4HUVA

Crystal structure of h2db-npm6w
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huvA01
4NQVA 5I2IB 4YXKL 3EYUL 5C09B 1XIWD 2D4DA 2VE6A 3FRUA 1MHCA 3MCLL 3V5DA 5BZDB 5J4MA 3VFMB 1HINH 1FZJA 3GB7A 3PWLA 1OSZA 1AY1L 1RJYB 5E56A 3T0BA 1QA9B 2XTLA 3GGWA 5IB1A 3CUPA 3D25B 4HIEB 1RZGA 2VLKE 35C8L 2MNUA 5C0CB 1XR9B 3T0AA 2E5EA 2VQUA 5E2VH 3CSPA 2FJFA 2EE9A 1FAIH 4WGWB 1NCDL 3C6SA 4U6HB 3CFDB 4G9DB 3QYCA 5E7FA 1SJXA 1WAAE 3DX8A 4FFVC 1DLFL 1HHIB 2F5BL 2DQGL 5D1ZC 5EIIB 2ZOLA 4J4PA 1U8IA 4KJQC 5HI4C 3RZCB 1G6VK 3WS6C 4H8WC 4UQ2B 4F33B 5DUML 3MLYH 1T1ZA 4X6CB 5KSAD 3ELAT 2EDKA 4OZGE 4PJ7E 3SDDC 5J89A 3MLZH 2W9EH 1P6AB 4EN3D 5EZJB 32C2B 5E2UL 5BVPL 2GJZA 2IGFH 1T0NB 3Q2CA 4FFZH 5K93A 5BV7H 5JPNA 3MLSL 4AM0B 5A1AA 2KPNA 4CNIA 1LP9A 1H3WM 4DGIL 1MIMH 2H41A 2NLJA 4B7IA 2V9RA 5I73B 4WO4C 4ERSH 1VERA 43C9B 1EFXD 3QQ3B 4ZUSB 4RFEA 1FFNA 3K3QA 1U92B 4XCFH 1JPTL 3TIDB 4KPHH 1VPOL 2UY7A 3KYKL 5I75C 3MRLA 3MODH 3MV8D 4G6KL 3HAEA 4OAWB 2GJ6B 3C60C 3F65A 1OTUC 1OWWA 4KTEL 3HHRB 4QXUL 3A0OA 1NCWL 4JDTL 1EJOL 1N5AB 3LMJL 4ISVB 5L2KB 3LKSA 2MCPL 5L6YL 5MEPB 2YK1H 2FWOB 4IDJH 4JGUA 3IU3A 5DFVC 1OW0C 2DLFL 2VXVH 1B0RB 3S36X 4FZEH 4IRSD 4K8RL 2W59A 3BPNB 5EO9A 2A6KB 4QOKD 5GSRA 1DQLH 4HSQA 4PG2C 4XHJD 5I1DA 5EG6C 4K3JH 4KUCF 5TF0A 2VLLA 4S0TD 3UTTD 1MRCH 1ZEAH 4H1LG 5D7IF 4OGYL 5E8DL 1MCNA 2R9HC 3Q6FB 5KVMC 5C0AE 1NAML 3PWVA 1LEKA 4XWGH 1KTLA 1NDGA 1MAML 3TZVD 1N0XL 4WFGD 4X4XA 3VXNA 3VFSB 1EHLL 4NPYB 4OCXL 3TVMD 3QG6A 1DBAH 3QEQE 1AXTL 2VLMD 2NR6D 3TBWB 5F9JA 1CXHA 4LGPB 3H9HA 2NYYD 4N0CC 3ILQD 1EEUA 4XGZB 3PHOB 2R23A 3FOLA 4MNHB 3R8QA 3VGBA 1IAIH 2DQDL 1WAAF 3TJHD 3M07A 2CDGB 2Q1EA 1D5MB 3QUXD 5CIPB 4XWOC 1XF5A 2EDXA 2J8OA 2H6PB 3AU1A 4IBLT 4IMKC 4JM2F 2ZPKL 5FO9A 4X6FA 3QDJA 2H26A 3I75A 4ONFH 2WWKT 2YPLD 5CHNA 1JJUA 4AH2B 5IHZA 4HWZB 1BIIB 2VXTH 3EW3B 5GRVL 2A73A 1IGFH 1P2CA 2X4UB 3BT2H 4OZGF 4PJ7F 2XT1B 4WV1A 1R5VA 4FG6C 5D1QA 4QT5B 4EUPB 1DLHB 1SJVA 5I19H 4LIQL 1C16B 3C6LA 3MRDA 3EOAB 1L6ZA 1JNLH 3OAYK 4MLSA 3ZDYF 4NQCB 2IPUG 4IRJD 4HT1L 1D5BB 5FYKU 1S9KC 2MSPA 3JWOC 2MQ0A 4WI5A 4Y5VA 4E42B 5BO1L 4HGWA 3MV9A 1KCSL 3MRGB 3D39B 5AUMB 1BHGA 1CK0H 3DYOA 3MA7B 4JO4H 1Z5LA 3QUMB 3VE0B 5FV2A 1V8HA 2J12B 1FIEA 2Z35A 5EU4B 2JB5H 1A6AA 4ORGA 3C08H 3OAZK 4G80A 4M7ZB 3EFFB 4GRWF 1LWRA 4I2XE 4ZUTA 3O0RH 1WZKA 2C3XA 4DOHE 1P1ZB 3MLVH 1CQYA 2IBZY 5EBLA 4KI5C 5F88B 3BE1H 2YZ8A 1UVQB 2ICES 2OZ4A 3SE8H 3VXRB 5TFSH 4MA8L 2FRGP 4ZQKA 2C1PB 3O2DH 3HPJB 4UT9L 5KVEL 3MNWB 1MCOL 5MP6H 1CFNA 4RGNB 4Y8AA 3I84A 2XWBA 5BVJB 5I66B 3RI5K 1BBDH 4GRMB 4JFFB 1NCUA 4GRWH 5CEZE 4KTDH 2OP4L 2CLZB 3SE4C 1BQHB 5EO0A 3DO7A 3UPCA 5KAQF 4HH8A 3U1SH 1LQVA 2VR9A 3HE7A 3TJEH 4LBEA 4HJJH 3WUWB 2YXFA 4FHBD 4TTDC 5IUSA 3NCBB 5IBTH 4EI5C 4JY6B 3KNBA 1JMXA 3L7FA 2UV3A 3QPQC 4XP6L 2H45A 1HKLL 2JELL 4HMCA 3T2QA 4YH6A 2MPAL 4ELMA 1PG7W 3QWOA 1IAKA 3AS1A 3RVXD 1Z9LA 1YMHA 1AGBB 5FYLE 3V95A 5ALBL 1JYNA 5IOPA 4NWTL 5A2IH 3QEGL 4RMQA 4OLVH 4G8IB 2BCKA 4BELD 1J1PL 3VXSD 1VEMA 5KS9B 5DQ9B 5DLMH 3BGMA 2ZSVB 2QTEA 1NFDE 2F5AH 1A7RL 3OTTA 4X9BA 4PJFB 1H9VA 3KAAA 1N5YH 3WYRA 3WDHA 2R0KL 4R8WH 5E95B 1OAKH 3QNZA 1JRHL 1U91A 5FK9A 3GSRA 2FHFA 1CLOL 4FXKB 2PKDA 4AENA 2R56L 4QHNB 3GMNA 3T04D 4D9QD 3WIHA 2V2TA 8FABA 3E0GA 3H7LA 5I17A 2C26A 1RFDH 4M9OA 1P7QB 4N8CH 4PJDA 1PKQE 4DWHA 2GTWA 2X1OA 1F58H 3C09C 5FA3B 1HHGA 3L3KA 1N7MH 4K71C 5DMKA 1R3IL 1YC8A 3SGKA 5H37G 5DK0B 3BWAA 2WAHA 2FNBA 3DUSB 3MLTA 4R97C 3TIEB 1MEXH 1GGUA 2EYTA 3ZKNC 3ALPA 4LFHG 1UQSB 2A83A 4KKLC 3HI1B 1MUJB 5DJYA 1G7QA 3O41B 1H3VA 2G9HA 4DN3H 3F7YB 3O8XB 2AEPL 4P59H 1YZZA 5I76A 3DVGB 2W9DL 4HIJB 3SDXA 3STLA 4J4PC 4HHAA 1A4KA 3KLHD 3P9LB 4JFEA 5IB2B 1R0AL 5IJVB 3P4NA 5LWYH 1KG0A 3JV0A 1MRDL 1ZVHA 4XNZC 5C0ND 1HEZA 2ZCLL 2LE9A 4XNYL 2FH8A 4POYA 2GQHA 4DKDC 5D1XC 5T1LB 4FXGA 1QFHA 1JI1A 4PRPE 1A3RH 3CSYB 1QHPA 3BKMH 2DWDB 1YJDC 3CFBB 3QXWA 1J0IA 2FX7H 1AKJB 2DF3A 1T3FB 2CRMA 3DPBA 4JFDD 1FG2A 1UJ3B 3VXQB 4JG1L 4OZFA 2OX5A 3BPOB 4YFLI 2NPLX 1BJMA 2BVOA 2DI7A 4F9PA 2CJUL 4RZCB 1K5NA 1WLHA 4G42A 2OCFD 1YEEH 3QHFL 2QR0B 1L7IL 4CMMB 5ICZA 2E8YA 4FTVB 4LOUD 2EO9A 5F6HJ 5HYQB 4Q0XL 4XP4L 4OF6A 1MI5D 1YY9C 2YRLA 5ISZE 4RISH 4ZFOB 4HV8B 5KSUB 4KK9D 2N56A 4HXBL 1E0OB 2LVEA 4X83A 4Y16B 1T0PB 2M8XA 1A6PA 4YK4C 1WBYA 1H3PH 4Z7UB 1FRGL 1OF2B 4G3YL 4OCRL 1G6RB 1J7VR 1MF2L 4FS0A 3RWJB 5D93C 5DGQA 3WIIH 3ROOB 5J13C 3IDXL 5CBAA 1B4JL 1MREL 3NGBC 4X6EA 1FNGA 1DBML 3IU4H 3CH1A 4XTRC 4PJAB 1IM9D 5IESL 2QL1A 1NDMB 1ACZA 2R0ZH 4M6MH 3OPZL 3KHOA 4Q6IC 3EO0A 3NFPB 3VGHA 5IG7B 2QSCH 5IW6A 1XGQB 3BWUC 4WCYH 4KZDH 1YDPA 3C2AL 5EU6E 2IANA 5K9QG 5TE4H 5BQ7B 3KPSE 4U0RC 1U8OB 4AG4L 3TPUE 3PDOA 3NIDE 4LCCC 2XN9A 4OGZA 3E6HB 3QB7C 4MZ3A 1ZHBB 5BMFH 2B4CH 5BXFB 1RIUL 5AZ2H 2OS7A 3RX7A 2IH1A 2R2CA 2O5YL 3W5MA 1OP5K 1M7DA 2DTSA 5D72L 4XCCL 4G59A 4LASH 2LV4A 1OGAE 4HWEL 2PYFA 4OFDA 5GS1A 3UZVB 1D6VH 2P42B 5DJAB 2JIXB 5DVKA 2XA8L 3BP4A 3GZKA 2ARJB 1NSNL 4Y2DD 5D1QC 1N26A 1TJGH 3KYNB 4F3FB 5I1AB 1CFTB 2APTA 5J1AA 4RWYH 1P84J 1GPOL 4EDWH 3C6LC 5KW9H 2W07A 1R5WB 4TVPL 5FGCE 1U58B 5ID0B 3KPMA 3OR7B 4PJ5A 5BJTA 4R4FL 1AGFB 3NH7H 3OB8A 5I9QC 3CC5A 1FIGH 4Y5VC 1M7XA 5DEFA 1INDH 1VFBB 4P57B 4XAWL 3CX2A 4G6AD 4Z0XB 4HC1H 1RIHL 4G6ML 3U6RA 3C9NB 3L3HB 5DJ8A 1FAKT 3L5XL 3DRTB 4L1HA 2FD6L 1UWGH 2HKHH 5ACZB 1U93B 3O81A 2DWEA 1I1AB 3V4UL 1BGXL 1BVKA 4I0PD 3QAZC 2DBLL 1XF2B 3DROA 2CKBB 2BJML 1CR9H 3I85A 4HKJA 4F8QA 5LGHH 1U8PA 2OXGA 4U1LA 3WE6B 4MQ7A 5DJ6A 4K7FB 4N1CA 4QWWD 5DS8A 2X1PA 4JQVA 5JW5A 3JUZA 5JW3L 4YHIA 1FNAA 1BD2A 5EFIA 5FAAA 3LV3B 2W60B 1DUZA 1EEZB 1UXWA 1W72B 3O2VH 4XPFH 4E0RA 4I77H 3LEVL 2HLAB 4Z7VE 3B8SA 4MJ4A 4YBLB 3WFCL 5B39B 4B50A 1SM3H 4YWGH 1HCFX 2P46B 1SMOA 4QTHA 5T1DL 3CVHB 1ADQL 1ZT4A 3CK0L 1KTDB 5IMKB 5DD5L 1C8PA 1QLRB 3H9YA 3QUZB 5IFJB 3HG1E 2DDQL 3VMNA 1LNUB 3D85B 4L9LB 4MQXC 5DRWA 5IV2B 1QBLH 5HGAB 1KJVB 3PHQB 3HE7C 2APBA 3EJYC 4LF3A 4ORZC 5C9KA 3NIDF 4HLJA 3Q3GB 4JZOA 5KTEH 1F6FB 1NUFA 4YHMH 4WW2B 3ARDD 3UXFA 5DT1L 4YHYC 1YA5A 3U9UA 1JYWA 2JJWA 5TE7L 2NY5L 2OJZL 4Y1AA 1XGTA 3QIWD 2ZSWA 3QUML 4EKXA 1KENH 1YNKL 5BRZB 4L8SA 5ANMB 2ADGB 5I30H 2FJHB 4P23A 1FNHA 1YPZA 5GGSB 3QDHA 3WNPA 3EYOB 1T03L 2YUZA 1ZHLA 3O3BB 1BAFL 3MLXH 3S88H 2OL3H 2GK0A 1IC1A 4JLRB 3GMRB 3FONA 1YEGH 4JFXA 2YEZB 1VACA 4NZRL 5DHXB 3VW3L 1RUQL 3EOBA 1L0QA 1NLBL 4FQHB 4FQCL 1C5BL 4L4TB 3W9EA 1IGYB 3TT1H 1EZVY 4OZIB 1YQ2A 1CLCA 1FLTX 2CMRL 2X4SB 3FO0H 3JTSA 4QYOB 4RFOH 4XBEL 5TDNA 3WLBB 1FVDA 1E4XH 3D3VE 2EDJA 4G9FE 3MJ9A 1P6FA 4P48A 4QHKJ 5JXAH 4UQ3A 1ETZA 1TQCB 1S5HA 3AVEA 2LU4A 1OQXA 5FM8A 3GSQB 3FFDB 1ED3A 2CXKA 1S7UA 1FJ1B 3WKML 2IPKB 1N64H 2WINB 4R7NA 2OK0H 3ZTJG 4Y4KA 4IOSD 3SGKC 5HDBE 2YUWA 1VKXB 2D9CA 1AR1C 4U3XA 3LZFL 4MNGB 4PGDA 1F4HA 3TYFB 4NUGH 5JHDA 1ACYL 4NBXB 3WIFA 2MQ3A 4PR5B 1D5XA 3S34L 3GUTB 1CLYL 3O4LD 3IAPA 4H88H 5DR5L 1E6OL 1KJMA 5SWZE 2EIBA 1QEWA 4UIKL 1IGIL 4XNUH 5E6IC 4Z7VF 2VZUA 3X13A 3S3PA 4Y5XA 3G5ZB 4EN3A 5J56B 2EXWD 4Y4HA 1KNOB 3F7RA 5HHMA 1CGTA 4RMRA 3CSGA 5C2BH 5E8NA 1V7NH 2EC9U 4NQED 1HQRB 5B38A 2YKLH 2GCYA 1A6UL 5H94A 3VWKB 2FBOJ 3AROA 4UU9A 5D6DC 5C0IA 3RKPA 1RIVL 2H1PL 1J8HD 1PG7H 3KJ6H 1M71A 5C0JB 2AI0H 1E28B 5JIIA 1D9KC 1JWSA 3RGVD 2WM0A 2NY1C 4C57C 3BVNB 1BQLH 2BDNL 3MXWH 4KV5F 4X98B 1A9EB 1BMGA 4TSBH 3MUGA 3GEWB 1QG3A 4QRPD 4NN7B 3BOVA 3PJSB 4H5SA 4M4PA 4DZ8B 4HUMB 4WU7A 3REWA 2ED7A 2HT2D 4NJ9H 1UYWH 3W39A 4TSCH 4MS8D 4YUEL 4Z0BL 4W70A 4R3SB 2BRRH 5TE6L 1WJ3A 1UCTA 4U1GB 2R2BB 1PYWB 4HFWB 2R8SH 5E1AB 4KMLB 1QYGL 3QA3B 3U9PH 1N0LA 3I50H 3CLFH 2BNUB 4M43L 1H15A 3V8OA 1DBKH 5ID1B 1A5FL 4BFBD 3WDIA 2I60L 2V7HA 3WL9B 3DIFA 4LAQH 3UTTA 3HZKA 1P69B 5EZOH 2NW2B 5JNYB 3QEUA 4MAYD 1JPGB 4WFGE 4YDLB 4KU1A 3PWNB 1MCFA 4KI1A 1RJYA 1S7VA 1OSPL 2O61B 1D9KD 4UNVA 3B5HA 1U8KB 2VLME 4HIEA 3KPRB 3H3PH 1V3MA 5EZIH 1XR9A 1FYTE 2HH0L 4PRHD 3TV3H 4HF5L 1DCLA 4KVCH 1GC1L 4OTXH 2Q7YA 4JDZB 2H9GA 3CFDA 3RUGF 1WSST 4XNXL 3H42H 4K2UH 5HDBF 3MBEB 4NZTH 4EJ1C 3MFGB 1HHIA 3UDWC 3DX7A 5CEXB 3MRBB 1FVCA 3QUXA 1WZ1L 1BQSA 3EFDL 4HUWB 4LARL 5J12B 2X4OB 3T0XA 1QLEH 1T7WA 3PHSA 4AMKH 3ARBC 4MNQD 3BZEB 2UUDH 4KAQL 2QSVA 2YPLA 5DO2D 1LK2B 5KSBE 4HKXA 2Z93B 1LHZA 5E9DB 2YC1B 3D2UB 2AJSL 4KTYA 4X80L 2F54D 1CE1L 4K94H 3SCMD 3V4VL 3VMOA 4ZFOL 3RDTD 5I8EA 2VLKB 3QFJB 2YUXA 2EH7H 5JIHA 5GGVL 2I5YL 43C9A 1B6UA 4K3HA 1T1XA 5KANI 3HRZB 1G6RL 4K8RD 3TIDA 4AT6A 2Y4SA 2NXZD 3DSFL 4QXGL 3WN5B 2PR4L 4JQIL 1YEHL 4EDXB 3VFVA 3D9AL 3RNQA 1S7TA 1N5AA 3L5HA 2JJSA 3C8KB 5HVFB 4OZHA 4DKEH 2C5DC 2HJKB 5E2WH 4P2RE 1KB5B 4CN1A 4L9DA 1BOGA 4QY8A 4HLZH 2I07A 3DURB 1L9NA 5ETUB 2V5YA 3LQAL 3OKKB 4JO2H 1E27A 4P5TA 2CSPA 2A6KA 5TDPB 1HZHH 1BVLB 5DMJB 5CZVL 3GI9L 4YAQB 3EKCA 4TSAL 1OAUH 1NGXA 4G6JL 3T2NL 4L3EB 2R1WA 1QVOB 1ZWIA 4P2QE 1NANH 1ZLWK 4OCSH 2DQTH 4BUHA 3MGOA 4NZUL 5CILL 4LLAA 4PJEA 1MHHA 4LSUH 3Q6FA 4D8PB 3BP7A 3GBLA 3VI4F 2BHYA 5AAWA 4JRXB 4XPTL 4BK4A 3SQBA 3VFSA 5I71C 2P5WE 4X6BA 2I9TA 4AQOA 2F74A 4NYLB 4HJ0D 2XWJB 1FN4B 2R2HA 3TBWA 1MQKH 4M62L 1FL3B 1J1XH 4TOYH 3ZYJA 5IMLB 2PF6A 2R1YB 3RHWK 4M7JH 1YQVH 5IBLC 4XGZA 2GKIA 4EI6B 4MNHA 3LRHA 3UYRH 4FQXD 5FOJA 4KI5E 1OARL 2CDGA 3R06A 1MJ7H 1QSVA 4FP8H 5M95B 3OKNA 3PL6A 4K7PL 2J4WH 4OLXL 2X70B 2PN5A 3UPRB 3TEUA 1U2HA 1Y0LA 3BIBX 5D7LE 4M61A 4JJ5A 1OLZA 4L4VD 4KH2A 1ADQA 5FUOL 4R2GD 3W81A 5DMGC 2YSSA 2VDPL 4WDIA 2G2RB 1F97A 5C7XL 4L8SC 4EUPA 1DLHA 1SY6H 3DV6B 5EWIL 4P23C 1NC4B 1JWUB 2R69L 4PRIB 4XI5C 2QEJA 3NCMA 4HBCH 3NZ8B 4P3DA 1I8MB 2NX5B 3EOAA 4XB8A 4GRLB 5DUPL 2NY3B 1A0QL 3MC0A 2WY3A 2DD8L 2Q86A 2CKBL 4PRAA 1PKOA 4XC1H 5DGRA 2EH8H 1AQDB 2ICWA 4P3CL 5F7UA 4AEIH 1RHFA 5KSVA 3A67L 1O5DT 5DFWH 5AUMA 3X3FL 5C07E 2DAVA 1MCPH 4KMTH 3T3ME 1W72L 2BNQB 4R90H 1UZ8B 4P4RA 4RNRB 5EU4A 3WLWD 2DLIA 5JPMB 3DGCR 3B4NA 4K9EC 3ZSTA 2K9UA 4CU7A 1UG9A 3GI8H 1Z3GH 3EFFA 4FQPA 3WHXB 3C8HA 3CVHL 3HUJF 4U1SA 3O6FD 1RHHB 1P1ZA 4Y4KC 5FKPA 5F88A 2I9LA 1QFOA 3B9KB 5E70A 4U1NB 2B0SH 5FO8B 1JZ3A 1MVUB 2DQHH 4NRZB 4ZD3H 2VLRE 1BECA 3Q5TA 2BVEA 3UP1A 5K9KB 1JFQL 3JWNC 3MNWA 4JN1H 3IDGB 3CX5K 4N1HB 3VRJB 1JK8B 3KYOB 2YRZA 1KN2L 3K8KA 4GRMA 2AQ1A 4YHLL 4NHUB 4BH7A 1GCFA 1G0DA 2FSEA 2CQVA 4PLJC 2EYSB 1A6WH 4NOBA 4LU5H 3MRHA 2FIRT 3ZKXC 3IFOB 3T77A 4Y4HC 5AEAA 3HC3L 2OR9L 4KWUA 2YZ1A 4PY7B 1GOGA 3KXFB 4RMTA 3RAJL 3WFZA 3LD8B 43CAA 4JY6A 1CCZA 2PYEB 5GRUH 2X6MA 5EUKB 3UX9B 1NGZB 1JF1B 1GGCH 2HFEB 4ODVH 4KI5F 5EBMB 5HD8D 3JWOH 4Y88A 5JO5B 3VFRB 2DQUL 2J6EL 1NCAL 1F6AB 2R1XA 1S5IL 2P8PB 3VXUD 3HA0A 4HK3J 5BS0D 2AK4B 1MI5A 4V1DB 4MJIB 5I1GH 4R0LB 1NGWA 3BDXA 1SYVB 2CDEA 4YPJA 1JWMB 4WJ5B 4JE4B 5KJRL 1Z2KA 3IRZA 3V0WH 3EDFA 4LSPH 4PP1D 1JHTA 1JVKA 3GO1L 4F15C 2DQEL 3VI3E 4EBQH 1LP9E 3ARED 1TETH 3W82A 4AY0A 2D31A 2XNAB 1IBGL 1A6ZB 3DXAB 4X7SL 4YDKH 4IM8A 2NXYB 4X4ZA 3DECA 5IMOB 1F45A 1KOAA 4P0DA 1RZFL 3MNZA 5FHAH 2XV6B 4EEEA 3IDUA 3GHEL 4Z77A 7FABH 1R24B 3P4OA 1IM9A 4OD1H 3UTSA 1A6TB 2QBWA 5ADOL 4NC2B 2UZIL 3KPNA 4HS6A 1WZMA 2FZ3B 3QXDA 3KYAA 2C3HA 3PV6B 5CCKH 3TIEA 3IYLW 1NFDB 3HI1A 5FYJU 1MUJA 3ZE1F 4MQTB 3VCLB 3HMXH 3RRQA 4ONGH 1K4CB 4N90E 3F7YA 5E00A 3O8XA 3SPVB 4A6YH 4I5BB 4YR6B 4C83A 1LDSA 3MYJB 3G04B 5GXBB 4G7YH 2HVKB 3RZCC 4P49A 1QPPA 5IJVA 5I1JH 4Q2ZA 3VA2C 4E41D 5C09D 5F9OH 1S7SA 5GZOD 3X11B 2YD9A 4UUJA 5IFHL 3TPKA 5T1LA 4PV9A 1F8TL 5AD0B 3P11H 4HFUH 2DLEA 3FRPG 1MCKA 3CSYA 3S4SB 3L6FB 5F7WC 2NY2C 3R0NA 1ZVSA 1FNEB 1NFIB 4TYUA 3QI9B 3CFBA 4XP5H 2ATKB 3K1KC 1AKJA 5HPOA 3NFNA 1DQML 4DQOH 5C0CD 4XCEA 5I73C 2GSIA 1JZ4A 4LCWA 3LSOA 2BNRE 3RWCA 5L8JB 1BPVA 3RL2A 1W0VB 1LO3H 1WFTA 3KLDA 4QTIL 1G1YA 3I6GB 1QSZA 5KZCD 1TMCA 2XY2A 1TXKA 2XWTB 4JM4H 4JHAH 5J6HB 2CIKB 4ODTL 4HUNB 2FX8L 1G7PB 4ZFOA 1X5JA 2GI7A 4MX7B 4Z95L 2V7NB 2Z8SA 2JJSC 3OKLB 1I8KA 5LBSL 5D7SL 1ZLSH 3F7PC 5F71A 1IFHL 2ZOKA 3JSSA 4PG9B 5C86A 4P5TC 1RJLA 4OBRA 3ROOA 4L8BB 3VI3F 2UY6A 1LP9F 4PJHA 3FT3B 3JWDC 4HK3N 4ZS7L 3K2MC 1NCBL 3BISA 4C4KO 1JZ8A 1I9IL 4YJZL 3OAUH 2BSSA 5DTFB 5HDQL 3MV9E 3VG9C 1NDMA 3BDYH 4LEXH 3WD5H 4HH9A 3X12B 4XVSH 3VDBA 3SDCB 2JCCA 3NFPA 2EC9T 5L8LB 5GSVA 1A7PL 5INCB 1RK0A 1UZ6E 3P30L 4JAMB 4GG6E 5IG7A 1XGQA 4R26H 2GJ6D 3F12B 3IFPB 3W5NA 4OCLC 1BEYH 1OD7A 2J3SA 4Z6AT 4OM0H 4U2YA 1G9MH 5L8KB 3E6HA 3GSNA 2EIDA 3ARWA 1ORQB 2EXYD 1J86A 4GQ9H 4C56A 1EO8H 1YJDH 1YYLH 1N3NA 2XXMB 1PD6A 5AZEL 2C3VA 3HAEG 2R0LL 5A40E 3SO5A 4NNYA 3MR9B 4H20L 1XCQB 4GAJH 3OKMB 1PZ5B 2CUHA 3TO4B 2AEQH 1IGJB 2FEDC 1E4WL 3PL6C 5I18L 2M26A 3NIFF 2FECI 1HDMA 4XBGB 2ZKHL 3VD4A 5CBEA 1D6EB 4CU6A 4DVBA 5C08B 5I1LB 3HAEH 1CD1B 3C5ZB 5MHSD 2ERJC 1EUUA 3MA9L 2Q6WA 4NHCL 3T65A 4F3FA 5I1AA 2DIBA 3HNVH 1KB5L 3KJ4C 4F37K 1UWXK 2X4RB 5HVHC 3ME0A 3GK8H 4XPHL 5H8DA 5EU6B 3TCLB 4NKIH 3KPSB 1AC6A 1FGVH 1QACA 2RBLA 3OR7A 3U0WL 5E6YA 1U8NB 2O26U 5E8PB 1T22A 2CO7B 5ENWB 1JNHB 1RMFH 2ARJQ 5T3ZD 1GRWA 3OKEB 3LEYH 4Z0XA 4HX1A 2D7NA 3QULA 1DVFB 4M8QB 1CGSL 2NY5C 4JKPH 4ZXBB 5E08H 1R3LB 2YPKB 3ARQA 4KRPB 2I26N 4YHPB 3ULVL 5CJOH 2XG5A 4ELME 3WNMA 1QFPA 3DRTA 3RKDD 4OQTL 5EUOB 2VR5A 3N9GH 1LO2H 1B3JA 1GL4B 1XF2A 4M7ZC 3OJVC 1VENA 3VU2A 3ERYA 5DD3H 1ODAA 2AJYH 3WE6A 5DVOA 5F7MC 3QEHA 1Q9KB 3WFEH 3DETD 5CZKA 1MFBL 3VFWA 2VDNH 3QO0A 4KJYA 4YZFE 2YWZA 5IFAL 5FGCB 4PJ8B 4POZC 1EEZA 1HNGA 1W72A 4GKSA 1C12B 2HLAA 4NQCD 4X9HA 1G9NL 3OKOB 2HLFD 3ULUD 1URLA 2UYLB 1XH3B 3P0VH 4S10A 5B39A 2F9BT 3DUUB 2GFBB 4KROD 4LKCB 4APQB 3U30B 3D39D 4MVBA 1P5VA 3QIBD 1K8IB 4YDJB 1RZKL 5IMKA 4QGTA 4NQEE 1DQJA 4MA1B 1QLRA 1HOCA 1JNNL 1UZ6F 1BFTA 4GMSL 4GG6F 5C0FA 1IAII 5ALCL 5ESVA 1LNUA 4F80A 5T3XE 5IV2A 5HGAA 1LILA 3FFCD 1QFWL 1YMMB 4TQEL 3V6FA 3BPCA 4P5KB 1Y6NR 4L5FH 5FA4B 5F7DB 3ULSB 4EVNA 2W1NA 3N06B 2A1WL 4A2LA 3ZSSA 2AABL 1CDBA 3QRGH 4DKAA 2YBRB 2Y5TA 4X4YA 1TZIA 4YNYB 2OYPA 3STZB 2HRPH 1ORSB 3D5OF 3PNWA 3TBVB 3VXRD 3RGVA 2V17H 5C9JA 2A6DB 1A14L 2F8OA 4C54A 2NMSA 3SDXE 5KBNC 3U0PB 2E7MA 2BY3A 1XCTA 3O6ML 1A7OH 2ZCKH 3VG0H 3EYOA 4FFYH 1FQ9C 2KQMA 4RGND 1MJ8H 2IEPA 1E4KA 1KIUA 4JLRA 5I8OL 5EC1B 3GMRA 3V7AG 2WWKO 3FB6A 3QT2A 2YEZA 3MRCA 2DKMA 2J5LB 1SBSH 4JY5H 4PJXB 1J1OH 3FOMB 5DJZB 1NJ9B 1T7ZA 4OIIH 4YXLH 4OZIA 2LTQB 2J1KA 4LDOB 1KLGB 1MJJB 5D2LA 3E3QA 1PBYA 5E8OB 2VAAA 1EAPB 5ESQB 4ZUWA 1AJ7L 1UCBH 1G7HB 4MAYA 3E2HA 1FC1A 3QR2A 3KLAB 2P4AB 1MSPA 4OGXL 1YN7B 1AGCA 1DDHB 4XH2B 4Z7NF 2A0LC 4LRNL 1HSAB 1FJ1A 4NKMB 2IPKA 4PTTA 5H2BA 2WINA 3GRWL 5E5UB 1KJ2H 3CAFA 1MY7A 15C8H 4PRNB 3MRJB 1S7RB 2Y5EA 3QHZL 1VKXA 1MJUL 1CDYA 2FX9L 1K6QL 1INQA 4QRRD 5F89A 5I8KH 2HTLD 2BSED 4OJFL 1TCRB 4D0DB 2F19L 4ELKA 3RWEB 3GKWH 4OF8A 3TYFA 3NACH 3S9DB 1MQ8A 4CGTA 3OL2A 4M1CD 2EDYA 4BSVB 2DQCL 4PR5A 2KDGA 3T0EA 1QFWM 1WVZA 4WUUB 1EHAA 1IC4H 1BWWA 1H3UA 3O8XC 1QRNA 1WGOA 4YZFF 1JYVA 4QF1B 2PTVA 4JO1L 2Q7NA 1T7VA 4G43B 1ZS8B 1HIML 3DX6B 3W0WB 1KGCD 3D69A 3FB7B 3D3VB 4MMZC 4G9FB 5EN2B 4Q9BA 3UO1H 2E9WA 3BDBA 3G5ZA 2F54A 4P9HL 1P7QD 4M5YL 2FEEL 1LO5B 1PLGH 4OUUB 5CSZA 3RDTA 4ZDHA 3O4OC 1H8NA 4TRPH 1AO7D 4PJGA 4M7LL 1R6VA 4I48B 5CEZL 3H9SB 2P44B 5ICXB 2RCSH 1I1YB 1U8JB 2IANE 1CU4H 2V5TA 2DIAA 3VXPA 3BESR 2ITDB 3AFLA 3V5HA 5C0JA 5F72S 1L7TL 1MNUL 1UJ3C 3L95A 1Q9OB 2AK1L 4Q7DA 4EQ2A 1CBVL 4QKXB 1NGQL 1H5BB 2XRAH 1ZGLP 3BPOC 5HHOD 4PGBB 4YHOH 1F4AA 5GGTL 2WBJB 3BSZL 5SWZB 1A9EA 2HMIC 2EIZB 2UWEB 4N8VG 1PZUB 5AWNL 3F7VB 1TIUA 2GSGA 4NKDB 3SDXF 2BFVH 4ZTOH 1ZANL 3WFHB 4CVWA 1WZLA 5DF0A 3W2DH 2XY1A 4QHUB 2DKSA 2H3NB 4RMWA 5FYLL 3IGAA 1JUFA 3A6CL 1FHGA 4HFWA 5F44A 5T3XH 1AC0A 1A3LL 3LDBB 4OLYL 4Y16C 2Z31D 4ZFFA 1QR1B 4OSUL 2BNUA 2X9YA 2OQJA 3AB0B 3RU8L 5ID1A 5LXGH 3MRQB 5MEND 4M93B 4GSDL 1FL6B 1GH7A 3LIZH 4MLIA 4TNVK 5JNYA 2NW2A 4YXKH 3EYUH 5FEBA 4FFWD 1U3ZA 5D1ZB 2KH2B 5MEOB 4LPVA 4WFED 5JDSB 3MCLH 4ZNCD 2WBWB 5DD1L 3J8F7 1U8KA 5F3BB 1W2KT 4LPXA 2XQBL 5C0RL 1AY1H 1F00I 1HWGB 3MRKB 4P4KB 5I15L 3FB8B 4W6WB 4LIQE 35C8H 3LQAC 2VL5A 4JB9L 4HPYH 4J6RL 3HC0B 1HKFA 1NCDH 5CZXC 4OZFG 5B4MC 1I1FB 4MCZA 5CEXA 3MRBA 4YHNA 1ZLUH 2N7BA 4LCYA 1DLFH 1CXIA 4DW2L 5HHVL 2ADIB 4X8JB 2F5BH 2DQGH 4Z78B 3BQUB 3DO3A 3G6JB 3IDYC 4P46B 4XMKL 4OB5L 2H2SD 3V4PL 5FM4A 4L4VA 2CLRB 5DUMH 3RPIB 5I75B 5GRYA 2ITCA 5I8CB 4MSWB 2VC2L 1T20B 3LKNA 3OJDB 1KT2B 3CFEB 3C60B 1II4E 5CWSA 4CKVX 3GMMB 2PW1A 3AMKA 5E2UH 4QGYA 4U1HB 3O3DA 3T1FB 5BVPH 4BSWA 3MLSH 2G75B 4P5MB 5KOVC 2BOCB 3VFNB 3UAJC 2W0LA 4DGIH 2HFGL 3FCTB 2D7MA 4M02A 2BOBB 4EOWL 5JMRA 2P5ED 5I1IL 1JPTH 4LK4A 1U3JA 3SJVB 3TA3D 1J9CT 1VPOH 3KYKH 4XBPB 3LB6C 4G6KH 2HKFH 2V2WB 2OMNA 3OR6A 2VN4A 5EOTB 4TVSa 3C8KA 4KTEH 4U6XA 1CICB 5KSBB 4Y1AE 4QXUH 2IAMA 2HJKA 1NCWH 1T5WB 4IRZL 2X2YA 1NBQA 4JDTH 1EJOH 1ZT1B 1MWAA 3LMJH 2DIJA 1YPZE 3H8NA 4O2CB 2MCPH 5L6YH 4WUKL 5ETUA 3OKKA 2E9JA 1FSKB 5HI5D 2G60L 2F53D 2DLFH 3G5XB 2JIXD 4YAQA 4K8RH 3MCG1 5FUZL 5ECJE 3R4DA 1AGDB 4BQBA 2H32H 3PP4L 5HHQB 2ZCHL 3K4ZA 4MMXC 1HXMB 4Z9KB 1C1EL 3L3DB 4G5ZL 1ZGLA 5D5ME 3B8YA 1ZOXA 2X9WA 4YBLC 4OGYH 1X4XA 4JRXA 4RX4D 5E8DH 4AZ8A 1NAMH 1XT5A 1MFEL 1MAMH 4GXVL 4WRLA 4X7DC 1EO7A 1N0XH 2MTPA 4MVBC 3PXJA 1FN4A 3HZMB 4BZ1L 1EHLH 3KPPA 4OCXH 1ZLVH 5GIRA 3BKJL 1AXTH 4UT6L 4XXDB 1ZA6B 4N5ED 4S1DC 1I1AD 3UJJL 3C2SA 4HS8L 1CQKA 1BFVL 2BMKA 3L3JB 1DQQA 1QBML 2DQDH 3AS2A 1PX3A 3EJJX 2GHWB 5JHDE 2Z92B 3IJYB 1LQSR 4WW2C 4ZAKB 2X70A 4PJIB 3PDDA 3VXMA 1U8MA 2ZPKH 3RX8A 1QLFB 2B39A 4Z76B 1NEUA 3QXVA 5DRNA 3X14B 5IQ9B 2G2RA 5F1NB 1UWEL 2CRYA 2OJEB 3D48R 1NC4A 2R15A 4KMQA 4J3OC 2AP2A 4PRIA 4EIZC 3NZ8A 1I8MA 2P5WB 3DMMB 4LIQH 1E4KC 2MKLC 5HHME 1DE4B 1AQDA 3VFTA 1JPST 1LGVA 3QUZD 2WIIA 1P7KB 2WSKA 3LAFA 4HT1H 4NQSA 5C92A 3NA4A 3T3PF 2HJLB 5DRXB 2SEBA 3PWPB 4X5WA 5BO1H 1YN6A 4RIRA 2XTJC 1KCSH 2BNQA 3BH8A 5JORA 3E3QC 2VQTA 1WWWX 3FB5B 4JPVL 4M1DL 4K3DL 1TQCC 3E2HC 3RQ3A 4YBQC 5E5MA 4XRCA 1CF8L 4WVRA 3QO1B 3CXHK 5BRZD 4KJPC 5DVMA 4CBPA 2FYYA 3ECBB 1YPZF 5IVXA 4UV4L 4PS4L 2FATL 1MCQA 4NN6B 4PB9L 4U1NA 4NRZA 1HILA 2P8MB 4PYHA 3IETB 4CAGA 3WEXB 1S9WA 1OTSC 3H7BA 5I1KL 5IKCA 5DQDL 4MA8H 4EI5B 4PJ9B 3T0EC 1UH4A 1I85A 3N1QC 2VUOA 5J7CC 3OGOE 4UT9H 5KVEH 4L4TD 1MCOH 2L7UA 1N2RB 1WC7A 4M7KL 4WY7L 5HY9B 5C07B 4F2MB 3I3DA 3OXSA 1HH9A 4E41A 4OI8A 3FN0L 4JZNB 5D5MF 3AUVA 4NHUA 4O51A 3MROA 3HS0A 3K7UA 5T1MB 4MYWB 2EYSA 3DVNB 4NC0B 5K59E 3FT2B 3IFOA 3QP3A 3BRFA 5I1CL 2OP4H 4XCNB 3F5WB 1Q38A 4LNRB 4FABL 4PY7A 3H0TB 3SY0B 2FO4B 3EYQD 1QSFD 1IM3A 5C0BB 2PYEA 4X7TA 5EUKA 4ZOCA 3B6SA 4KK5D 2HFEA 5EBMA 1JP5A 4XP6H 4XX1E 1AD9A 2VLRB 3U4BL 1HKLH 2JELH 3V6ZB 1KELL 1GSMA 3DVFA 4JDVB 2MPAH 5JO5A 1NC2B 4JRYA 2AXHA 5D2NA 2E6JA 2Y06L 3BX7C 3TGXA 3IDMA 2APXA 2VE6B 5ALBH 4Z18A 4NWTH 1MHCB 4R0LA 3UBXI 1SYVA 3QEGH 4ODSL 4FNLL 5D7IB 3PV7A 3GB7B 5J1TC 1J1PH 2B1HL 4Y4FA 4MQSB 1OSZB 2ICEB 4NNXA 2CD0A 1A7RH 5IB1B 1RZ7L 3IFNL 3CUPB 4U1GC 4WWID 5F3HB 1E4XI 2R0KH 2XNAA 1JRHH 3C6SB 4KK6D 1LEIB 5IMOA 3GMPA 3VWKD 2AQ3A 1CLOH 2R4RL 2WUCL 3MOAL 2R56H 5FYKE 1Q0XL 4NQDA 3DX8B 4XCYA 1A6TA 1P4IL 2ZJSL 4FMFA 2ZOLB 2GJ6E 5F96L 5J11B 4M6OL 5B38G 3WKNA 4X9FA 1JL8A 3CMOL 1R3IH 5L2KE 4OZHE 2J8UB 4JPKL 1F3DJ 3BKCL 2ZUWA 4Y19D 3VGGA 4WI3A 4XZUA 1ZV5A 2YD6A 3MBEC 2GJZB 2HWZL 4ZS6C 5JPNB 4JY4A 4TVPE 3E6FB 2VLJA 4CNIB 1WWAX 4LL9A 1ZT7A 2AEPH 1FGNL 3K81A 4XPBL 2W9DH 2WQRA 1WFUA 4Z5RA 4RFEB 2P24A 4G8EB 1MCJA 5F97E 4PJEE 3RWGA 1TNNA 4NWUL 3X11A 2V5MA 3MRLB 1I75A 2D7TL 4MXQD 4ZOAA 1MRDH 1DBJL 5AD0A 2ZCLH 4YHZL 4S1SL 4XNYH 3S4SA 5DUBA 4KHTL 3QI9A 1O7SA 4QCIA 4RMVA 3KPRD 1GGIL 1GZPA 1U36A 3ARUA 2YD8A 3LKSB 2ZG1A 2ZG3A 4HQQL 1EX0A 1Q9LA 1JHKL 4OLUL 5AG8A 3GJFK 3FJTA 4HUXA 4JG1H 4LSQL 1D5ZB 5D93B 5GSRB 2XWTA 3ZYIA 2CJUH 4CMHC 1U9KA 4KUCD 4U33A 5I1DB 2CIKA 3NGBB 3L7EA 3QHFH 1L7IH 4WWKD 3WBDA 4MXVF 4WGVB 1I7UA 4MX7A 2V7NA 3ARGB 4H8WL 4X6DA 1J0ZA 2AS5M 2QQLL 1AXIB 3OKLA 4X6CF 4Q0XH 4XP4H 1X5IA 1AR2A 2IAMC 4XP1L 1A7NL 2ORBL 4XX1G 3PWVB 5E9DD 1KTLB 4M48L 4HXBH 4QNPE 3VXNB 3IVKA 3ARFD 4KKCD 5A43C 1A2YB 4EXKA 1FRGH 4G3YH 4OCRH 4U0RB 4NO0A 2VLKD 1MF2H 1NGPL 1IAOA 3FT3A 4LPWA 4GW5A 1FFQA 3HE6B 3QDMA 3IDXH 1B4JH 1MREH 3ULVC 4PJBA 4O4YL 5JZ7D 4D0CB 1DBMH 2H2PC 4LLMB 1U3HD 1FORL 2X4PB 5IESH 3EGSA 3QIBA 4JAMA 3A6OA 3INUL 4NJAL 3OPZH 3QCUL 4X6FB 3QDJB 2H26B 3I75B 4JHBA 5CHNB 5IHZB 3HI6L 2N1KA 3E8UL 4WEBL 5FO7B 1LO0L 2A73B 4LPUA 4RAUA 3R1GL 3C2AH 1MAKA 4WV1B 1R5VB 1KB9K 2RB8A 4UBDC 4AG4H 1FP5A 3C6LB 3MRDB 4IHOA 4OI7A 3VXRE 3MR9A 5MI0B 1PZ5A 3OKMA 1RIUH 1SYSB 2O5YH 3ET9F 1NUDA 3NCYP 2NY7L 4XBGA 4Y5VB 3VRLF 5D72H 4XCCH 4RGNE 3MV9B 4N0FB 2R4SL 2YD7A 1RZKC 3D87B 4OD3L 4HWEH 5F8QC 4G8GA 1Z5LB 4RAVA 1ES0A 1OAZL 4JFFE 3QWQB 2XA8H 1KBGL 2X4RA 1NSNH 2Z35B 4LVNB 2A77L 1A6AB 4GRLC 4ORGB 3QAZB 4PRDA 1U8HB 2NY3C 1MVFA 5TJWK 1GPOH 1CN4A 3CFJA 4UIMB 1X44A 1U8NA 1KLFA 4TVPH 1AE6L 4ZUTB 5GZNC 1TZGL 3TYGL 4S1RL 3OKEA 4R4FH 3BN9D 4ZXBA 5EBLB 1ND0A 2YPKA 4GW4A 4XAWH 1OTTD 5HYJA 2NY6C 3MRRA 1RIHH 1I7RB 4G6MH 5EUOA 2WZPD 4IOFD 3L5XH 2OR7A 2FD6H 4Q9RL 1CFNB 5KG9B 2YMXL 1VEOA 3V4UH 1BGXH 4J8RA 2DBLH 5KS9E 1G7JA 4DUWA 4QRRA 5C0AD 5CMAA 3BHBB 3QQNA 2BJMH 3DV4A 1GGBL 5D7JD 3GJFB 4W68A 4AQ1B 4QNPF 5EO0B 3CXDL 1IZKA 3B9KC 4XC3L 3CFKA 4PJ8A 5SWQA 3FAXA 1C5CL 3QEQD 3HE7B 4LBEB 2Q76A 1C12A 5JW3H 4DK3A 2DB8A 4LLUA 2BY2A 3OKOA 2W65A 2EDQA 3KNBB 5CIPH 2NCMA 1OAXL 1I85C 2V9TA 4EUPG 3LEVH 2L0DA 5F7EL 4APQA 1IARB 1OCWL 3WFCH 3B9DA 1WV7T 3JUYA 2HA1A 1UM6L 2HTKD 4ELMB 3UTSE 5I1HL 1R3HA 5T1DH 1ADQH 3CK0H 4U05A 5IB5A 3EDDA 1YMHB 2GT9A 5DD5H 1YMMA 5IOPB 2E7LC 4P5KA 1HN1A 1CGXA 2DDQH 2VH5L 2FDBP 1HK6A 1D5IL 3UTZA 4CL7A 5F7DA 5T1KD 5HVGB 2W9EL 1OPGL 3BGMB 1M7IA 1WTGT 4HCRA 3QQ9C 5EIQA 2ZUTA 2FECL 3STZA 5CP3A 2AW2A 4K55A 4YDIL 3G6AB 5LKNA 3MTRA 1JF6A 3QNZB 2YD1A 5DT1H 1U91B 3GSRB 4AENB 5TE7H 1QKZL 2NY5H 2OJZH 5D2NC 4DJMA 4Q9QL 3GMNB 3WUZA 3QUMH 3DHMA 3QFDB 3WXVL 1I4FB 1YNKH 4P9HC 2V2TB 3BGFC 5I17B 2EDEA 5DXWA 4PJDB 1LO4L 4R0LC 2GTWB 1VCAA 1T03H 3TBSA 3V7MA 4LFHD 3ROLA 1J18A 3UEZA 3VXOA 1HHGB 1BAFH 5LGJA 4Y4FC 3L3KB 4BK5A 5DMKB 5DZOA 4TNWK 4PJXA 1NJ9A 4KKBC 4N8VB 4NZRH 5SWSB 3BWAB 3VW3H 3B2UD 1RUQH 1NLBH 3MLTB 3P73A 2ESVA 4FQCH 4OV6F 5MENA 1MJJA 5DSCA 1C5BH 1FO0A 2K1MA 3LN5A 1LVEA 5DEZA 1UACL 4NP4H 4ZSOB 2GJJA 1G7HA 3ZMRA 2NXYC 3ARRA 2CMRH 3LHPL 4XBEH 5DJYB 3KLAA 1QPXA 1JIBA 1G7QB 5CP7A 1DDHA 4XH2A 2G9HB 2DYPD 4MHHI 5CD5D 5B3JE 5I76B 4YFEA 3S37X 3ZTNH 1A9BA 4FTVE 4PRNA 4HHAB 4OIAA 1A4KB 3K80A 5C0DB 3WKMH 4JFEB 2XYCA 4WFFE 2DM2A 1HEZB 4MJID 2Y6SD 2IF7A 3GSOA 1QFUL 5KS9F 1QSEB 4FXGB 2UVEA 1AQKL 1M6OA 4MJ5A 3LZFH 5CEZD 1GHFL 4Z7UE 1MCHA 4PJFF 4WUUA 5CUSL 1ACYH 2KL6A 5CLTA 3AAZB 5JXED 3S34H 1CLYH 5DR5H 1E6OH 2HFFA 2N7AA 4G43A 4X0KA 4Z7WF 2IMNA 4UIKH 1FG2B 4PB0L 3EDKA 1IGIH 4OZFB 3P77B 5FGRA 1ONQA 2NY1B 3T8XA 1ITBB 2BVOB 4LGRB 4U1MB 2Y9RT 4G42B 2VJXA 1NH6A 3HMWL 4KZEL 5ICZB 4S1QL 4I48A 3UMTA 3WO4B 5FYLD 5ICXA 3QI9C 4FA8A 3S35L 1A1MB 1A6UH 3S37L 3EDEA 3G9AB 2ITDA 1RIVH 5D7KD 2H1PH 4C56E 2P5EA 4N0UA 2D0FA 4K7PY 4KRLB 4PGBA 3TA3A 4LLDA 4HIXL 4NCC1 1GJIA 2UWEA 2XZQL 1I9JL 2KBGA 2WWMC 3F7VA 4GAFB 2BDNH 4NKDA 1DL7L 3SDAD 5JTWA 5K33A 4X6EB 1FNGB 3QDGA 1KPUB 2MJWA 3WO3B 4CW1B 3VFOB 4GBXA 4YUEH 4Z0BH 2MHAA 3QJHB 4QXWA 2F53A 4JR9L 5F6HI 4UAOB 1P4LA 4CRPA 5TE6H 1DTUA 3OGCA 3WNNA 1QYGH 3BIKA 5IW6B 3MRQA 4MGXA 4GG8B 4M43H 3LQMA 3GKZA 4UTBL 2IANB 4WHYG 1S78D 1A5FH 1IGML 2MWCA 1I8IA 2I60H 3UBXB 3PDOB 2XN9B 3O0RL 3SGDH 3LS4L 2DQFA 4WNQB 3L9RA 3MXVL 2DQIL 4RX4A 3ZL4L 1KXVC 2IH1B 2PCPA 2R29L 4RMSA 5CEYA 1OSPH 4P4KA 1T66D 1M7DB 1RUML 4UT7L 2QSQA 3O9WD 4CVUA 1FV1B 2HH0H 5DD6A 4HF5H 2PYFB 3HC0A 1GC1H 4N5EA 5GS1B 5LQBL 2UUDK 4XNXH 5C0GA 4OLEA 3BP4B 1IEAA 1WIOA 1EXUA 2YD4A 2Q3AA 3U2SB 4PRPD 1OP3H 2ADIA 4Z7UF 1WZ1H 3EFDH 4P46A 4LARH 5D9SA 1YNLL 1HYSD 1FZMA 1MCSA 5IWLA 2DRUA 5JLZA 1F3JB 3BRGC 3TO4C 1T7YA 4UZGA 4PJ5B 4KAQH 4HKZA 3OJDA 3CC5B 1KT2A 1ZMYA 5DEFB 3RIAF 3MSPA 5GGSY 2AJSH 4PJAF 5HGDA 3NOIA 3THML 4X80H 3U6RB 1CE1H 5DJ8B 3T1FA 3FQNA 4KC3B 4GKZB 3EHBD 3V4VH 3Q1SL 4P5MA 3SDCD 2BOCA 4PLKD 4OCWL 1S9XA 1WICA 1BVKB 2CXGA 4XNQB 5ISZD 3DROB 3GSUA 3NAAL 5GGVH 2I5YH 1CIDA 1UADC 2BOBA 2C7UB 4U7SA 4HKJB 3NPZB 3RTQD 1U8PB 1G6RH 1BF2A 2HT3D 3SJVA 4MQ7B 5DJ6B 4MA3B 2CLVA 1X6LA 1HH6A 4YE4L 2HT4D 5B22A 3DSFH 4ESKA 4QXGH 5E1HB 4ZXBC 2PR4H 4JQIH 4N5UA 1BD2B 1YEHH 2DLTA 4R4ND 2W0FA 4KRPC 2B20A 5EFIB 5C8JB 4MZ2A 3D9AH 1DUZB 1UXWB 4E0RB 1NMAL 1ZT1A 2GTZA 5ANME 3FO9A 4D9LL 3W11C 4CJ1A 1XGUA 2F8VA 1DFBL 3AY4A 1A4JA 3G5XA 3NCEB 3C5ZD 1ZT4B 3LQAH 3VFUA 1B6DA 4H26B 5AYUL 5CZVH 3GI9H 5HHQA 4DN4L 2JLLA 4TSAH 1IKNA 5GGQL 1HXMA 5DRWB 4G6JH 3T2NH 4QRTA 4P2OB 5CINL 3UZQA 2QKIA 4PJ8C 3L3DA 5EU6D 1M05A 4OZIE 4UDTA 4UINL 3HKFA 3KPSD 3LKPB 3SHSA 4NQTA 2XTJE 4NZUH 4UOJA 5D2LE 2BSRA 4JZOB 3DOSA 1CLZH 4PRBB 4APQC 4HUVA 2MMXA 1DVFD 4XPTH 3U9UB 4KQ4L 4LSSL 1XGTB 2ZSWB 1U95B 4MA1C 4XXDA 5L2JB 1PJ9A 2W9LA 4M62H 2RIKA 1OGAD 1FBIL 1ZHLB 3U83A 2IBZX 3GBML 2GK0B 4LPTA 1OARH 2Y36L 2Z92A 3FONB 3P2TA 3IJYA 4JFXB 1VACB 3FO1B 3DJ9A 3T0EE 3VWJD 3BKML 4K7PH 1QLFA 3W9EB 4Z76A 4OLXH 1QRNE 5F9DC 2DKUA 2OZ4L 1UC6A 3NMEA 1NCTA 2FCBA 1XIWB 2XZZA 3RVVC 5TDNB 2M2DA 1FVDB 2EO1A 5FUOH 2AJ3A 2VDPH 2HVJA 5JA8B 2VSDA 5I0ZA 1OQOA 5C7XH 5EWIH 3DMMA 1KCRL 3GFUA 2R69H 3DLQR 2NZIA 2IQAA 1RU9L 1ED3B 5DUPH 1S7UB 1A0QH 2CKBH 5GGRA 1BM3L 4R7NB 1P7KA 5E2JA 4Y4KB 5EU7C 2XACC 3I3EA 4P3CH 3PWPA 2LTQC 1OM3L 3QJFB 3A67H 3LEXB 3JTCA 3QCVL 4O00A 3O3AA 3X3FH 5JHDB 1W72H 1D5XB 4WW2F 3VJ6A 1DN0B 1KJMB 2EEDA 1MCWM 1I9RL 1QEWB 4GFTB 3LPWA 2GAZB 2VXSL 4TULL 4PY8J 4QHKI 3RA7L 2O5XL 4HMDA 1TITA 5KSAB 3CVHH 4DCQA 3ZE0E 4MD4B 1D3CA 1DZBA 3X13B 4Y19A 2VR4A 2FGZA 1I7ZA 4Y5XB 4EN3B 4QLRA 2UVFA 4Y4HB 3EOYG 3QWRD 1GGYA 5E8NB 1X7QA 3WEXA 4KDVA 5B38B 2GCYB 3FTGA 3HG1D 4M3KB 4UU9B 4JCMA 4M6NL 5C0IB 4JHZA 1JFQH 5C3TA 3IS1X 4LDLB 2VZ1A 1EFXB 2XQYG 1T2QL 4F2MA 3FZUD 1QTYT 2E8ZA 3TFKD 4M1GL 1M71B 1I3GL 1KN2H 4FQ2L 5FDYA 3MV8B 3DVNA 2EDLA 4YHLH 3WIHL 1DQDL 3MUGB 4LNRA 1YYML 5INDA 1I1CA 5C0BA 4H5SB 3HC3H 4WU7B 4KJWD 2OR9H 3REWB 5KVFL 3RAJH 3W39B 3KYMA 1BX2A 3REVA 1JI2A 1I7TA 5LJYH 3V6ZA 3TN0A 1CG9A 1WCBA 1OP5H 4ZPVA 5FV1L 1H15B 2WBJC 2DQUH 2J6EH 1FNFA 1NCAH 4JQXA 1S5IH 2V7HB 4UNUA 5B8CB 3DIFB 3UTTB 1IQWL 3HZKB 3L3IB 5D7IA 5E9DE 2FGWL 3QEUB 1MFCL 1SVZA 3EYSL 3D3VD 2NY0D 3K8LA 4G9FD 1S7VB 2ICEA 2CR6A 4GBXC 5KJRH 2RFXA 5F3HA 2BHUA 3QFJE 3LDBC 3TVMB 3DGGA 2XZAL 3GO1H 3AB0C 2DQEH 2Q7YB 1FNSL 2H9GB 1LEIA 4M93C 5IM7A 2D03L 1IBGH 3OZ9L 3TH2T 4X7SH 4U6VL 4G6FD 1U42A 3DX7B 1PW3A 1RZFH 1CYGA 1FVCB 3G5YB 3QUXB 1R5IA 1U3HA 3GSWB 1JPFA 1SEBA 3GHEH 2J88L 1B2WH 4KK8D 5A16B 5ADOH 3IXAA 4ONOA 1JGDB 2UZIH 4JM2A 5SWZD 1IQDB 3WDJA 2CH8A 4P4KC 4V3DB 2YPLB 4HKXB 2J8UA 1IVLA 4PJ7A 3ZE0F 1ZHKA 1KCGC 2NY2B 3RY4A 2QHLA 5E8EB 3M1BA 2L4OA 3E6FA 4YQXL 5K9JL 5I8EB 2VDKL 1S7QB 1X4YA 4MCYA 4XVTL 5DA0B 1SQ2N 4L3EE 5HGHB 3QUYA 3HNTL 3BQUC 4P46C 3NPSB 4IRJB 1T1XB 4KDTA 4G8EA 2AEWA 4AT6B 3ULVE 4ZFGL 1NUNB 3O2DA 4GOSA 4FFVD 1EERB 3V5KA 4JRXE 1RURL 5D1ZD 5IFHH 1EFQA 4KJQD 5HI4D 3VFVB 1F8TH 2OTWA 2YOCA 3MJ6A 1EH9A 3RNQB 1S7TB 4M3JA 4ODHL 3ESUF 3DRQA 3FO2A 4OZHB 3KS0H 1Z0NA 3SDDD 4UOW1 3HUJB 3IDIA 3TNMA 1BOGB 4QY8B 1DQMH 2I07B 3ZE2F 5DVNA 1MCCA 3SKMA 1RZJC 3SN6N 1E27B 3EOTL 4P5TB 1D5ZA 3OF6A 1KYOJ 4KKNA 1JYXA 2IBGA 4N9GA 1DEEB 4QTIH 1NGXB 4MXWL 3RWIB 2R1WB 1ZWIB 1T4KA 4WO4D 3MBXL 3LKQA 2IH3A 3BQUD 3ARGA 3VXME 4UTAL 2Q87A 3MGOB 3U79A 4ODTH 3VG9B 4PJEB 1CICC 1TNMA 2ADJA 1MHHB 2FX8H 4Z95H 3O3EA 1GYAA 2BERA 3BP7B 4M7LT 1IE5A 4PRIE 3OQ3B 5C0AA 4ENEC 1QQDA 3C60D 2NX5E 5LBSH 1OTUD 3PQYA 5D7SH 1FSKC 2X89A 4X6BB 5D7JA 1IFHH 2I9TB 1A2YA 3AY4C 2F74B 4O2EA 4G7VL 4OGAC 2R2HB 4H1LH 1SHMA 3V79C 4HXAL 5IF0A 1FYTD 3QEQA 3CDGA 4IDLA 2FO1A 3HE6A 3AS0A 4MJ6A 4LCIL 1IKNC 5DFVD 1TVBB 4ZS7H 5JQ6L 1NCBH 1ZKAA 4NT6B 4D0CA 3SO3B 3R06B 1I9IH 4LLMA 4PD4K 4LVHB 5HDQH 2BNQE 4RGMB 1Q94A 2X4PA 5DJXA 4PJCB 3CJJA 3OKNB 3S36L 3PL6B 2DMKA 1RZIA 5TH2A 4A2MA 1A7PH 3BZDA 3MV7A 3P30H 1Y0LB 3FQTA 4M61B 4JJ5B 5FO7A 2YSSB 3LN9A 2ERJB 2R9HD 4WDIB 5SV4A 4BZYA 1XR8A 5GJSL 4NQXA 3VXSB 4HMEA 4HG4K 1NBVL 3KJ4B 4WEUD 4P3DB 5FYJE 3DI2B 5HVHB 2FHBA 1J05B 1OGTA 4YFLF 3F6IA 3GSXA 2Q86B 5AZEH 4PRAB 2A2QT 3F62A 1SYSA 2R0LH 1KFAL 2ICWB 2BVQA 4ZAKC 4H20H 5E4IA 1C5DA 3MLUL 4N0CD 5J9PA 5KSVB 2IWGA 1E4WH 3C87A 5I18H 4N0FA 1OAQL 3ULVF 2ZKHH 1MHEA 4PGCA 4XWOD 1T1WB 2P43B 4JFHE 5I1EL 4NHUE 4HUUA 4P4RB 2X09A 3MA9H 4NHCH 4JHWL 5B21A 3M8OL 3DMMC 1U8HA 1KB5H 1RUAL 4LLVA 2E7LE 3JXAA 3V0AC 3O45A 3MJ7A 2XXCB 4UIMA 4XPHH 3KXFE 5LG1A 4U1SB 4FG6D 4P2RD 2C3GA 3U0WH 2PYEE 4I2XA 5FKPB 3GIZL 1IT9L 3MRFA 4NGHL 4W6YB 2I9LB 3AM8A 4OV5B 4BSJA 1I7RA 5EB9A 1CGSH 2DL2A 2EEAA 4Z7OE 3MRPB 5C6PB 4BH8A 4JRYE 5EU3A 3ULVH 4KGJA 5D2NE 2PXYA 4L29B 4P2QD 1FLRL 4OQTH 3U7AA 5KG9A 4I9WE 2BX5A 2AK4E 4F7MA 1CE6A 4V1DE 4MJIE 1CWVA 3BHBA 1KSRA 3P0GB 4CVXA 2DM4A 4BQ9A 4G8FA 3GJFA 4BH7B 2FSEB 2P5WD 4MAUL 4NN6C 3HC4L 3MRHB 3OV6A 3T77B 1MFBH 1WBZB 2PTUA 1KIRA 5IFAH 5DFTA 1VESA 3CDFA 1EZVX 43CAB 3MRIA 4PJ9C 1KCUL 1RULL 3DXAE 3X3GL 1G9NH 3G9VA 4JFDB 1K3ZA 4KI5D 1UB6A 4HIHB 1KF9B 1DN2A 2VQ1A 1L9MA 1TQBB 5DDHB 1PEZA 2R1XB 4O5LL 1KACB 1RZKH 3MJ9L 1JNNH 4K9EL 4GMSH 4QRSA 5D7LD 5ALCH 4X4MA 2VDLL 1MI5B 4K3EL 1QFWH 5D7KE 4TQEH 1ZAGA 1NGWB 5CGMA 2CDEB 1EHXA 3S5LA 4GS7B 3RNKA 2A1WH 3BYTA 3I2CL 3OKYA 4PFEA 3ESVF 3G6AA 4IIQA 2AABH 1JHTB 2VLJE 2ADFL 3VGEA 2OMBA 4TTDD 3TN0C 4TPRL 4JPIB 2D31B 5MEQA 4QRUA 4EI5D 5DZLA 5IB4B 3QFDA 1A14H 1CZ8L 1G1CA 1I4FA 1OAYL 3RVUC 5JHLL 4KKAC 1FZKA 3QPQD 1P9MA 4JQXC 3FL7A 3O6MH 3MNZB 4XPAL 5C07D 4Z77B 1A7BA 3P4OB 1IM9B 2JK5A 1FL5A 3UTSB 3N0PB 1FC2D 1PKQA 3KPNB 4HS6B 4K23L 5I8OH 1AFVL 3OMZA 3B83A 3QXDB 4N8VA 4E9LA 2Q8AL 3V8CA 5SWSA 4AIXA 4R7DA 3TO2A 4JGJA 5F1IA 4PUBL 4ZSOA 4UILL 3OBAA 4ZYKA 1FZOB 3SE3A 2BHZA 5EA0L 3GSVB 3RVTC 1AJ7H 5HI3C 3ABZA 5E00B 4B41A 5H37H 1CDJA 1G7IA 1EPFA 2VLRD 4OGXH 3ZT5A 4C83B 4Z7OF 4OFYD 1NC2D 3BIAX 3KDMA 3PGCA 5HVWA 1J8KA 4QHLA 5J11C 4LRNH 4S11A 5C0DA 4JM2C 3IFLL 5J57B 3B5TA 4Q2ZB 2GK2A 3GRWH 4OZ4A 1S7SB 3FQUB 3QHZH 4LLWA 1MJUH 4UUJB 2FX9H 1K6QH 1QSEA 4U6YB 3O4OB 4PV9B 3RHWF 2HAZA 4OJFH 2W38A 2F19H 5LCVL 2QQQA 5FM5O 5DMIL 5CD3A 5T5FL 1ZVSB 4PRPA 1OY3B 2DQCH 3AAZA 5ICYA 1ZLWH 3ZYZA 5L88L 3DX9A 3NFNB 4XCEB 2GSIB 3ZKND 3QUYC 4I13B 4JO1H 4LCWB 3LSOB 4KKLD 1IRAY 3RWCB 3P77A 1HIMH 2E9BA 5DEGB 1XGRA 3RL2B 1SMAA 1H3XA 4PJBE 2CPCA 4KHXL 4U1MA 4IMLA 2VXQL 4LKXA 1OP9A 5DC0A 1TMCB 4P9HH 4M5YH 3N50A 4U3CA 3WCYA 4RRPA 2X4TB 4J4PD 4YX2L 2LVCA 1H8OA 1KUMA 5F6IB 4WHDA 2AV7A 4PREA 4M7LH 1A1MA 2XOTA 4I0PB 5CEZH 5IHLB 1CFSA 5E6ZA 4XT1C 1ITCA 1I8KB 5D71L 4U7MA 4TUOA 5D1XD 3RTQA 4E5XA 5GS0L 2ZOKB 1NFDF 3F7QA 4TTGA 4HJGB 3Q0HA 1G7MA 4CVZA 1KXQE 1L7TH 1MNUH 4U1KA 2G5BA 2ZUYA 2AK1H 1CBVH 1RJLB 1NGQH 3S3JA 5GGTH 4H0GA 4WTXA 3BSZH 4ZUVA 4PJHB 4L8CA 1WTLA 1KPUA 5AWNH 4CW1A 5IROA 4P2YA 1CT8B 3CFCL 3ARGC 3VFOA 3S97C 2BSSB 1ZANH 1CGVA 5C08E 3K46A 3U46B 3C8DA 4GUPB 1UEYA 5FYLH 4HH9B 1MFDL 3QJHA 3CVIL 2JCCB 3RX5A 3B9EA 1B9ZA 3A6CH 1JRHI 2B5IB 5GSVB 1RK0B 2VITA 4NZDA 1A3LH 3BD5A 2WLYA 3B9AA 4OLYH 2FB4L 4GG8A 2EDBA 4OSUH 3VXTB 1IAMA 3RU8H 1YY9D 2XQYK 1P5UA 6CGTA 1PGRB 4X5XB 1IILE 4OFIA 4NN5C 3UBXA 1N4XL 3GSNB 4GSDH 2MCG1 2D2OA 4C56B 4J3TA 3TPUA 3HE6C 4WNQA 1N3NB 5FYKL 2C3VB 3IDYB 3S4SG 3DTXA 1H0DB 4N90D 4NNYB 3TBTB 5HYJE 3EJZC 4P2CG 5EUOE 5DD1H 1EJ6A 4ZNEA 3NIGE 4LSRL 5C0RH 3NBNA 3QIWB 1FV1A 5I15H 1HDMB 4JG0L 5CBEB 4DVBB 4XTRD 5DURD 4JB9H 1RPQA 5E4EB 4J6RH 4WV1C 4WW1A 2Q6WB 3T65B 2AQ2A 3U2SA 2R39A 1MHPL 4YO0A 1A6WL 1NCCL 4N1EA 4ODWA 3HZVA 5HHVH 4DW2H 5MI0C 3VWJA 1F3JA 3MQIA 2CRIA 4XMKH 3QH3A 5HGGS 4OB5H 2E7CA 1HSBA 1T22B 1VB9A 3V4PH 4F58L 2EZ0C 4OCYL 3JWDL 2BNRD 1KEML 4HX1B 4RA0C 2VC2H 5F9WB 3QULB 5I16B 4NQUA 3K1DA 4YFDB 4O02L 5FB8B 2IADB 4GKZA 4RBPK 1K4DB 2FLBT 4OF5A 4JN2B 2XZCL 4LVNC 3OHXA 1XGPB 1KC5L 1BZ7A 1QP1A 1RSFA 4JO3L 5FGBA 4XNQA 1YMME 4U0QB 2PO6A 2C7UA 5D8JL 5ITBL 2AJZA 2HFGH 2D0GA 4MA3A 5D1QD 3QEHB 5IT2L 4EOWH 1WFNA 4BKLA 5I1IH 3VFWB 3QO0B 3C6LD 2XFXB 3ARXA 4KJYB 1RAMA 3AM8C 5C8JA 2V2XA 2B1AL 3OXRA 4GKSB 4AIZA 1EIBA 1MFAL 2XPGB 5I0DA 2CK0L 2E27L 2PXYC 5TQ2L 4GW1A 2NY4C 2VZ3A 1SEQL 4IRZH 4LHUA 3QIUA 4CUCA 2VZOA 3MV9D 4NM8L 4PP8C 3L3GA 2EDTA 2GITA 4WUKH 5J3HC 4H26A 2G60H 1RK1A 1WQVT 3MLRL 1DQJB 3QWRA 2Q8BL 4C55A 1HOCB 5C0FB 4AYFA 1J12A 5ESVB 1QNZL 5EU7E 4PJXE 2FL5B 5FUZH 5E99L 4DUXA 1VA9A 4P2OA 3V6FB 3BPCB 3PP4H 3SKOB 2ZCHH 3LKPA 2ESVE 1C1EH 4EVNB 4MWFA 1J8HB 1T04B 4G5ZH 4NZJA 3UTQA 4I1NB 4PRBA 4ONHA 2Y5TB 4X4YB 1TZIB 3GIVA 1LE5A 3PNWB 3RGVB 4JKLA 1UJTA 3MMEA 1MFEH 1JGUL 5C9JB 1R3KB 1U95A 4GXVH 2I24N 4QRPB 5EUOF 2JJUA 2QADC 5L2JA 3NIGF 4BZ1H 1XCTB 1A47A 3BKJH 4LEOA 1UB5B 5EC2A 3SEPA 4FQ1L 3MCKB 3UJJH 1UH3A 1OT1A 5HYIA 4AEHL 4HS8H 4KUZL 1BFVH 2CDFA 3FB6B 4C58B 1QBMH 2Y25A 4PBXA 3FO1A 3MRCB 4ALAL 4XVJL 2P8LA 4WUUE 3T09A 4MQXD 4IIQC 2PW2B 3JV4B 3HE7D 2CO6B 5KANG 1XIWA 2XTJB 2ED9A 3EJYD 4BFGA 3W0WE 5D2LB 2B4CC 2VAAB 3CU1A 4ZUWB 3V0VA 1UWEH 4MD0A 4MAYB 5A3IC 1P9MC 3E2HB 5D4QA 3WFBL 3PDGA 1P53A 1AGCB 5DI8A 3MX0A 2ZWLT 1K2DA 4PTTB 5H2BB 3KLSA 2CGRL 3BZ4B 3H9SE 4PRHB 4QXTB 1TPXB 1T5XA 5CJQL 3RUGA 5CGYC 2ILLA 5HSFA 3QJFA 3SOBL 1INQB 2J2ZA 5F89B 3WFDL 3LEXA 4ETQA 4ELKB 1XF4B 5IQ7L 3IXTB 1NEZB 3CLEL 4N0UE 4XVUC 3SE3C 3T0EB 2VUYA 1DN0A 2D9QB 3ZTJH 4JPVH 3CZFA 4EZMA 1JGLL 4M1DH 4K3DH 3WSQL 1QRNB 2GAZA 2VAJA 2UWEE 2XKUA 2X5PA 3U82B 5KSAA 5DMYA 2AJUL 1CF8H 2NQCA 1MCLA 1HYRC 3D69B 4MD4A 5CGTA 3QDGE 4N9OB 1EO5A 3HNSL 2F54B 3O2WL 1AI1L 5DZNA 4J3SA 4U1JB 4GLRH 3SCMB 4UV4H 2X42A 4PS4H 2FATH 5CSZB 3RDTB 4ZDHB 3DYPA 3WXWL 4PB9H 4Y7MA 2DQJL 3UPAA 4D0BA 1UEMA 4PJGB 4URTB 25C8L 5T3XD 5FCSH 5I1KH 3QCTL 1VFAA 5J0BA 4PJXF 5DQDH 2VDML 1EFXA 2COQA 5CGYD 1I9EA 5HXMA 1F4YL 1AR1D 3VXPB 4LQFL 3AMLA 2CKNA 3V5HB 2IFGA 4M7KH 2NXZB 4WY7H 1PVHA 3DBXB 3L95B 2CR3A 3MV8A 2EICA 3FN0H 3V6BR 2WP3T 3SE9L 1N6QL 4GAGL 4Z7QE 4F9PC 3ETBF 4PGJA 4CJ0A 2JJTA 3IS0X 1P7HL 5I1CH 2GSGB 1RVFL 3MGTA 4F37F 5E6ID 3WO4C 4FABH 2BRQA 5C0EA 2WUBL 3IGAB 5JUEL 1J0HA 1JUFB 1Q72L 3B2VL 4ZTPL 1ZE3C 3VD5A 4LSTL 5TPWL 4IRSA 1EDQA 4YBHA 8CGTA 3CD4A 3S6CA 4QOKA 4ZFFB 4HAGA 4HWBL 1A1NA 5ILTL 4ZPTB 2OQJB 3U4BH 1KELH 3P4MB 3G6JE 1UA6L 1V3LA 3UCRA 4ZFZA 1X4ZA 3CU7A 4WO4A 5B8CA 3EIFA 2Y06H 3L3IA 2AJXL 2D4FA 2LABA 3QSKB 5IROC 1FH5L 4ODSH 4FNLH 1KIPB 3TZVA 5JDJA 1F4XL 2B1HH 2NY1D 2AKRB 5DK2A 4DFHA 1CL7I 3I9GL 3TVMA 4UAOC 5IB3A 3T0DA 1RZ7H 3IFNH 2VL5B 3KPQB 2Z9TA 1BF8A 2R4RH 2WUCH 3CSBA 3MOAH 2JKXA 3QPXL 4MCZB 3TJHA 4YHNB 1Q0XH 3G5YA 3SJVE 2X40A 3GSWA 1TFHA 4LCYB 4FQQA 2UZXB 5A16A 1JGDA 1P4IH 2ZJSH 4NM4L 1IQDA 1EAJA 4LHQB 5F96H 3DWTA 4OD2A 4M6OH 1LE9B 2UWEF 1J5OL 4L4VB 3CMOH 2ITCB 2WNGA 1TDQA 3LKNB 3MFFA 1S7XB 4JPKH 5GS1C 3BKCH 5HPMA 5CWSB 3OKDA 5E8EA 2GUOA 4LCUB 2PW1B 1DANU 1S7QA 3O3DB 3RVWC 2HWZH 3SQOL 4BSWB 1JTTA 2ZNWA 3HFML 4AIOA 5HGHA 1IC5L 1T0MB 4M5ZL 1NKRA 4IRJA 1YEDB 1KIQA 4D2NA 1FGNH 4N0CA 3BUTA 4XPBH 2IAND 3ZT7A 3PGDB 4NSKA 1TZHB 5KN5A 2XN9D 3KWWB 4NWUH 1QO3B 4W6XB 1XZ0B 4CMHB 3QRGL 6FABL 3CDCA 2D7TH 1GXEA 1DBJH 4Y2OA 4YPGA 3U4EA 4JEGB 2Z4QA 4Z7QF 3OR6B 3ARBD 4S1SH 4YHZH 1CDHA 2HG5B 1KXTB 5F9AC 4U6XB 4KHTH 2ZUQC 2IAMB 1EV2E 2D7QA 4KRNA 5FDWA 3HUJA 5IMMA 1MWAB 1GGIH 3NFSL 4RSVA 2VMFA 1Q8MA 4HQQH 2AXFA 1XAUA 4GKNB 2PO6C 1JHKH 4OLUH 1N8ZB 4CADB 1F4WL 2GIYA 1DEEA 3GSNL 4I8DA 4LSQH 5F7LB 3RWIA 1HNFA 4JQVC 4PJIE 4MA7L 2QQKL 4RAHA 1F2XK 4JFYB 3G6JF 4P2QA 3KR3L 1G7LA 1UT9A 1IKFL 1ZGLB 4H8WH 2UZYB 2QQLH 2EIEA 1NBYB 4XP1H 1A7NH 2ORBH 5I6XB 3QIUC 4JPWL 4M48H 5DQJA 4OI9A 3KPPB 5GIRB 2NZ9C 3IT8D 1EVUA 2Y7QA 1SVCP 4LP5A 3G5VB 1NGPH 1TVBA 4P2OC 4NT6A 3LH2L 1MIEL 3PWPE 2BMKB 3OB0K 1DQQB 4OQ1A 2KUTA 1GOFA 4O4YH 4PJCA 4PPTA 4DVRL 1MCWW 1FORH 4U1IB 4FQJL 3VXMB 3INUH 4XMPH 2QV2A 1U8MB 1BD2D 4NJAH 3QCUH 2OSLB 2OI9B 1IC7L 5DRNB 5KSBF 3OJMB 1QUNA 3HI6H 3E8UH 2XG4A 3PP3K 5FKAB 1T89A 4WEBH 3VXSA 1LO0H 3R1GH 4YXHL 3VRIA 1J05A 3KGRA 1A7QL 3JV6B 2Z0BA 3VFTB 4ODXB 4YEFA 2DM7A 3HMXA 2WIIB 3A6BL 5IBLD 1MFNA 4NQSB 1RZ8A 3T1WA 4U3HA 2NY7H 3GHBL 4ODUB 2SEBB 2MQCA 2BC4A 4X5WB 1EA9C 1YN6B 3C5JA 4RIRB 1XIWC 2VB5A 3BH8B 1T1WA 5JORB 5SX5K 2NY6B 4J3VA 2IJ0C 2R4SH 1BBJA 3QUKB 4OCNC 4OD3H 5EBWA 3QXAB 2A9ML 1OAZH 1DEDA 1F3RB 5E5MB 4XRCB 1KBGH 2EE2A 3IAQA 1YEFL 2A77H 3IJHB 3W9DB 5DMGD 4Y1AD 5C0BE 1T7XA 4FQIL 4K94C 3RP1A 2FYYB 3ZT6A 5IVOA 4P23D 1NLDL 4XI5D 5IVXB 2VTFA 3HR6A 1AE6H 1K9TA 1TZGH 3TYGH 1JF5A 4WFHE 1EBAA 4S1RH 3EYVA 5DJDA 1PQZA 4OV5A 1HILB 3D1MC 3OG4B 3VDAA 3MRPA 1S9WB 3H7BB 1Q1JL 5CS7A 5IKCB 3LKOA 3I6LE 4J1UA 4L29A 4OFYA 4PJIF 5IR1A 3PXHA 5DJ2B 4WENB 2MOVA 5T5NG 1WC7B 3IF1A 4X7CC 5BCAA 4Q9RH 3EZJB 5KSAC 3WNOA 3OXSB 1HH9B 5D7IE 4E41B 2YMXH 4GXUM 4HIIA 4NOFA 4DGYL 1TTGA 4IS6B 5F7HA 1CFQA 4O51B 3MROB 3HS0B 4JFPA 1TVDA 3CPLA 4RDQG 4Y5XC 4EN3C 4HKBA 1GGBH 1WBZA 3CXDH 2BVTA 4XC3H 5HJ3A 1IM3B 5IJKA 1C5CH 3RIFK 1HHHA 4Y4KD 4X7TB 4JFDA 4HPYL 3B6SB 1OAXH 5IEHB 3HZYB 4HIHA 4ZMAT 5GQBA 1AD9B 5F7EH 4HEME 5DRZA 1T21A 2E6QA 1OCWH 3NABL 5DDHA 4JRYB 5KZCB 5JHDD 1UM6H 3HI5L 3HN3A 4L3CA 5D2NB 5K9OB 3TWCL 5I1HH 3ILPA 4NC1C 3PWJA 3BGFB 5IW1B 3IDMB 2E7HA 2JJTC 3IKCA 4NRYB 2J8UE 1S3KL 4LMQE 2VH5H 1TVHB 1MAJA 1D5IH 1IGCL 3FQRA 4Y4FB 1OPGH 4F9LA 5D1XA 2CIIA 3OWEA 4PLJD 4NNXB 1ZXQA 1S9VB 5IK3A 4Y4HD 4IRSC 1WFOA 5HHMD 2X1XR 2DMBA 4OKVA 2PUQT 4YDIH 4JPIA 3V9FA 3ZDYE 3VFPA 5IB4A 2B2XL 4XHJC 3GMPB 1YEJL 1QKZH 5HHNA 4Q9QH 3ALXA 1KCVL 2CUIA 5B8CC 3VFGL 1GIGL 3WXVH 4NQDB 1YEKL 5A2LH 4XCYB 3T3MF 4W4OA 4MJ2A 3G6DL 1LO4H 3RL1B 3TZVC 2HKFL 4QEGA 4J23A 5ITFA 5F7FA 1EK3A 5ADPL 2EDWA 5HHXL 3TVMC 1WCQA 4HWBA 4BJLA 2YRPA 5GS0C 2NR6C 4GRWE 1VSCA 5E5RB 1FZOA 2NYYC 4F7EB 3ILQC 4XZUB 1UACH 3GSVA 1B0GB 4JY4B 3LHPH 2VLJB 1WUNT 1A8JH 4I0CC 1BP3B 3TJHC 3QUXC 1ZT7B 2X1QA 1YNTB 2XI9A 4Z5RB 2X9XA 5GS3A 2P24B 1T2JA 4UB0L 3RWGB 3FQUA 3MJ8B 4I18A 4U6YA 3BH9B 1TENA 2XKNB 1CDUA 5IIEA 4Y2DA 5HGBA 1QFUH 4Q6IA 3AC0A 4D9RE 5DUBB 3PQYE 3TT3L 1AQKH 1GHFH 3BZFA 4QCIB 3S96A 4H25B 5CUSH 1GZPB 1UXSA 5HYSA 5GS0D 1DJSA 1Q9LB 3BXNB 3NPSC 4IRJC 4LCCA 5DHVH 5DEGA 3U7YL 4HUXB 4TN9A 2BNRA 4PB0H 4JVUA 1LK3L 2X4TA 3K2UL 4HZLA 1X5FA 3RZCD 3QDJE 3L7EB 3HMWH 4KZEH 1MH5B 3MV7E 5CJBA 3ARZA 1I7UB 4S1QH 1ZSDA 4I0PA 4X6DB 2E7BA 1BJ1H 3GM0A 2PNDA 4RCAA 5CJXA 4LSVL 4N0YL 3S35H 4XPGL 3UJIL 2J8UF 4FQLL 3S37H 2RGSA 3MACL 2RJMA 4HJGA 1IEBB 3IVKB 1V3KA 2NY2D 1K8DA 5TDOA 1I1RA 2QQNL 3T4YB 3ZKMC 3MV11 4HIXH 4NO0B 1VEPA 1KPVB 1YECL 1BZ9A 1IAOB 3HRPA 4OLZL 3LQZA 4NO5B 2XZQH 4GW5B 1I9JH 4BM7A 1CT8A 3QDMB 5FYKD 1DL7H 2I27N 3HPLB 3U46A 4GUPA 3QQ4A 4PJBB 3RWDA 3H6JA 4KROB 1FCCA 1R3JA 3ARPA 3EGSB 3QIBB 4OBSA 1RD6A 4JR9H 5KVDL 4GO6B 3NZHL 3VXTA 4GG6A 5E24E 4GJTB 2HN7A 4M00A 1IGTA 1FYHB 4JGMA 4HS3B 4NUJA 4X5XA 3G08A 2R2EA 3FFCB 5ACMA 3LS5L 5L2KD 4RAUB 3HLAA 4UTBH 5EO1B 3FMGL 1IGMH 2VDOL 4OT1L 3TLRA 1A1OA 1FE8H 3IKKA 3SO3C 5J6GA 1H0DA 3ARDA 4IHOB 4TVPD 5HDOA 3LS4H 3V7AE 4P5TD 4LVHC 3MXVH 2DQIH 3TBTA 4RGMC 3ZL4H 3ZKMD 1AD0B 1HQ4A 2R29H 3QIWA 5TF1L 1RUMH 2DS4A 1OP3K 3RVXC 4UT7H 2A9NL 3MOBL 2W92A 4HPOL 4J3WA 4G8GB 1W0WA 5LQBH 4RAVB 1ES0B 3M17B 3Q6GL 4K07A 1UFUA 1T89C 4JKKA 1KJ2A 1CFVL 1BFOB 5L9DL 3TBYA 1MWAL 5ERWA 3I6KA 5EOQL 4PRDB 3EO1A 3CFJB 2VDRL 4W4NA 1YNLH 5EORL 3SKUD 3GJEA 3L3OA 3Q5OA 5I16A 1ND0B 4GW4B 5FB8A 2IADA 1AXSA 2W0KA 5HYJB 3THMH 3MRRB 3QHTC 5E0QA 1K4DA 4JN2A 4QO1A 5KAQG 2FEDD 2OM5A 3PL6D 1KEGL 3RZWA 1LD9A 3Q1SH 1XGPA 2EDHA 1F11A 3P9WB 4OCWH 5FHBL 4LGSB 5B3NA 4S0UC 4R4BA 3LOWA 3RIAK 4X4ME 4J8RB 2AV1A 3QISA 1G7JB 4QRRB 3NAAH 5CMAB 1GAFL 3DV4B 1F2QA 4YHKL 2F58L 2Y1VA 2XFXA 4YE4H 4M6AA 2E6PA 3O4LA 3CFKB 5SWQB 2Q76B 5FCUL 1J11A 2G5RA 2XPGA 3F58L 4LLUB 2W65B 5TQ0L 2ATPA 2A38A 1NMAH 4Z7WB 1FDLL 1LEGA 3K4AA 2IFFL 5FOBA 3KLHC 1U6AL 5DHYA 4FN0A 4D9LH 4N0RA 2Z91B 4PJDE 1DANT 3TNNA 1JCKA 1DFBH 5C0NC 3P0YL 1O0VA 1KTKE 1R3HB 2WK2A 4PTUA 1FPTH 5IB5B 3RWHA 4NQEA 3RJQB 1AO7B 1WISA 1WEJL 2FL5A 2GT9B 5AYUH 3FT4B 3U48A 3PGFL 3WJJA 5GISL 1RUKL 5SWSE 3SKOA 4U31A 4DN4H 1EEYA 4DKFL 5GGQH 3UTZB 5DC4B 1QRKA 1YEIL 3FN9A 5CINH 3FQXA 4PP2B 1J8HA 1T04A 5IJKC 1M7IB 1U8QA 4ZSOE 4UINH 4KXZH 5GHWL 1U0QA 2AJVL 3QG7L 4PBWD 4L8DA 5LVEA 2JB6A 4ZO7A 4WU5B 4TUKL 5HHOB 4KY1L 1R3KA 4POZD 1TQBC 4QRPA 4PLNC 4KQ4H 4JFZL 2BVPA 3DARA 4LSSH 3N85L 1F13A 5FXCH 4JFEE 1IJ9A 1C7SA 5E6IA 4LOUC 5DWUL 1UB5A 2ZNXA 3MCKA 4MS8A 4JFOA 3NVQA 3EBAA 1ZGLM 2ARWA 4KK9C 1FBIH 3TBSB 2Z8WC 3ROLB 1QSEE 4YGAB 3ZLQC 4JFFD 3VXOB 5LGJB 3GBMH 4GS7C 4YC2B 4F9LC 2Z31B 2NNAA 4BYHA 1ZTXL 2Y36H 2PW2A 5FYJL 1QR4A 4D3CL 1G9MC 2IC2A 3JV4A 5D6DA 3RY5A 3P73B 1JN6B 2ESVB 5MENB 5DSCB 1FO0B 3EYFA 3LN5B 2OZ4H 3O6LL 1JV5A 4XAKE 4M8VA 3JBG7 2NTFA 2X4QA 2H8PB 1RJZA 2IG2L 1X5KA 1MCRA