2B 2EC8A 1JWUB 3M07A 4EBQH 5IBTL 4Z8FL 1XR9B 3M8OL 3R0NA 4KUCD 4KPHL 3AMKA 1KJVA 4D2NA 3RVWD 1PAMA 2BSED 2OSLA 2FX9L 3QYCA 2VXTL 1JCKA 5E9DE 3KPOA 4FNLL 4XNXH 5L0QC 5DD3L 5CEZH 5I1IH 4I18B 5JORB 4TYUA 2DIBA 4JVPA 1ND0A 1N64H 2VLJB 3PGDA 2DI9A 3B3IA 4XNMB 1Z9MA 5LGHH 5CIPH 2BK8A 1BQHG 3P3YA 4EIGB 3U0PA 3OKLB 4UT9H 4GXVL 5IHZA 4FXKA 1BQUA 4CADB 35C8H 3STLB 3LPGA 1F6FB 1EIBA 1EXUA 1JRHL 4HIIA 5C0BA 5F7DA 4YFEA 4YHNA 5CJXA 4XAKE 4ZODA 1FSKB 2VITB 2NY0B 1IE5A 1UA6L 4CNIA 4OQ1A 3LIZH 2UVFA 2EDRA 1C08B 4LRIC 3CSYB 3FL7A 5SX5H 1H5BB 3C8KB 4IDJH 5HGBA 1HSBA 2Q87A 3ME0A 1ADQH 2VDNL 5HJ3A 5JIHA 2DQTL 3D48R 4HIJA 3D0VA 1YDPA 5AD0B 4U31A 5I76B 4M4RA 3MBXH 1T5XA 1KLGA 4EXKA 3IS1X 5I1KL 4MXVE 1IZJA 2YPLE 1RMFL 4P4KC 4WFGE 3BSZH 2BRRH 3ALWA 3H9ZA 1QSZA 2CJUL 3BW9A 1VHPA 3QEGL 3RY5A 4X80H 3H9YA 4WI7A 1KB5A 2OTUA 2NTSP 2VZ1A 2KQNA 5GS0L 1ZHBA 4S2SB 3B9KD 1EFXD 5ESQA 2F54E 1KIUA 1NC4B 1ZHKA 1MELA 1VFMA 1FV1B 3SKNA 4BUHA 3Q5TA 1GJIA 4JR9H 5CGYD 3WFDH 1QLFA 1NCDL 4JHAH 3MNVB 3LN9A 3V9FA 1RVFH 4YBQD 4MB4A 1WFOA 3U48A 3EYUL 1YUHA 3GSWA 5EU6D 1L4IA 3QNYB 5BMFH 3PIQB 3EHBC 4LLDB 5E8EB 1BM3H 2F74B 2NY1D 4M93C 4YHOH 5JZ7D 3ULSB 4ZO6A 3RIFK 1LO3L 3QIUB 4GW5B 4GLRI 4ZO9A 3GIVB 3C6LC 1J0IA 4WU5B 3VXSA 4PJGA 3SGDI 1WVZA 5GZNC 1OCWH 2XQBH 4DKAA 2K3TA 3QEQD 3BZEB 1TJGL 2I60L 5E2JA 3TYGH 3N1GC 4LNRA 3N9GL 4G6ML 5IFHL 5GSRA 3IFOB 3OXSA 5EO9A 1TCRA 2ZUYA 1JN6B 3VWJA 1YY8A 4FQXD 4PJ5B 2AXGA 2GFBB 5T1KD 1X4XA 4XC1L 2WUBH 1D3CA 4Y19A 5IM7B 4KHTL 5DO2D 1DBKH 5D72L 3BEVA 2VTFA 3JV5A 1UC6A 2MPAL 3FQRB 2J8UF 4OKDA 2OS7A 3D0LA 5IWLA 5CD3B 1XF2B 1CL7H 1WC7A 2Z31B 5IEHB 5KSAC 1E0OB 1M7DB 3ZE1E 3P0YL 1UYWL 5BOPA 1BJ1J 4NBYB 3GSRB 5HDQH 2MKWA 4PJIE 1R5WB 4XPGH 1EEUA 1T22B 1UG9A 3GGWB 3C5ZA 1H3PH 3OQ3B 1TQCB 1AD9A 1MCQA 5A2LH 4ALAH 1NEZA 1BOYA 2WQRA 4M3KB 4PGCB 3EDKA 3LKSA 3U82B 3ILPA 4G43A 5JIIA 4OFYA 5D1QB 3SDYH 2J2ZA 1KXQE 2VDPL 1NMAH 5FHAH 5ACZB 5HHXH 4I3RH 4KKAC 5DJAA 1CD1A 4XPHL 2O5ZL 4LCWA 1WCBA 2WAHA 1MNUH 1N6UA 1N5AA 2RHEA 1BIIA 2AJSH 3FFDA 3T0BA 5C0EB 5DD1L 1OT2A 4JZNB 4L3ED 1NFDE 4HUWB 2N7BA 1Q9OB 2DQGH 2XIDA 1Q72H 1ZT4A 3QXDB 1KC5L 5JUEL 3UYRH 1ZHNB 2X4OB 4NDMB 1TZGL 3ZTJG 1VADA 3TFKD 3RGVC 5IHBA 2EYRA 2VNCA 4QHUA 1U3HA 4GRMA 5GRYA 3PL6D 4APQD 1H3TA 1FLTX 5EUOA 1BJ1H 1MHEA 1VACB 1YQ2A 3MLSL 4TTGA 3B2VH 3PWUB 3B9AA 4HH9A 2CDEA 2ZOKB 3EYQC 3BP7B 4MA7H 1HI6B 2YRZA 3NH7L 5FFLA 3LQAC 1U8HB 1XGUA 1LK3H 4TNWK 4CMHB 3ZO0A 2FB4H 3UTZA 3BT2H 1TNNA 3UTSD 2IADB 3G5XA 1T03L 4ODTL 4PG9A 3EYFB 3UPRB 5HHMB 4X4YA 2CMRH 4JFFD 4HG4J 2VLLB 3GRWA 4DQOL 1Y0LB 4R4BB 3VFWA 3C6SA 4QO1A 4LLQA 3U1SH 2Y7QB 2C1OA 3R06A 4H26A 3MV9D 1T7ZA 5EIIA 2GY5A 1FCGA 3IXTA 3REWB 5KSBF 1T66D 3ZDZF 3GHBH 4Q9RL 3A6CL 4JM2A 1P53A 3ULVD 3MJ9A 5D71H 3BI9X 4F7EA 3HFML 5GIRA 3EGSA 2B0SL 3DBXB 5I1CL 1PEWA 3DRTA 3QDJD 3ARZA 2HVJB 5JMOC 5F89B 1KJMB 4MCYB 3LMJH 5AEAA 4H1LH 2E7HA 3MA9L 3GBML 4ZO7A 2VISB 4N0YL 4TNVK 4XCNB 5EU4B 1A6AB 1JGDB 1XMWA 1QHOA 3FQWB 1D6EA 2NX5B 3BYYA 4ODVH 1AXTH 3BP6A 4I5BA 2X4SA 2P5EB 5DHYB 4X4XA 3MCKB 2FO4B 1FORH 4GKNA 1RK1A 4WWKB 3X3GH 3CX5J 5K9KA 3TZVA 4FHBD 1A21A 1Z2KA 3QT2A 3U7YL 1R3HB 3RVXC 4CDHA 3ALPA 2EDFA 4QHMB 2Q3ZA 4GXUM 2W0FB 5T3XH 3UZVB 5FF6B 4FZ8L 1EEZA 4HW6A 4NQDE 2BNRB 2JJTC 1I8KA 4IHOB 1ZKAA 3QDGA 4G8GA 5DJXB 4ODUB 1ES0B 3BP5A 1INEL 3RAJH 4R26L 2AVGA 3VA6A 4PLOB 4DK6A 1U8QB 5I66A 4JVWA 4G9DA 2P5WD 3SKUD 4OZGF 1KGCD 3LRSB 4TUOB 3LQAH 2MTPA 1SEQL 2JIXA 4JY4A 4P4RA 1Y6NR 4W6WB 5DS8A 3VCLB 5GSVB 2XA8L 3LSOA 5E0QA 5F3HA 1T1ZB 3BKML 1A9EA 1BD2B 2UWEF 1JTOA 1CTOA 5INCB 3W39A 3L5XH 1MI5A 2E6QA 1LP9A 4QRPB 2ADGB 4M61B 1QZ1A 5EN2B 4S1QL 1U95A 4YXLH 4QGTA 5IFAL 1LEGA 4OV5B 2NXZC 2ARJA 3P4NA 2VE6B 3WL9A 2X42A 4M6NH 4P2RD 1CS6A 3FRPG 5H37H 4HUMB 4M62H 4DGYL 5DRXB 1OAUL 1E6JH 4Z7VF 4MLIA 5EZJA 4LKXB 5GGQL 1DN2A 1KPUB 3ES6B 3E3QC 2E7LE 1RURL 5K59E 1NGXA 2CLVB 4F33B 2NTFB 5DC9B 3ZE2F 2GTZA 2OTPA 1AXIB 4EOWH 3TN0C 3P0GB 1KN2H 3E2HB 2HFGH 1OTSC 5FO8A 3BGAA 3DI2B 4BQCA 5DFVC 3PQYE 4YIQB 1DBAL 4HH8A 5FO7A 5CJOL 4RNRB 1V5JA 5F7NC 4DFIA 5BRZE 4ELME 5L7XH 3HLAA 1Q0XH 4NZTL 3IJHB 4YHIA 4WJ5A 4MQXC 4XI5C 1BX2A 3NZHH 1M7IB 4N9OB 2P24A 1RUKH 2R9HD 2QQNL 3FRUA 5JOFB 4EDWL 1P4LB 2BHZA 4P3CL 3HS0B 3EYSL 5J56B 1FFNA 1E4XH 1B4JH 1X5IA 3WLBA 4RX4A 2W9EH 4YFDB 4UTAH 3UTOA 1EHXA 5TQ2L 5IVXB 1JNNH 3B9KA 1EFXA 5HDLA 5CP3H 1MLCB 4OCWH 2IFGA 3EFDL 4MZ3A 3GBNH 2X1WL 2CK2A 4KKCC 2C3GA 2NNAB 3CFCL 2IBZY 1FPTL 4ZSOB 2NY4B 4Y19E 5BXFA 4LSUH 3OG6B 3CUPB 3ZE0E 3GJFH 1CQYA 2C3VB 3CFEA 8CGTA 4Y89A 4YHKH 3QA3B 4YHZL 1VFBB 2F8VA 3RZWA 1JPFB 4PRAB 2DM7A 1ED3A 1MAJA 1BFVL 4JRYB 3SDAC 1T4KA 3T0EE 3TJEL 4JM4H 4WFEE 2XG4A 4EDXB 3EO0B 4XX1E 2YD8A 4GMTL 4JZJC 2YBRA 3RIAF 1HZHH 2ZSWB 3QEQA 5HHNB 2VQ1A 4KY1H 4U7SA 5F9WC 1WJ3A 2D03L 5T3ZD 4KRLB 3GMQA 3MRGA 5C3LD 4PJAF 4K7PL 4X7SL 1QYGH 2XACC 5GS2H 4J3VA 2NW3A 1SJHB 3V0VB 2E5EA 1VEPA 4FQXA 2VC2H 5T1KA 4ERSL 1Q0YL 4PV9A 1EMTH 3F12A 2AQ3A 3OAYH 3QJHA 4HKBB 3VG9B 4KVNH 1JGEB 4U05A 4P5KA 4R0LB 3W0WA 2CK0L 2V2WB 1CGWA 3HI5L 1LDPH 3GSUA 4Y1AE 1ZSDA 4WGVB 3MJ8A 4KH2A 2W38A 5TFSL 5E8OA 4XPAL 5DYOA 1XF3B 4PJ8C 2Z4QB 4Y2DC 4QRRB 4PJ7A 3P4OA 4I9WD 1XGQB 3BKCL 2HJFA 5DT1H 2YD4A 3FN3A 1RJZB 3QHZH 3ZDYF 1S7SA 4KJQC 5C86A 1AJ7H 1S7RB 1D5ZB 3QPQD 1MIEH 1MH5A 1RZIB 4U1SB 1R24A 2BHYA 2YS4A 3OKOB 2G9HA 2XWBA 3VD7A 1KEMH 3QEUB 4O4YL 4UT7L 2GTWA 1Q9LB 1FGVL 3CFJA 3IDYC 5J1AB 2FHBA 1BZQK 4M03A 2A6DB 3AXLB 4XBEL 1W0WB 1CL7I 2H8PA 2QHRH 5C0GB 4BFBD 4L3EA 3BXNA 4CW1B 5F70A 4JDTH 1FJ1A 1TTUA 1U8JB 1J0YA 3ZDXF 1R3IL 4MMXC 4JFQB 4JDZB 1CT8A 1DANT 3DVNA 4YHPB 1MJUL 4Y4HD 5D7IB 3PWPB 1UWXK 4KKBC 1KYOJ 1I8IA 2X4PA 5C8JA 1K4CA 3PL6A 3IB4A 5DEFB 3M17A 2D31A 1XEDA 3VXUE 4PJBB 2AJXH 4HGWA 1WBYB 3LS4L 3SQOL 4GAGL 1I8MB 3TJHD 4X6CA 3C2AH 3MNWA 3HZKB 1IRAY 4WV1A 4KZEH 5C0JA 5IR1B 3T0DA 5EBLB 4L4TA 1IGCL 3KLHC 5D1ZB 3PDGA 2R2BA 3VFOB 2VERN 2IFFH 2JTDA 3OR6A 3VFSB 3RWFB 4N8VA 4U6YA 4NWTL 1X5YA 4JPIA 3MRQB 4LAQL 5E5MA 4PRDA 2PR4H 3KYOA 3P2TA 5EOTA 3PF2A 4R7NB 4TPRH 1C16A 4GH7B 1A5FL 2H3NA 4NSKA 3F65A 1D9KD 5FYKU 4NGHL 5H94B 3UC0L 3LKNB 3BFOA 4HWEL 4JEGB 1NJ9A 3HC0A 4KJYB 1FSKC 4ZFOL 1U8PB 5IB2B 4XGZB 2XWTA 2VLRE 3WIIL 4YHML 4LPWA 4Q9QL 3K2UL 1EHLL 5HD8C 1QOKA 5C2BH 3QDJA 5CEXA 1FE8L 4WW2F 3JSSA 3ULVL 3QIWD 3SDXE 4AM0A 3KWWA 2RFXB 4L8SC 1Q94A 4M48L 5HGGS 4ODXA 1N7ML 4ODWB 1JMXA 4ACPA 4G6KH 2XY1A 4PY8J 1ZVSB 1WICA 3RVUD 4PV8B 2G5RA 4L9LA 4NQED 2MCG1 5GS1B 4FA8A 2EIBA 3QFJD 3IDGB 1M1SA 2FLRT 4FMFA 3UJTL 1A6WL 3VXOA 3HE6D 5DA4A 1S5HA 1T5WB 3QO0B 3P77B 5DJDB 4FQ2L 3WS3A 1PX3A 2C1PB 3BO8A 3O81A 2ADFH 1KTKE 1A6TB 4NZRL 3L5WB 1RIUH 1T1WB 2E27H 4NO3A 4DVBA 4NUJB 1FO0L 1DBBL 5EOQH 1V05A 3SKOA 4YUEL 2N4IA 3KPRB 4YDVB 4U6TA 2GEEA 4TSCL 4RMVA 3DX6A 1GIGH 2CD0A 4CU6A 3NFPA 1C7SA 3GHEL 2P5WA 3VWKC 3DGGB 3HZMB 5F93C 1G6VK 3FCTB 3K4ZA 1BAFL 3UTTA 5GGVY 1D5XB 5IHLB 2WBJB 3I02B 3CVHB 4P9MH 5BVPL 3WJJC 2XTLA 3GM8A 4PJFF 2I24N 5DJ0A 3OX8B 3OGCB 4X0KA 5TPWH 4J1UB 5FXCH 1WEJH 1CBVH 3MBEB 1FRGH 4IMLB 5F1OB 4ZUSA 3VXMB 2V2TA 4PJHB 5KN5B 3ZHKA 1NFKA 5IW6B 3V4UL 1MJJA 2WWKO 3G04B 4P2RA 4PJXF 2FBJL 4TSBL 1RV6X 4XP4L 4LLAA 3OKYA 4LVHC 2Y36H 4LEOA 1U92B 3WS6A 1LO2H 5C2UB 4DGIL 4ZDHB 5DXWA 4KDTA 1CXFA 4ZFOB 2AXFA 1J1PH 4S1RL 4GXUN 1BIHA 5KVEL 2YKLH 5HYFA 4FQIH 2DWEB 4GBXD 4QYOA 3ORJA 1WISA 2EC9T 4POZC 4FG6C 3MYJB 2AJ3B 2ERJC 1QRNB 1S9XA 4HPYL 5B38A 2KL6A 1NBYB 1JNLH 1EGJA 2OQJA 1N0XL 3TBTB 5DRZB 4YDIL 2PXYD 1QFWM 4JFXA 3TNMA 1GOFA 3PDDA 1CFVH 1IKFH 5E7BA 2E7LC 4N8CH 5ADOL 3OZ9L 1KENH 5GS0C 4ELKB 5EU6E 4KHXH 1MWAH 1WIPA 5EIQA 4PPTA 1MFCH 2NY3C 4LARH 1OWWA 4G6JL 3PWLB 4NRYB 2EZ0D 1FO0B 3GSVA 3MJGX 1NKRA 3QDAA 4KGLA 4Z8FH 4KPHH 4PRPD 4F7MA 1CGUA 1NSNL 2VXUL 4U1GC 3HG1A 5JR1H 1CVSC 3LVEA 4FNLH 5JQ6H 3QEQE 3BPOC 1X4YA 5DD3H 3VFMB 1OSPH 5F8RC 1TPXC 4LLYB 3WLWC 1CXKA 1OAYL 5DRNA 1NFIA 5IB1A 1JGLL 3R0MA 4GXVH 1BBDL 3VDBA 2BY3A 4NO0A 3ZKSD 1TVBA 3JV6A 1MCNA 5EC2A 3WKMH 3SGKA 5IMKB 1BLNB 1JRHH 2LU7A 5SV4A 4Q6IC 1AGEA 5J7CC 5ESAA 4L8BB 4OCLC 1HHKA 5TDOA 4LPXA 5IVNA 4R97B 5FB8B 5B4MD 1MCDA 1IEBA 1TMCB 1UA6H 2W65B 3H7LA 3NA9L 1E4XI 2E9WA 2Y07H 3U79A 2L4OA 1GGCL 1ACYL 1D5IL 2ZP0T 3IFLH 3D2UD 4PGEB 4UT6L 2CKBA 2BP3A 2VDNH 3QZWA 3RVTD 1OAXL 5EOCJ 2R8SL 4G59A 1QLRB 2O93L 1OAQL 4DUVA 1CXIA 5E99L 3DSFH 4QTHB 1NAML 1RMFH 4YPGA 5A2JH 3ARBB 1FNSL 3QHFH 4LHJB 2CJUH 3OSKA 3O3DB 2E8ZA 3QEGH 1A22B 4GJTB 5I8EA 2O5YL 4PJGF 2XPGA 4I4WB 3ROLB 1MCOH 3GSNL 2UUDH 2P8LB 4Z7UB 4P2CG 3T0EC 4QWWD 5GS0H 1AXSB 3SHSA 1KB5H 1MCCA 3SCMC 4OLVL 4L3EE 4RMWA 2FCBA 2FIKB 3PDOB 3G5YB 4YX2L 1OP9A 3SE3C 1LNUB 3C5ZC 2JB6B 5JXAH 4LASL 2NY6B 1SM3L 3RGHA 4PGJA 2YA0A 2X5PA 1NCDH 1NEZG 1F4AA 1FFRA 2G5BA 1RIVL 3LN5B 1RIHH 3PV6A 2EH8L 4WWKC 3EYUH 2P42B 3KHOA 3T4YB 1G7QB 4RFEA 2ICEB 4MX7A 5DF0A 4JKLA 4RAUB 2V5TA 1IGJB 2NY2C 3BPCA 3HRZA 2GI7A 5BVJA 4Z95L 3E0GA 5EOCH 3U7WL 3GSQA 4LCIL 4LVNC 3RY6C 2XKUA 5E70A 2EDTA 5CJQL 5F97E 1NC2B 1N6QL 3SO3B 1QBMH 5BS0E 3MOQA 3RNKA 4FABL 4IBLT 3UTSE 4TN9A 2ZUWA 2W0KA 3LEVL 5MP6L 2IANB 1TJGH 2I60H 4XAWL 4JFFE 1F90L 4PB9L 5DVNA 1V8HA 1G7PA 1ZANL 4LPYA 4OT1H 3WDIA 4HUXB 5IFHH 2R0ZH 4MLSA 4RFOL 1EEYA 1KJ2A 4XC1H 3Q5YA 3C87A 3MV9E 4KK5C 1RZFL 4IRJD 4KRPB 4PIRF 3ULVE 4HWUA 5MERB 3BMVA