4L8CA

Crystal structure of the h2db in complex with the np-n3d peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 275
sequence length 275
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8cA01
2V2XB 1MCFA 2EDHA 5IMMA 2IPUK 1MCCA 3H42H 4U1KB 4QOKD 2YPVH 3ECBB 2DS4A 4LMQI 5SWSE 3V0AC 5DD6B 4ETQB 3VXUD 5CSGA 1TZGH 1MREL 3O6FD 43C9B 5BV7B 3BP4A 4XWGL 5JW4M 2WP3T 3RU8L 1EEYA 2FZ3A 1BJ1H 1BVLA 4OZHE 3BJLA 3GSVA 3QYCA 4BZ1L 2XA8L 1P2CB 4NQDB 2LAGB 3U79A 5DHVA 2MTPA 1XF4A 3INUL 5IG7A 1EJOL 3QIBA 4KMTH 2VUYA 3IKKA 5DEGB 4P4KA 5FDWB 4X5XA 2JIXB 3V4UL 4DGVL 4Y4FD 1CIDA 4MWFA 2FSEB 1Q94A 1WF5A 1XMWA 3N1FC 3BPLB 4D0DA 5HTSA 1YJDL 2QKIA 4LVEA 3CMOL 1OSPH 5ICYB 4NZDA 1MLCA 3HAEH 1IGIH 5J0BA 2HKFL 4JN1L 3OXRA 3L1OL 1DLFL 3VXNB 3PWLB 4L29A 3O2DH 3EYSL 3V4VL 5ISZE 1TNNA 4QKXB 1PLGL 4KJYA 3BVNB 1HQRA 2BCKA 3IDIB 5TDOB 2XRAH 4PRBB 1KJ2B 2Y9RT 5TE4L 5IM7B 2X4SB 1UVQB 4AL8L 3RIFF 3E8UH 4TUKH 4RCAA 4OT1L 1GGYA 5D7LD 3TO4B 4PY7B 15C8L 4YQXH 2CKBB 3WD5H 4PJIB 5GRXG 2BZDA 1HXMB 1DBJH 2DLEA 4XXDB 5BV7H 3N85L 5J12B 2ENSA 4LCWD 5DMIH 5FM5O 4X6CB 5CMAB 4JPWH 1Q72H 3H42L 3O9WD 4ZD3H 2YPVL 5EUOE 1YNLH 2Y06H 2KDGA 3I9GL 4NO0A 2D7PA 2XKUA 1U8QB 4U1HB 3CIQA 2P5WD 3BP7A 4UZGA 4DTGH 4P2RD 5MP6H 3OAUL 2L7UA 3GMNA 5BS0B 4ONGL 1J10A 5I1HH 4KMTL 5E2VH 4LEOB 3CDGB 3PF2A 3RUGF 3MRBB 5C0RH 4P9HH 3D48R 4G9FA 4Z18A 5ICXA 5E6YA 3OSKA 2XTJB 4XAKD 2I9LB 2NNAA 3QHTC 5GS1B 1OSPL 3EGSB 3L5HA 4G8FB 2EDTA 1BMGA 3O2DL 5DRNA 2EH8H 3VFRB 4F58H 1JMXA 5CKGA 2XRAL 2EE9A 2ZUXA 5C08E 4J3TA 1H9VA 3ZKQD 4JFOA 1QSEB 1A6AA 3NFPA 3SCMD 4AEIH 3B8SA 4NCC1 1YN7B 4QF1A 4XX1E 4PJ9D 4V1DE 4L8BB 4YQXL 4OZIB 3W11D 4DUVA 2W60B 5D7IF 2AVGA 1KGCE 1DUYA 2EYSB 2ZUUA 4W4OC 4JJ5A 4XCEB 4ZD3L 3OJ2C 1ODAA 1YNLL 2Y06L 1GZQB 1PZUB 2C1PA 4KQ3H 4UIKH 1AIFA 2JJUA 1KN2H 4I9WE 5F3HB 1RUQH 2P5EE 4BSVA 2M1KA 5HHNA 1IAMA 5T1LB 1A22B 3TZVC 4PJAB 4MVBA 5TF0A 5MP6L 3NAAH 1LO3H 4K7FB 3OXSB 3S3PA 5I1HL 5C0RL 3BXNA 2NLJA 1V3JA 4P9HL 2BSSB 3JV4A 4Y0GA 1JUFA 1XAUA 3D6GA 5D2NB 3QNZA 3WFBH 5GRJH 2XN9D 1WWCA 3UTSB 3G04A 2F53A 4F9LC 1NGQL 1A6ZB 2XKNB 4PG9B 4QRTB 1K9TA 4CAGA 3RZWA 2R39A 1MVUB 2EH8L 2HKHL 3B6SB 4F58L 1U8JA 4PR5B 1LQSR 3S34L 1M7DA 3TBYB 5GZNC 4JO2H 2BVPB 5DRXA 1A6WH 2ARJQ 1CQKA 4I0CC 4WNQA 5I19H 3RVVC 1T03H 2DRUA 4AEIL 4IRJB 4M61B 4WO4D 3EFFA 3GMMA 4DJMA 4S11A 4OFIA 4P4KC 2WP3O 1Q9WA 5BRZA 4DW2H 1FRGH 3QUKB 3PP3H 2C1OB 4YDLB 1NGZA 4NZTH 1H3VA 3PWVA 5EDXA 4KQ3L 4UIKL 3WDIA 1KN2L 3PP4H 4JFFE 5DSCB 1T0NB 3D85A 1F58L 2VQUA 1FG2B 3QIUB 4NQSA 1G0YR 1FNFA 4W70A 1OGAD 2J7LA 4PJXF 1MCWM 1LO3L 4BJLA 3MRQA 1TCRB 3OB8A 3T4YA 2NR6D 1OLZA 3GMOB 5GRJL 5DEFB 1J0IA 2EICA 3WEXA 5CD5D 1TTUA 3QPQD 3ULUD 1MFEH 1NCAL 5SWZB 3T04D 5MHSE 2CRZA 3DRTA 4G7VL 1P1ZB 5DXWA 3T2OA 4JVUA 4TYUA 3VJ6A 2RCSH 3I84A 3TBTA 4XPBH 1J1PH 1J9CT 3ROLB 1JNHA 3MV9B 4G80B 3TBSA 1A6WL 1SY6A 3MJ9L 3B3IA 4K7PX 3LKRB 2R0KL 5I19L 3BPOB 4L8CB 1T03L 1H0DA 4PP8C 3K0WA 1EZVX 1I8IB 2ZG2A 4FTVE 1AR1D 2BX5A 4MLIA 3UYOD 4EVNB 4ZPVA 3V4PL 4J1UB 4DW2L 5C0GB 3G6JA 2XZCL 2VLRE 1X7QA 3MREA 1NAML 3I75A 3MRIB 2XKSA 4MX7B 1A7BA 12E8H 3TVMA 2Z91B 3PDGA 1A6TB 4NZTL 4UQ2A 4CMHB 3OAZK 3BEWA 3PP4L 2VXQH 5F6HI 3WIFA 1ZTXL 4LPUA 32C2A 2J8UB 2NW3A 4UOW1 1NC2B 4RGNB 1JTTA 4BQBA 3H8NA 4AG4L 4TOYH 3OG6B 4MAUH 4Z7WE 4XVJL 4U2YA 3DV4B 2YPLD 43CAA 4CVWA 3L3HB 4E9LA 1RZ8A 2G2RA 5KAQG 4OZGF 3IVKA 3FMGL 2P47B 1A02N 5IEHA 2K3TA 4LIQL 1M71A 2ZSVB 1MFEL 2NXZC 5IJKA 5CEXA 1GGBH 1T22A 3JVGA 3VWJB 1A0QH 4YIQB 4WFED 2UV3A 2XFXA 5E9DA 1NC4A 1J1PL 2P24B 4LSPH 3NFNA 1QFUH 1U95A 1RK1A 3OKDA 3SKOB 3O6LH 3B2VH 2NY3D 1AGBB 3NCYP 3I6LD 4RWYH 5ACZB 5IB4B 5SX4H 4OV5B 4GRWH 5FA3B 4Q9RH 2O5XL 4PJGB 4HWBA 4MB5A 2ZPKH 1A7QH 5B21A 2CLZB 1S7SA 2VYRE 5F7YC 4G3YH 1T21A 3FO0H 3T1FA 2RIKA 4GRLC 1INQA 2APBA 1EAPA 1MOEA 12E8L 4OF6A 3V5KB 3QEQE 1OAQL 2HLFC 2F8XC 5TFSL 2OTUB 3PWNA 2XWJA 4K71C 3DROB 3QCTH 5KSVB 2VXQL 4Y19E 2B1HH 1F6LL 2ZNWA 1A7NL 4K55A 1MEXL 5L7XH 3STZB 1ZVYA 4MAUL 2E7BA 4MNQD 1CGWA 1HYSD 3MBEA 3OKYA 5GISH 3S6CA 4POZC 3STBA 5KSBF 3MLRH 3T3ME 4YX2H 4UNVA 1YPZB 5HHOD 1MLBB 4ENED 2Q3ZA 1A1NA 4YDJA 25C8H 1KIPA 4ZSOB 1BLNB 4M7KH 5EO9A 3QQ9C 4YHML 3QO0A 5I6XB 1HXYB 4MJIA 1NBVH 2XYCA 5J6GA 3RWGB 4LSPL 1FNEA 1NPUA 5D1ZB 4G6AC 3IU4H 4QRRE 4XRCB 3X3FH 3O6LL 4JKMA 4PGBA 3B2VL 1B0RA 1BVKA 1JV5B 3B9KA 1BD2D 4X7DC 4WHYH 4P5TA 2Q8AH 4C83B 1ND0A 4JFPB 4HGWB 4P2OA 3S4SG 1NCUA 4Q9RL 1A7QL 4NC1E 5F6IC 1RU9H 1MELA 1HCFX 2H3NB 1P5VA 5MENB 4KV5E 1JGDB 1F42A 2WBJD 3FO0L 4P5KB 2XWTB 4OGXH 5ILTL 5DMKA 2DMBA 5CINH 4AM0B 3RGVD 1M6OB 3VXPB 3QIWD 4JRXA 1PZ5A 5JXED 3HPLB 4Y1AE 1ACZA 3VFNB 3I2CH 1NBQA 3QCTL 4P0DA 3KLHC 5I75C 3UPRB 3FQWB 2VRAA 2X4NA 2ZJSH 2PUQT 4R4FH 3WFEL 3FQUA 1BZ7B 2EEBA 2B1HL 1OTUC 2EEDA 1HHHA 1X44A 1CD1B 2FHBA 1RZGB 1I3RB 2E9JA 1XT5A 5GISL 3T0WA 2O61B 1G7PA 1ONQB 2FO4A 2NY0B 1EEUA 4NWUH 3U36A 3MLRL 2QADC 5D1QA 4YR6A 4YDKL 3WJLA 1KACB 4FQ2L 3WLWC 2HTKC 4W6WB 3BN9C 2BSED 5B3NA 4AY0A 5HDQL 4M7KL 1EVTC 1IT9L 4QO1A 3R8BB 5INDA 3TVMC 3DX7A 1NBVL 4DN3H 3BQUD 1IGMH 4ZOEA 1FNSH 1QRKA 4O2EA 2C3WA 4O58L 1L0YA 2IFFH 5D2LF 2BSRA 3IU4L 1G7LB 4TVPE 2GJZB 1IGFH 2Q8AL 1NUFA 1DVFD 1AP2A 5F7KC 2PXYB 1LMKA 1JWSA 4G6FB 2HAZA 1RU9L 1BM3H 1QBBA 2JCCF 2GEEA 4GKZB 4UMGA 2L0DA 1IGYB 5CINL 5D1XB 4JFEE 1YEEL 3ARDA 3STLA 1A6PA 4U1JB 2DJ4A 3PWPE 2EZ0D 4HS3B 3JVGC 1UJ3B 3OB0H 5F9DC 3TNMB 3VA2C 2BERA 3SY0A 4MA3A 2V9RA 3CCHA 2ZJSL 4R4FL 1P7KA 3P4NB 4R3SA 5I0ZA 4HBCH 4S0UC 3KPOA 3WXVH 1CG9A 3CC5A 4JM2F 1J0ZA 4U6XA 3FN9A 3T65A 1R5VB 2B7DT 3ARFD 5DGRA 3KXFD 2EE3A 2HT4C 4QOKB 4NWUL 1A3RL 4LPVA 3VXUB 4QHUB 3O6FB 2ICWJ 4ZOCA 1H5BA 1CI5A 3P0VH 1T2QH 2ZUSA 3VXRD 2E7HA 2FD6H 2X9YA 3MUY1 4LL9A 3MJGX 1YZZA 4FFVC 4U6YB 3RWEA 4DN3L 3U1SH 1IGML 4ZUVB 1N8ZB 3B5TA 1FNSL 2FO1A 3WS3A 3ALPA 3G6AA 4XB7A 2ADGB 4AH2A 1XR9B 1T1ZA 4ODWA 4Y4FB 1CFNB 1QOKA 1AKJD 2CPCA 4GLRI 4HWZA 4H8WC 2IQAB 4EDXB 5LQBL 1EUTA 2WW8A 3MBEC 2X44D 4NRYA 4ZDHA 1HILB 3C5SB 5DJ8A 4JG0H 5E5RB 3MRGB 3ARUA 4CW1B 1R3JA 1Z9MA 1KPVB 5FUCC 3L95B 2HN7B 1JRHH 2W1NA 1KTLA 35C8H 4JCLA 3VDAA 1K8DB 5HPMB 1MAMH 3K74B 1VPOH 2CO7B 3M17A 4PY8I 5DD1H 5DJDA 4OD2B 4NBZB 3UTOA 3WXVL 1IGJB 3BAEH 4HCRH 4J4PD 4ERSL 3B9KC 2EKSA 5LBSL 2Y07H 4LCWB 4MAYC 4P2OC 3RZCD 3O9WB 3DHMA 2Z8WC 1XF3A 3MV7E 3NCJH 1HHKB 2CSPA 2DWEB 2Q6WB 3MMEB 4HS8L 4HBQA 3P0VL 5DS8A 3RWHB 4F7MA 5A16B 2P5WB 4U1IB 4P2RB 2LFGA 1V3LA 2F54A 4KKLC 1J8KA 5FFLA 2YRLA 2MJWA 2WIIA 3Q3GB 3ARED 2CR3A 3KPQA 3WFCH 1ZLUH 2DTSA 3F7VB 1GL4B 1J0YA 4E41E 5KS9E 1A6VH 4OFKA 4YDIH 5JR1H 5D1QC 1PVHA 3VXSE 3WJLC 1I1FB 5C0AE 1X5JA 4RFOL 2B4CC 4PBWD 2FATH 2CMRH 1S3KH 4YO0A 2PR4H 35C8L 1MAML 1VPOL 4OQTA 3QI9D 5DD1L 2O5YH 1XGRB 1FYTA 4PGCB 1BZ9B 1MCPH 4MJ6B 5I1GH 2F74A 3HZKA 5GPRA 4PB0H 4G9DB 5J11B 3QUYB 3S7GA 4APQD 2A2QT 4G43A 1QNZL 1C5CH 3VFWB 2Y07L 3KPPB 3VFTB 3HPJB 5GHWH 4D8PA 2EDFA 4S1SH 5JQ6H 2YK1H 1BPVA 4EUPB 4RAVA 3NCJL 2P49B 1MCHA 1QLEL 4KI5E 3IDGB 3GO1H 3HS0B 4X7SH 3PXHA 3P9MA 4O2CA 4ZO9A 1TZIA 3EO1B 3PUCA 2H32B 2VB5A 2HVKA 3ARDC 3V0WL 1AQDB 5HDBF 4LPXA 4WV1B 3ZKSD 5K59F 3QDJD 1EHNA 3IRZA 2IAMA 2LTQB 5FYKD 1S5HA 1PD6A 5GGVY 3O3DA 1N4XH 4UIMB 1HHGB 3ORJA 1RUML 2FJHB 3K2UH 4FQHB 2XN9B 5FGRA 1KCUL 5DJ6B 3O2VH 1ZHBA 1A6VL 5ID0A 5JPMB 4KAQL 1T89A 4UT7H 1OWWA 2X89A 4A6YA 4MXVF 3X14A 4B53A 5I66B 5JR1L 5E4EC 4Y5VA 3FB6B 1H5BC 1QKZH 3DMMA 1ACYH 4JRYD 1S3KL 5ADPH 1WTLA 2PR4L 3JSSA 4OF7A 2P42B 4MB3A 3LZFL 4WO4B 5DZLA 2Y1VA 1E4WH 1UZ8A 1KIRB 2NXYD 4HXBL 2O5YL 1Q8MA 2BOBB 4NYLA 5I1GL 4EUPH 2FJGB 4BZ2L 3FCTB 3N1PC 3ZYZA 4PB0L 5CIPA 4NO5A 1GGIH 2DWDA 3R1GH 5CZVL 4U0RB 1BAFH 2R0ZL 1MFAH 3T0EA 4GW1A 4P46A 3TWCL 5IVXF 3FB8B 2IBGA 3V6OC 2OK0H 1N2RB 2APVA 5GHWL 4RGNC 2YK1L 4PPTA 5HY9A 1AE6H 4Z7VE 4JFHE 1C5DB 4ISVB 5F7FA 4XC1H 3HCVA 4X7SL 5DVNA 5D7IB 5I71B 1HWHB 1WJ3A 2A0LD 2KPNA 3OKNA 4FZ8H 1OGAB 5D7KE 2HMIC 3OR7A 1U8OA 4I0PD 4ZUUA 3BFOA 3I6GA 3HC3H 3VWJC 3PV6B 5KSAD 1YEGH 2VH5H 4NCDA 3F12A 4JHAH 4U6HA 1OLLA 3O2VL 2IFGA 2IANA 2AK4D 2MCG1 5I8CA 4PLKC 4UT7L 1PG7H 4NJAH 2R1WB 4UINH 1X6LA 2ZUQB 1EUUA 5C0BD 2ATKB 3BKJH 3MBXH 3B4NA 5JHDD 1QKZL 4HK3N 1ACYL 5ADPL 2GJ6E 2VLKA 5BZDA 4K3JL 1HKFA 4X6EA 2BNRD 4WI5A 1K6QH 1FZKA 1E4WL 4QYOA 3I3BA 2LU3A 3QRGH 5ID1A 1CE6B 3RY4A 3WUWB 1MHEA 3CLFL 4PJ8A 3L7EA 3MOQA 5J4MA 4YH6A 3PABA 1EFXD 3R1GL 4NFDA 1BAFL 4AK1A 4NRZB 2ZWLT 1S8DA 1Y0LB 2OK0L 4WFHE 1QLFA 1V3MA 5TGBA 1AQKH 3TIEB 4QY8A 3PIQA 2DICA 1D9KB 3KYNB 3TJHA 1I8KB 4KDTA 3U9UA 5C0CB 1MHCB 2R2EB 3IFNH 5CSZA 4PJCA 3VWKA 3HC3L 3JUZA 2YPLB 1YEGL 1I7RB 2VH5L 2V2WB 5HGBA 4HV8A 4JHAL 4KUZH 1JMZA 4L4JA 2DQIL 4OAWA 1PG7L 4DZBB 5I9QC 4UINL 1YNTA 4P59L 3BGMB 3BKJL 3BRGC 3MBXL 1VFMA 5EBWB 4BFEA 4XCNB 2VXUH 4P4RA 4F2MB 3VXQB 1JE6A 4MGXA 2NY3B 3BHBA 1SMOA 1YUHB 1DBBH 1T4KB 1K6QL 4LLYB 4PYGA 4XNZB 4L8SA 2VQ1B 1L7TH 3PDOB 2CJUH 4M8QB 2F58H 1A7OL 3L3DB 4IMLB 2IAMC 5GJSH 1T7WA 3Q48A 2X4OA 3BH9B 4YHYB 1XGTA 5KVGH 1DJSA 1NGXA 3QAZB 5KVMC 3ZE0E 4UOW0 4G8EA 3RVWC 1OWRM 4L4VD 2XIDA 4UAOC 1XR8A 5EIIA 4KROC 5E99L 5EZOH 1P4LB 5KANG 1U91B 4P23A 4JZOB 3QXDA 4G9FE 5IEKA 4Y5VC 1AQKL 3P9LA 1FC1A 3DMMC 5T1DH 1MIMH 3WNOA 3HI6H 3QHFL 4LVOB 2FX8L 4NHCH 4YDVA 3UXFA 4LCCB 2G9HA 1SM3H 5GSVB 3LKSA 1G6RH 3O3EB 5HHOB 5JTWA 4WGVB 1U58B 4F57H 4NO3A 3Q1SH 2VO5A 1HK6A 3T0EC 4P46C 5HI4C 4Z95H 1FC2D 5E6IC 4PFEA 1TTFA 4HKJA 2VXUL 4OZGB 5EU4B 4OZ4A 1BD2B 3RA7H 1DBBL 1T2JA 3DGGB 4EKXA 1L7TL 2CJUL 3LSOA 2F58L 4XMKL 1IJ9A 1KXTB 2GYSA 2AEWA 2WBJB 3D2UA 4LGSB 2R0LL 5KVGL 2JK5A 3I3EA 2CK0H 4XTRC 3CGTA 5JA8B 3RGVB 5IT2H 3QIWB 1HHIB 3TYFA 4ODXA 3HUJA 1J12A 5CBAB 2VAJA 2RR3A 3P4MB 1FL3A 3Q5YA 3ZDXF 4R4NC 2AXFA 5F7LB 5T1DL 1FL5A 1MIML 2F53E 3AUVA 3CFKB 5C0DA 5LGKA 1YECL 4HKZB 2AP2A 4XWOD 4NGHL 4NHCL 5D93B 1LEKA 4WHCA 1A47A 5HI5D 1PX3A 4ZPTB 4PJ8C 3WNMA 4F57L 1AY1L 4HD9A 4E42A 2VMFA 2WQ8A 4U1LB 3BQUB 3RWJA 3S37X 1ZGLB 1XIWA 5CEZD 3RBSA 1MWAB 2J2ZA 4MXQD 4N9OB 5EZIH 4NN5B 5KSBB 1R24A 1R3KA 2B0SH 4Z7OE 3U7YH 5BRZE 2W38A 2IBZY 3RA7L 4ZODA 3VRJB 1DVFB 2CIIB 3LKOA 3TJHC 4I48A 4KDTC 5DJAB 1DP0A 4JO4H 4X5WB 1S7QA 2UZXB 2VKWA 3D69A 3VWKC 5E5UB 4PJ5B 3F7RA 1UXSB 4HH9A 4JAMB 2CK0L 4XBPA 1CDCA 3OKOB 4Q6IB 5IT2L 3QBTB 3QXAA 5IHZB 4XCFH 4YWGH 1E4XH 4BFBD 1J1OH 3WE6B 2UZYB 3MXWL 4ZTOL 1JHKH 1ZOXA 2HT2D 2A73A 2NYYC 1MFNA 4D9LH 4IS6A 4EXKA 3MUGB 1GGTA 2CUHA 4OUUA 4PGEB 5DI8B 2N4IA 5M94B 3ARFB 4LCYA 3CFJB 3SDXA 4YPJA 5GGTH 3KXFB 1XZ0B 3S35X 4AQ1B 2FLRT 1DBKH 1WBZA 1J8HD 2I25N 5LAXA 4XNMA 1FLTX 5SWSD 3P11H 2A6DA 1KPUA 5MEOA 3MFGB 4YAQA 3VXRB 3NBNA 3PNWB 3LD8C 1UKSA 1WSST 2D0GA 4X6DF 2I5YH 5B8CA 3P4OB 5BCAA 5B39A 5HI3C 4JHWL 4RA3A 3WN5C 4PP1D 2JB5H 4X4YB 3U7YL 1S9WB 2UYLB 3G6JE 2C4XA 4JN2B 3DOSA 4XHJD 2YZ1A 4TVPH 4HIEB 2H1PH 3SE3A 1T0MA 1IC7H 3HFML 1AFVH 3R0MA 4G7YH 4I1NB 4I4WB 1P7QD 1ZT1A 4OD1L 4ONHA 4YNYA 4JO4L 2BXZA 5FCUH 1BFTA 3LQAH 1AGEB 2CRYA 2EIBA 3SDCC 1SEBA 1LE9A 4QRPD 5D2LB 2QEJA 5ISZD 1CK0H 5F1NA 3D39D 5DRZA 3RNQB 4XCFL 1NJ9A 3V6ZB 2ARJA 4YWGL 1E4XL 5HYSA 4JR9H 2D7NA 3TM6A 1KT2B 2ILLA 1KENH 3RAJH 3TCLB 1JHKL 5CZXD 3S4SB 3MLTB 4D9LL 4OLEA 2E7CA 2HJFA 2ERJC 4HS6B 4NQCD 2CRMA 4EI5D 4DCQA 4G6MH 5T3ZE 5HYJA 1TQBC 1T3FA 4K9EL 3VI3F 5GGTL 2ED7A 3DI2B 1E6JH 3RZCB 2WINB 1DBKL 3FT4B 3ZYIA 4L8DB 1QR1A 5E9DE 3QULB 5LGHH 1U93B 4D0CB 4Z78B 3ARBA 3GM8A 1S9YA 3MRFB 4MA1C 4S1QH 1K8IB 4WW2A 1N59A 5IW6B 1TPXB 2I5YL 4OZFG 4HFUL 4NP4H 3ROOB 3AVEA 4UDUB 3MV8D 2LV4A 2FHCA 2ESVA 3VFMA 2ZOLB 2Y5TA 3HHRB 4PJHA 1D5ZB 5HHPA 2DM7A 4LSDA 5FV1L 4TVPL 4U49A 2H1PL 1XF5B 4ZAKA 1IC7L 4G7YL 4QCIB 1MAJA 3V9FA 1A21A 3VFGL 5FCUL 2VOTA 2R4SL 4LP5A 2VZ1A 3LQAL 3Q6FA 4I77L 2PO6A 3IJYA 1SEQL 4IRSD 1T5XB 5I17B 1CK0L 3P3YA 5ICZB 1JWUB 5F9OH 2FYYA 4P3DB 4WDIB 5EOCH 4JANA 4DQOH 1FFPA 5DRWB 4BFIA 1ZS8B 1NANH 2XI9A 3O3BA 2VABA 3QI9B 5FUZH 5TQ0H 5AG9A 2WUBH 1FIGH 1XIWC 2MMXA 5BQ7B 1JZ4A 4GBXC 4IJ3B 4NPYA 2J5LC 1U8NA 4APQB 3VRIA 4G6ML 4PB9H 3PQYE 1NAMB 1QRNA 2X4RB 4QHNB 3EO9H 5DJ0A 6FABH 1E6JL 3GMLA 4HPYH 1FFOA 3QFJD 1OTTD 4MJIE 3X13B 5LGHL 4HZLB 2IPKB 1UB5B 1SJXA 2GTZA 2XZAH 5L2KD 1FCGA 1G7IA 1T7ZA 2EDKA 4BH8A 4HWUA 1CU4H 4L3EA 3TH3T 5C0EA 4I9WD 5DFWH 4E5XA 4NP4L 4LNRA 1AXSA 1JPGA 4PRAA 3C5JA 4I2XB 3QDJB 4UB0H 5GRVK 2EXWC 5KJRH 3CDFA 3VGDA 3ARXA 3L5WB 4QGTA 2F8OA 4N8CH 3DYMA 5EU6A 3I50H 5DJCB 5CHNB 3O8XB 4R96A 1IM9A 1UACH 4JRXE 4FABL 5GS0D 1MQKH 4A2MA 2LAAA 1B0GA 3QEHB 3W9EB 5C8JA 3QUZA 3FN3A 3MA7B 5DO2C 4RMTA 4WTZA 1T7XA 4R9HA 5EU5B 4DGIH 3BW9B 3ABZA 3BZFB 4PS4H 2GSIB 2WMPA 5EOCL 5BW7A 4DQOL 2YSSA 3MLVL 4R0LB 4WFGD 5B8CC 3RFZC 4YXKH 3DURB 4HX1A 5FUZL 2G5BB 5TQ0L 2WUBL 2NXYB 4H5SA 1ZVSB 1YY8B 1F4YH 1EEZA 5DC4B 3D3VA 4POYA 4NQUA 4PRHB 3GIZH 5MI0C 5H94B 4PB9L 2DOCA 5IFJA 3SE3C 3MRKB 4QRSA 5IVZB 3BIKB 1S7RB 1OTSC 4X7EC 4MS8A 3MJ6A 1I7ZA 5DK0A 5E70A 3MFFB 4YFLI 3HAEA 3ETBF 3BZ4B 1XF1A 2O93L 4LSSH 5FYKH 1XEDA 1CICA 4KRPC 2V2TB 4YUEH 2EDYA 3ULVF 1DQTA 3GI9H 1UZ6E 3PXJA 1T1WB 3THMH 4UB0L 1TVBB 4BKLB 5JNYB 1KB5L 4I0PB 2YD1A 4GG6F 3M45A 3MRHB 5D96B 1YMHB 3RWIB 3Q5OA 4A2LA 5HHMA 1I1AD 4Z8FH 3I50L 1QSFD 2R1XB 1J05B 3JWOL 1ZANL 2YD4A 1UACL 2GT9B 4WW1A 5DD6A 1MQKL 2SEBB 4MDJB 3TJEH 43C9A 5IOPB 5FV2A 3ZE2E 5DQ9B 3VXMB 1J86A 3RTQA 4WUUD 3OKKB 2VDNH 1QUNA 5C0BB 3G5YB 3GJFH 4N5EA 4JVPA 4KK5C 3E3QA 3O11A 3ARBC 1P2CA 2OTPA 2FR4B 4NQDA 1X5YA 3MJ8A 3QEUB 3EYQC 2FBJL 3VG9C 3LEXB 4WW2C 2BNRB 5DEGA 3SDAC 3MV11 2WBKA 1GGUA 3O4LB 2H9GA 5L8LB 3V5DA 5EOQH 4NNXB 1WT5C 1LD9A 3ZHLA 4FTVD 4C57C 1F4YL 5KVDH 5J1TC 1K5NA 3UEZA 1RUAL 4XNYH 3TP4A 5CAYB 1RJZA 1KYOJ 3PWLA 4ZNEA 1IAIH 3AGVA 3MRNA 1EZVY 4BQ6A 1I1YB 3BVNA 3AU1B 1H3PH 3C60B 1E4KA 1BIIA 4PRBA 3OKLB 4P2YA 2PO6C 2P7TA 3H2WA 4YUEL 4DOHE 1HINL 2C3VA 1EDQA 2IPUG 4D94A 2CQVA 1UM6H 1G1CA 4OCRH 3H7LA 4JRWA 1KLUB 3QDGB 3AAZB 4Y89A 2DD8H 1UWXH 3TO4A 5IVXB 1EO5A 4PY7A 4PJDA 3THML 2N56A 3LS4H 1A6UH 1HXMA 5FUOH 4XXDA 4PREB 5B3JE 3GIVB 4BELD 4OSUH 4Z8FL 4JPIA 3ULVD 2X4UB 3WNLA 1FGNH 1NSNL 3TJEL 3GJEB 3IDUA 2IQ9H 5GGSY 4N8VG 1WBXA 3BMVA 4NOFA 3OG4B 1GPOL 1YJDC 1U8QA 4J7RA 3FKUS 2VLJA 3Q6GH 1LO4H 3HE7A 2CGRH 5D5MB 1CL7L 1IEAB 2HJLB 3K1KC 4DFIA 2NY1D 5ESQB 1LEGA 2QSCH 1IFHH 2VKXA 5IGXH 1XGYL 5KVDL 1LGVA 1PKQB 4XNYL 3EYUH 4PJFB 1BF2A 3N50A 1IAIL 4FFWC 2P8MA 2F54E 4OCXH 1H3PL 3QEQD 4KVCH 3V8OA 3QUZC 3UTZB 3BN3B 1PBYA 4N5UA 2GAZA 5DHVH 3DLQR 1QSEA 1JZ7A 2BP3A 1YN7A 1FH5L 1DN0B 2QLVB 3NFSL 4LDEB 4EN3A 5BW7C 2WUCH 5LVEA 1VFUA 3GSRA 2IADB 1A6UL 1VA9A 2C4FT 2LABA 5I73C 3N1GC 1Z9LA 1JZ5A 3QQ3B 2XOTA 4OSUL 4XCEA 4ZXBA 2J88H 4JO3H 5DQJA 3MJ7B 2VL5B 3DX8B 3MSPA 1FGNL 3DIFA 2R1YB 2OI9B 3U2SB 5KVFH 3FFCD 1ZMYA 1WZLA 1S78C 3FZUC 4MS8C 5F3HA 5ENWB 1FYTE 5F71A 4PV9A 3Q6GL 1Z9OA 1CICC 4PV8B 2P4AB 4Y16D 1DQJB 1ZAGA 3UBXG 1BX2A 2CGRL 3LIZH 3FO9A 5D2NA 2QSCL 1IFHL 1PEZA 3UTSA 3EOYG 3LEYH 2FB4L 3EYUL 2X40A 1IC4L 5J13B 3R06B 1ES0B 3P30H 4FQXD 2Z92B 3X17A 4XVUC 1MUJB 4P2QD 3B6SA 4OF3A 4AIXA 4L4TB 3OKMB 3H9SD 3DVNB 4Y1AD 3RTQC 1N64H 1R5WA 2EXYD 2X1PA 3PWUA 4XMPH 3E3QC 4M61A 2P1YA 4K8RD 5EOCJ 4GW4B 1X6NA 1DBAH 2EC8A 3NA9H 3CZFB 2WUCL 2OL3H 1V8HA 3LS5L 1FHGA 1B90A 2QSVA 3K2MC 3QUKA 3L3JB 4RQQB 1Z3GL 3EO0B 2J88L 4GQ9L 1LHZA 3FO2B 5LG1A 2PKDA 1F4AA 4P9HC 3IDMA 4TTDC 5JPNA 4LDLB 4KMQA 4YHKH 5DSCA 1SYSA 4YHOH 4FA8A 5I1LA 2F8VA 1FG2A 2NY4D 4QXGH 3RVUC 1MCWW 3PV7A 1IKNA 4NQED 3VGAC 4X6FA 3QUXA 3T0EE 1J1XL 1RHFA 1JZ2A 3OAYH 2YR3A 2V7NA 3HE6B 3LEYL 5DEFA 3IDYC 1U8IB 1KN4L 5FKAB 1RJCA 3T4AB 4HDIB 4JY6B 2R0WL 3GGWB 5SV3A 3ZTJH 5KG9B 1D5IH 3PWPD 1BQHG 5EBLB 3MNZB 1N64L 1UJTA 1FN4A 4L8CA 1CFSB 4KJWD 5ERWA 1NFDF 2ORBH 3HE7C 3NA9L 1VACB 3ME0A 2IANE 1U3HA 5DVOA 4M6AA 4J1UA 4U6TA 4ODBD 1J8HB 4R26H 3O3UN 4KY1H 5B4MD 2OX5A 2OR8A 3MRIA 3GB7B 1J0HA 5SWSB 2HTLD 1TMCB 2Z91A 4JY4B 1A9EA 4XPFH 2MHAA 3G5ZA 5I74C 1A1OA 5FM8A 4YHKL 1XCTA 4RX4D 2IWGA 1NC2A 5GS3A 3IRPX 3MLPA 3OX8B 3HLAA 4OIBA 4P5MA 4HULB 3AROA 4Y4HA 5IESH 3KJ4C 4TQEL 2EYTB 5IR1B 4C56D 4MNHA 4EN3C 3VMNA 5JMRA 4NC2B 1P7QB 1KJ3H 3DJ9A 3F5WB 1JGEA 5TE6H 5EC1B 3FO1B 4UUJA 5FA4B 1XGUA 3G9AB 2ZSVA 3HB3D 3D0LA 4TNVF 4RIRB 1JP5A 2A6KB 2BSTB 4ZXBC 2Z31A 2V7HA 4P2CG 4OKDA 5ISZB 2MOVA 4YIQA 5HVGB 4TN9A 2RB8A 1NEUA 1D5IL 1NH6A 4Y8DC 2XQYK 3CFDB 5ADOH 3C8DA 3P9WB 4PJCE 4BUGA 3SKNB 3GNML 1I7UB 3IKCA 1ZV5A 4CMMA 4ELMF 5IB4A 5ACZA 1N3NB 4JQVA 2ORBL 1RULH 4NQCB 4Z7NE 5CP7B 3C5ZA 4Z7QF 1LEIB 1MHPL 3QP3A 4PUBL 4R26L 4KHXL 4YPGB 3U48A 5T3XD 3MV7D 5EUOB 4NQVA 5EZLA 3V5KA 5IFHH 2OTUA 2YXFA 4XCYB 3CSYA 4UDTA 4WENB 4XPFL 3HN3A 3RNKB 4D9RE 2QBWA 3TA3C 4OM0H 3O3AA 5KSVA 4JZJA 3EYFB 1RZIB 1MCJA 3MV8B 2VTFA 1YEIL 2AJ3A 5BZWB 3LRGA 4M7LH 4W6XB 2X9XA 5FXCH 1OAZH 1RIVH 4JDZB 5J3HC 4TRPH 1JK8B 4JVWA 5E2TL 2X1WL 1XF2B 3N9GH 5JZ7C 4LLUA 1NEZA 4X6DB 1NMAH 5I15H 4B0MM 4E41D 3CUPB 5TE6L 4EZMA 2UWEF 3EYVA 1MLBA 4JLRA 2YMXL 4X9GA 4IRSB 3DHJA 3RPIB 5FB8B 3CK0H 4E0RA 4RMRA 4XGZA 5I16B 2JJVA 5C08B 3FTGB 2IPTH 2ADJA 2XT1B 3VCLB 1WAAF 1YY9D 1JV5A 2VITB 2ZSWA 5T1MB 1N6UA 2J6EA 4DEPB 1A1MB 3B5GA 1RULL 3OF6A 1HH9B 4RRPA 4OLUL 4FFZH 1KBGL 2FH8A 1ZHNA 2ZUVA 3QUXC 1G7QB 2BVOA 2H3NA 2Z8VC 1JGDA 5T3ZH 3ARGC 2J8OA 5GGSB 1FDLH 3MODH 2PTTB 4XH2B 5IFHL 3KPLA 3MNVA 3VFNA 3U4EB 3X12B 5TDPA 2DMKA 4N0UA 4OM0L 1JPSH 1U42A 2NY6C 3FQWA 3JXAA 1T1XB 2P5EB 5HJ3B 1JNNL 1ZLSH 1BQLH 4K7PH 2QQLH 1AO7A 2F19H 4M7LL 5F9JB 4B7IA 2BHYA 2X42A 3HMXH 2PYFA 1RIVL 1UC6A 3PGDB 2R2BA 3W39B 3ZDYF 4O9HH 1JRHI 1CN4A 4TRPL 4PJEF 4Y2DA 5IB1B 2ENYA 1NMBL 5JW5B 3N9GL 2O61A 4RAHA 2ICEA 1U3HC 2C4FU 5I15L 3BGFB 3HUJE 4U1SB 5A2IH 2PW1B 3UJTL 2WWKT 4AYFA 5EO1A 3V95A 4Q97A 5E7FA 3W0WA 5HBBA 3CK0L 3D87B 3HI5H 4X98A 2GK0B 1DEEB 4O2FA 4Q9QH 5GJTH 1JFQL 1LK3L 2IPTL 4XMLH 2AAVA 4ZUTB 5TE7H 5DD0H 5HGHB 1RSFA 4KKAD 3PP3K 2V5YA 4FFZL 4ZFGH 4Y4HC 4JKPL 5INCB 1M05A 5T3ZL 4I3SL 1U2CA 5D1XA 2X4PB 1V7MH 4L9LB 9CGTA 5EPMA 1FDLL 1KC5L 3MODL 4X99B 1ORQB 4LDOB 4HS3A 1UJ3A 3MOAH 1LE5A 2A74A 1OCWH 2Z31C 4JFFB 3CDCA 1JPSL 5F96L 1JPST 5J9PA 1ZLWH 4HIIB 1ZLSL 4JM4H 3TN0A 5JOFA 1BQLL 3TC9A 4K7PL 5LWYH 2QQLL 3MA9L 2F19L 5GS0H 5D6CB 4RZCB 4KTDL 4JREC 5EZJA 5FF6B 3SDDA 1R5VA 5I1AA 3MGOA 1RUKL 3DYOA 1QSFB 2ZP0T 4PGJA 1G9NH 2EIDA 2PW2B 2NCMA 3C5ZC 3D0VB 4HCRA 1OW0C 1GYAA 2COQA 3EOAA 3HC4H 4CVZB 4NZJA 3I02B 4PJBA 4WUUB 4XP9H 4Y5YB 4OZFB 2FX7H 3BISA 1X5AA 4U6YA 4H20H 3HI5L 1Q9KB 1WEJH 1S7WB 4RGMC 1WITA 4RWHA 4WGWB 5GJTL 5D7JA 4JZJC 1I9JH 3SDXE 5DUBA 4XMLL 1XR9A 1CFNA 1LDPL 5IBUG 5TE7L 1I4FB 2ZUTA 4DKFH 1ZXQA 4FTVB 2AV1A 2IQAA 4HXAH 2XZZA 5GZND 1HILA 2VLRB 3C5SA 3EJZC 2KKQA 2CLRB 2Z8SA 3ZE1E 3RVVD 4XP6H 3CVHB 3HI1B 4M6OH 4CW1A 4WFHD 4R7DB 5SX5K 5HGDB 3CPLB 3IETA 5H37G 1U3JA 2HN7A 2BVQA 2K9UA 1TFHA 3LRSB 4HIJB 4JKKA 5DK3A 1NGYB 1OCWL 5HPMA 4YC2C 4P4KD 1C8PA 4AQOA 4HGMA 4QWWC 4JM4L 5LWYL 5D7LA 4O00A 3X11A 1W72H 2H26B 4QXTB 4WFFE 3HRZA 2P44B 4Z7WB 1UQSB 1ZVHA 1QD0A 2A6JA 2NW2B 4H25A 4OF5A 5EO0B 5TH2B 5L0QB 3BD3A 1Y18B 3SHSA 1G9NL 2DM4A 4WEBH 1B9ZA 2W65A 3K81A 5HHQA 1HHKA 1AGFB 1VSCA 3C6LD 3CX2A 3T8XA 3MYJB 3MMEA 3HC4L 2VAAB 4XP9L 4G8IB 2FX7L 3L6FA 2YHGA 4HUUB 1OD7A 4NCC2 3W81A 1JF1A 5HHVL 3FT3A 4HUWB 4PTUA 1V7NH 3TBWB 2VZUA 3GMRA 3NOIA 1I9JL 4M93C 4GAYB 5JXAH 1RD6A 2VLLB 3NPSC 4AT6B 1VFBA 5FYJD 1JWMA 1KXQE 4U0QB 3DWTA 4GRMB 3CVHH 3H9HB 1BQUA 4KK9C 4HXAL 4Y2DC 2OXGA 4NZUH 3DTXA 4BFGA 4OI7A 4NO0D 2M8XA 4X4MA 1MCQA 3QEQB 3CD4A 2R23A 3BDYH 3QCUH 2X7LA 2ESVE 1PQZB 3KS0H 4PJHE 1MH5B 3MGTB 2BC4B 3SCMA 4MXWH 2KL6A 3UX9B 4NQXA 4G9FD 2DAVA 2KUTA 5IMOA 4PJ9A 3LN9A 4PGCA 5I2IA 4MJ6A 5K9QG 2WWKO 3ZTNH 4G9DA 4IIQA 3VG0L 1IGTA 2OS7A 4J23A 3GSXB 2YD8A 3ES6A 1R6VA 5FO9B 4KU1A 3V0VB 3VE0A 5JUEL 1Z6JT 1FFNB 4WEBL 4EUPA 1MCLA 2C26A 2V5SA 5EA0H 3IDGA 1UA6H 1MHHB 1LK2B 1IGCL 3UTQB 1AQDA 4YEEA 4HJJL 4FG6C 3SE8H 2B1AL 3NIDF 4Y16B 3G08A 3S5LA 1P4BH 1QA9B 4UIMA 1QRNE 5JXAL 4WY7H 3GI8H 3TN0C 2NXZD 3RKPA 3REWB 2DQFB 4GS7B 2XN9A 4U1GB 4Z77B 3MNWB 1K3ZA 2X70B 5DJ6A 4M9PA 4NSKB 1A8JH 3SDDC 5E24E 2QSTA 4Z5RB 3LOWA 5F7EH 4H88H 4LCIH 1EERB 2CD0A 4L3EE 1CD0A 4NZUL 1AJ7L 1N0LA 3AY4C 4O4YH 4LLQB 4P2QB 3RUGA 4X4XB 3NIFF 3QCUL 4Y1AB 4ONFH 5D9SA 2MFNA 3LY6A 1INEL 1ZT7B 1QFPA 3EOBA 4EJ1C 5EBMB 3MZTA 3IFOA 5DWUH 5FOBB 3KVQA 4RNRA 2YPKA 5EU6E 4PLJD 1S9VA 4GLRH 5HD8C 5AUMB 5IQ9A 2BOBA 3NMEA 5D7JC 4GRLD 5DFVC 3ZTNL 1FZMA 3IXAB 4HK3J 3KNBB 2HLFD 5CILL 4Z0BL 5JOPE 4ORGA 3RDTA 5I76A 3BI9X 3FB8A 1N2RA 5A3IC 1T2XA 1EXUA 4P57B 4GH7B 1F90L 4S1DC 3C8HA 1IAKB 1C5DA 4WI3A 1UA6L 3CXDH 1A9BB 2JB6B 1MFDH 4F7PA 1T04A 4DVRH 4NRXA 3VD5A 2NY4B 2NX5D 4HLZG 4MSWB 3D3VE 2VZVA 2YD2A 3BKML 3CVIL 2V6HA 3VH8A 1JTOA 4WY7L 3MRDA 1WLHA 4L1HA 3EKCA 3GI8L 5EFIB 3PV6A 3OWEA 4URTB 2NY7L 3QQ9D 2IH1B 4R97C 1E28B 2YD7A 2OCFD 1D6EB 2HFEA 4N8VB 5F7EL 4H88L 2DL9A 4LCIL 1F8TL 2W0KA 3OB0K 1QPXA 2R1WA 4G6AD 4PBVC 4GG8B 4LLWA 1FSKC 1CYGA 4JFEB 1RK0A 4PJIF 1X5HA 3PWPB 4KUCF 1I9RL 5F6HJ 4TPRH 4UTAH 1F4HA 3BP5A 2VERN 5DWUL 3TO2A 4X6CF 5HHME 1L0QA 5DC0A 1Z5LB 3KYOA 1P4IH 5DJZB 2A9MH 4OI8A 1QFWL 4HUXB 1IZJA 1CDIA 3F65A 1PAMA 1XCQA 2VZTA 5I8KH 4YHLH 3QG6B 3OBAA 3LKPB 4LFHG 3E3QE 2ATPA 1QHPA 1A64A 4NQDE 4Y8AA 1OTUD 3FQRB 4Z9KB 5GSRA 3MACH 1OF2B 2HG5B 3CFIC 5KN5B 1WICA 4H1LG 4HF5L 3FQTA 2AJZB 2AXGB 2XPGB 1UKQA 5GGRY 1NCWH 3TIEA 2NY5H 1CXHA 2CIKB 4OQTL 1NBYB 1KFAH 2W9LA 2QADD 2Y25A 2WQRA 1KJVB 2HTKD 5CP3H 3BN9D 3RPKA 2RBLA 2YN5A 4PJ9C 4ZNEE 1I7RA 3MO1A 4IOIB 2V2WA 3C9NA 4Z0XB 3PL6B 1OAKH 3AC0A 1X4XA 2W0FB 3DX6B 2EYRA 4IIQC 4HKBA 3IFPB 5DA4A 5C6WH 3UAJD 4ZFZB 3AB0C 4PJXA 1OP3H 4I3RL 4DZBA 5IMLB 1SQ2N 1DQQB 2H8PA 2K1MA 2V5TA 4I3GA 1G6RA 3BGMA 4OZIF 3HR5A 5TPWH 3A6BH 4TTGA 3RWFA 1S9XB 4PJDE 1FO0B 4TPRL 3UBXB 3ZT7A 1KCGC 2VLMD 4NKIH 1BWMA 1JPFB 2GSGA 3SQOH 1RZ7H 4RAUB 1IMHC 3HNVH 4FFEX 5F89A 1KEGH 1P4IL 2FWOB 2BRRH 2XICA 1XGPA 4KK8C 4PGDA 5F3BB 1BFVH 4KUCD 5I8KL 4U7MA 3KDMB 4YHLL 5BO1H 3U46A 4A6YL 4PJAF 4XPHL 2OMNA 5J7CC 2VLJE 3MV7B 1U3YA 3BE1L 4G59A 3QJFA 4OFYD 2EKJA 1NFDB 5DTFB 3OPZH 3MR9A 1U91A 4OV6F 4XPGH 3MLXL 5IQ7L 2HT4D 1KB5B 1W0VB 1RJYB 2FIRT 4MDIB 4BK4A 1KFAL 1B4JL 1LP9A 3AMKA 4MNQA 4JDVA 5BS0D 4YZFE 1JI2A 4LCCA 4M5ZH 3JZ7A 1T1YB 2OTWA 3O3EA 5HHOA 4FFVD 4E41B 5KS9B 1MAKA 3GZKA 2XTJD 4GUPA 1U58A 1BBJA 1LILA 4CGTA 4BSWA 4N0YL 2FNBA 5CJ8A 3RDTC 3B2UC 5JIKA 1QSEE 1JFMA 3VXSB 4JZNA 1G1YA 1FZOA 3A6BL 2YWYA 1NLBH 4XNQB 4QHLA 2AJXL 3TH4T 1A4KB 3IT8D 4WJ5B 4O51B 1CDHA 2AJVH 3SQOL 2EDDA 1RZ7L 1G7HB 3MBED 3DUSA 3F6IA 5DT1H 3HNVL 3OJDB 4GW5A 5EU7C 2BRRL 3U7WH 5T3XH 3SPVA 3HC0B 4AZ8A 2HA1A 2A1WH 2BDNH 3GBMH 3DV6B 1BFVL 2R4RH 4F7CB 1KG0A 3UTPD 4M1GL 4NN6C 3RGVA 4M1DH 3KJ6L 3QIWA 5CD5C 2OR9L 1NLDH 5JXEA 1RIUL 1X4ZA 3BEVA 4ELMB 1BQHB 2CDGB 4FXKB 3H3KA 3LCYA 1OL0A 1PSKH 2MQ0A 1F4WL 4XPGL 5IROA 5D2NE 1WWWX 3KS0J 1Q1JL 3ELAT 2GY7B 4MAYD 4P2OD 3NACH 5EUKA 1BEYH 3UTSE 5T1LD 2FJFA 4NO2A 2OQJA 1LNUB 4HJGA 3ARWA 3MCKB 5C6PB 1OP9A 3IS0X 1INDH 3AM8C 4GMSH 4LFHD 4Q2ZA 4M5ZL 4DUXA 2CXKA 2I07B 5DDHB 4PGZA 3MRPA 3SGJA 1YEDB 2EIZB 4ZPTA 1IAOB 4DZ8B 5CLTA 4KKLD 4M6MH 5GGTA 1CIUA 3ZDZE 4KDVA 4XNUH 4GO6B 3IXTB 3QHZL 4WU7B 2D7TL 1MCDA 3JTTA 5AD0A 3GDBA 5CJ5A 5KSBA 2Q7YB 1YDPB 4XVTH 3GRWH 3OKEA 1B0WA 3RIFK 3IYLW 2AJVL 2UWEB 3CFEB 1BWWA 4UQ3B 3VRJA 5DT1L 3RWCA 3CFBA 5D1QD 3QUMH 2MCPH 2A1WL 3DRQB 2A83A 5J6HA 4YGVB 3VFPB 2BDNL 1U8MB 4GAFB 1EGJH 1UXSA 2R4RL 4X8JB 4LLVA 2J8UF 4ZFOA 5LGJA 1KULA 3WNKA 3BX7C 1NLDL 4Z7VB 1Q9OA 1S7UA 1HOCB 3C2SA 1OT2A 4D9QD 3G6DH 4LKCB 1PSKL 4JQXA 3ZSSA 1HI6A 3O0RH 3IJHB 3BYTA 5DLMH 3RWDA 5EU3A 1PFCA 5DI8A 1RHHA 5IW1A 3ARFA 3L3GB 1F11A 4FQJH 4TSAL 3RKDD 1INDL 3M1BA 3KXFA 4TSBH 3L7FB 5CCKH 1DQMH 4GMSL 3KYMB 3PGCB 4X0KA 4CVXB 1FVCA 1DFBL 3MV9E 3NIGE 5FYLE 3TZVB 1G7JA 5JW3L 4WWKB 1C16A 2O5ZH 2R9HC 3PNWA 4EI6A 4M6ML 3P4OA 4XNUL 1NCBH 1OT1A 2VZOA 3GK8L 4PJEB 5JO5B 2VNCA 4PY8J 4XCCL 4X4YA 4XVTL 3GRWL 5ESVB 1KELH 4NKQB 4IEFB 3KPSA 1W8NA 1GRWA 4QTHB 5IMMB 5SWQA 1AKJA 4LOUC 4GRWE 3SGDI 2B8OT 4I4WA 3TIDA 3BSZL 2BFVH 2HT3C 2MCPL 3DPBA 3QISA 2H2SC 1MFCH 5GGQH 1TQCC 1AGEA 1EGJL 1G9EA 5D2LA 1EEYB 2FZ3B 3JV6A 1BVLB 4UV4H 3GSVB 3QDMD 4ENEC 4LASH 1RURH 1XF4B 5E94A 5IG7B 4CU7A 5BOZG 2VQTA 3VFVA 4P4KB 4X5XB 3TCLA 2JCCA 2XY2A 4MWFB 1EBPA 1Q94B 1RY7B 1YPZF 3DX9A 4H26A 2QL1A 2QKIB 5DR5H 4AENA 1W0WA 4RGND 1MLCB 5DLML 4QNPE 3MCLL 5LCVH 3OXRB 5EOTA 4FQJL 4RFNC 4TSBL 5IF0B 5CCKL 5CJXA 2VXTH 3OGCA 4KJYB 4HMEA 2BCKB 3QULA 1U93A 1PW3A 4HMCA 1FJ1A 3MRFA 2O5ZL 2HMID 3HZMB 4JM2A 1HH6A 3VWJD 4ZQKA 4CJ1A 2DQJH 3EJYD 4PJGE 5ACMA 2EDNA 2WNGA 4Q58C 1NAKL 4U05A 3AREA 3T2NH 1KELL 8FABA 5IROC 5CUSH 4PLKD 2OSLA 2V17H 1WFUA 4PJ7A 5D8JH 1MRCL 2VIRB 3QSKB 3VI4F 1MFCL 5GGQL 4NO0B 4UV4L 1WIOA 5E6ZA 3SGJC 3BP7B 3IAPA 4UBDD 1OP5H 3HNSH 3I85A 1RURL 3EZ8A 3GMNB 5DRWA 3S37H 5I0DA 1ZS8A 4BQ9A 4G9FB 5IFAH 5ICXB 3E2HA 1EO7A 2GTWA 5BQ7A 5F7UA 3AS1A 2RFXB 2NNAB 1T5WB 4NUGH 3BZDA 4TULL 4LQFH 4QRUB 3V6BR 4APQA 3EUUA 2BOCB 2CO6B 5LCVL 3LQZA 5DRNB 1MCSA 3SGEI 1MFBL 2VXTL 3SJVA 3X13A 2IPKA 3LKNB 1FNGA 2E5EA 4OCSH 4JFOB 1A6AB 3UCRA 3IGAA 1KCSH 1HE7A 3ALWA 3KPRA 3NZHL 4QF1B 2EZ0C 5FYJH 2DQJL 3QDJA 2VXSL 4ZFFA 5I30L 3LQAC 3D9AH 4OGYH 2XWBA 1QTYT 2R69H 1DUYB 5F1IA 4JQXC 5D1ZD 2NXZB 1RJLA 4JJ5B 1D5XB 2P48B 2V17L 5K93A 2EECA 5E4IA 1I85A 3S35H 4F9PC 2C1PB 4JFYA 1AIFB 3G5VB 4MD5B 4N0UE 4BSJA 5MEND 3K46A 4YBQD 4O02L 4BSVB 1KUMA 1U8LA 5HHNB 1N6VA 1AO7E 3BZFA 4JFZL 3OGOE 3HNSL 2GSIA 5ESAA 4JRYA 2J4WH 3QT2A 1WZ1H 4MQTB 2ZCLH 3BXNB 2E6JA 3DURA 3GJFA 2G5BA 5IBUB 5IFAL 3JV4B 1JUFB 3QNZB 1ZVSA 4NUGL 1D6VH 4GRLB 5DURB 1YY8A 3G04B 4FN0A 4D3CH 4J3SA 2F53B 3KYKH 4LQFL 2E3VA 4K94H 4KROD 3BGAA 3GSQA 4GKSA 5HYEA 4G5ZH 1IC5L 4K71B 4U3HA 4XNXH 5F7MC 3W0WE 5IVZA 1S7RA 1SJEB 3QWQB 4KKNA 3MFFA 3DMMD 5DRXB 3ZT5A 1HIMH 1ZA3B 3TYGL 4LSUH 1AXTH 1X5IA 2BY0A 4JY5L 4OCSL 4Z76A 2UVEA 3ZKNC 2DMCA 1KCSL 3EFFB 2VN7A 4KTEH 3MLSH 1TVBA 1JYXA 1KYOK 2AJUH 2XY1A 5JNYA 3WHE1 2R69L 3GSWA 5KSAA 2VSDA 2QR0B 4P46D 5C9JA 5HI4D 4QHMB 4CL7A 4XBGA 5AEAA 3CAFA 2R1XA 4I5BB 1IC1A 1J05A 1NGZB 2A6IA 5E6ID 3VRLE 2GT9A 3QA3A 5BVPH 3PWVB 2AK4A 3M8OL 3O4OC 1ZHKB 5DQ9A 3RGHA 4G6FD 5CJXC 2I9TA 2GI7A 1WC7A 4X9IA 3G5YA 4N68A 1YYLH 1GXEA 3QFDA 2R2HB 2Z93A 4NQSB 5JHDA 1A3LH 2X1OA 2FR4A 1N7MH 3JV5A 3QEUA 3WKNA 5IB5A 4JM2C 4F7EA 3MRQB 5F6IB 2N1KA 3FHAA 4F7TA 4XTRD 2ZOKA 4K3HA 3OMZA 4ODVL 5IWLA 3KYKL 5B22A 3WEXB 3BUYA 3AREC 1LVEA 4K94L 1EFXA 4LNVA 3DRTB 4G5ZL 5C2BH 4MA8H 4XNXL 5I75B 3VJ6B 5E00B 1ZA6B 5EC2B 1H3UA 1JNHB 3TBSB 3SEPA 4FMFA 1M7XA 3B3IB 3TFKD 1N5YH 2VLKD 1UYWL 2DQUH 5ITBH 1AXTL 3JWOC 2XQBL 1YEHH 4P9MH 1PY9A 4OF0A 1KPRB 3W2DH 2G75A 5IVXA 1NMCC 4KTEL 2QADB 3MLSL 3CJJA 3C8KA 2AJUL 1MQ8A 2Q86A 4F3FA 4HUVB 3TLRA 1TVHA 4ZPVB 2HFGH 3C09C 3E2HC 4PREA 1X7QB 3GIVA 3ZO0A 5TDNA 3I75B 4L5FH 2HVJA 4KPHL 1QYGH 3TVMB 2X4UA 4R7NA 3CZJA 2Y36L 3RX7A 1PJ9A 1RAMA 5JLZB 4ODHL 3T3PF 1YYLL 4U1MB 4QRQB 2VC2H 5D7LE 1YN6B 2PCPA 4OF8A 1A3LL 4XI5C 4BQ8A 3QG7L 3VWKD 3GSNH 4LLMA 4TUOA 43CAB 5ESQA 4XBEH 1RZ8B 5J89A 1KTDA 4KI5C 2YUZA 3EZJB 3R8QA 3IVKB 5KVEH 5CEXB 5C2BL 4OJFH 1OGTB 4ELKA 4K2UH 3K80A 3H0TA 4L4VA 2XFXB 1I85C 5ALBH 4X7TA 1PYWB 4YHIA 3NFNB 2NYYD 2IBBA 2NQCA 1U95B 3GHEH 1RK1B 3OKDB 1TZGL 1N5YL 3QR2A 4D9RD 1MJJA 4MCZB 1YEHL 4M62H 5CWSA 4RMSA 5IBTH 4XAKE 1KCRH 2Q1EA 4ODUA 1JZ3A 1G0DA 2IADA 3EDKA 2H6PA 3UPCA 4N8PA 5CD3A 3DARA 2HFGL 1I1CA 2FECI 3R0NA 4YEFA 4FHBD 4Y5XA 3T1FB 2VE6B 3QQ3A 1INQB 4L5FL 4X4ME 1ZLVH 1S9KC 1QYGL 1ZSDA 2OL3A 3MJ7A 1YQVH 2XWJB 3TBVB 1IGIL 2D0FA 3F58H 3DUUB 3WUWG 1KJ2H 3BIAX 3RIAK 1DTUA 3RP1A 2DM3A 1K85A 5CGYD 2KQMA 3NCBB 3K8LA 1AGDA 1CFVH 4PV8A 3PHQB 4HAFA 2CKBH 4LGPB 5AYUH 3MBEB 3GSNL 3GMQB 3KPMA 1MCNA 3SDCD 3E8UL 2VDKH 4TUKL 2WK2A 4XBEL 4D0BA 4GQPH 3IF1A 2NMSA 2RGSA 3WD5L 1A1NB 4YDJB 5KSAC 5CZKA 3SE4A 1KIPB 1ORSB 2Z4QB 3QUYD 3H9ZA 1DBJL 1ETZB 3R06A 1JGLH 4K2UL 1ES0A 3B9AA 5BV7L 3QO0B 2VISB 4MJIB 5DMIL 1MUJA 5ALBL 5J6GB 1CTNA 1Q72L 4JPWL 5DEZA 1FNEB 2FGWH 3GHEL 4IDJH 4I18C 2EDRA 4PGBB 1B0RB 1BVKB 1ZHLA 2PYEA 3B9KB 4YHNA 1UWEH 1H8SA 2QTEA 4M62L 1ND0B 5IBTL 3X3GH 3UDWA 2XN9E 4MAYB 4P2OB 3ULUF 1FFRA 2JTDA 1TZHB 2AW2A 4DTGL 3CZFA 4WWKC 2AERT 4X80H 2OYPA 2YUXA 4WTXA 1NUGA 2VXVH 1G7MA 5E2VL 4NFBA 2ZCHH 3RUGE 3L3JA 4RQQA 5IWLC 2DLIA 4JRXB 1R3IH 4Q0XH 5C7XH 3MUHL 2W07A 3FO2A 1YQVL 4H1LB 3U7AA 1NGWB 5C9KA 3F58L 1KJ2L 5JDSA 3D18A 4PTTB 4FQQB 4CN4A 1F3JB 1EX0A 3FQUB 2CDEA 4ZUWB 1H3GA 4MXQA 3S96A 1CFVL 3F7PC 4FP8H 2CKBL 1R0AH 4IDLA 3R4DA 1G7PB 3U36B 2VDKL 5D1QB 4YR6B 1VENA 2K7QA 4YJZL 2IMNA 2PNDA 4KKCD 3RL2A 3BO8A 3QIBC 1NFIB 4X6BA 4MNGA 5E0QA 1JGLL 1B2WH 5INDB 3DX7B 4PRDA 3GBNH 2EH7H 5JORA 1XIWD 1QFOA 4O2EB 4IHOA 1IVLA 3P2TA 4GBXD 1XFPA 2FGWL 5EU7E 2HH0H 5EBLA 2BSRB 3MNZA 4IDJL 5L9DH 3CDYA 3QJHA 3RJDA 5A40E 1CFSA 1RUQL 4OTXH 1WIUA 4ODSH 1AP2B 1S5IH 2CLVA 3MROA 3WV0A 1JWSB 3NABH 5E7BA 4CKVX 3NAAL 1J8HA 2ZCHL 3ARDB 3GB7A 3STLB 3GJFK 1R3IL 4Z7UF 3WFHA 3WFBL 1TMCA 5C7XL 5FKPB 4NM8H 3CXHJ 5J1AA 3SY0B 1JI1A 4FXLA 4MA3B 5J56B 4R3SB 5C92A 5HDOA 2A77H 4PYHA 3KPOB 1FZJA 3CC5B 3U0TA 3JWDH 3GMPA 1MCBA 4U6XB 4JO2L 3S3JA 3T65B 3L3IA 4FP8L 2JJWA 1CDJA 1QQDA 4YHPB 1R0AL 3VFUA 2AV7A 2FIKA 1FBIH 1Q9LA 1AH1A 4ZS6C 2D0HA 1V5JA 3MRRB 5E4EB 1AHWA 2EDLA 5ELIA 2QHRH 3F5WA 4JO1H 1H5BB 4G8GA 1AD0A 3ZL4H 5E8OB 4POUB 4R90H 4QRPA 4Y5XC 4WTZG 5C6TH 1FRGL 3L3KA 5IHUH 3QDMB 3RWEB 3D39A 1U6AH 3GBNL 2BY1A 2EH7L 4OBRA 1E6OH 1CLCA 3WS3B 3G6AB 2Y6SC 3CFDA 1UWXK 1L6XA 4ZO8A 1N0XH 1T7YA 2XACC 3QWOA 1T1ZB 4ODWB 1I7UA 1T6VN 3ZYOA 3RRQA 4OTXL 1N3NA 2GK2A 4HWZB 1S5IL 2VSCA 4NQCA 3QZWG 1D9KD 4EI5A 3NABL 1X5XA 4NRYB 1LEIA 1YEKH 5C0CD 4LVNC 4KRPD 4NN7C 4DVBB 4PJXE 2APTA 2CKNA 4WFEE 4UTBH 1R3JB 5K9OA 3LHPH 1CLOH 3HAEG 1KTLB 3DUHA 5FYLH 3LN5B 4FQLH 3I6LE 1RZIA 1QP1A 4F37K 4J3XA 2A77L 2RCSL 4XPBL 1JJUA 3JWDL 4N0FB 4MCYA 2EKSB 5HYJD 1BJ1J 1ZEAH 5D70H 1C7SA 1FBIL 3BPCA 3UDWC 4BQCA 2XQYG 1DQLH 4X6DA 1FG9C 1XF3B 1U0QA 4MVBC 4KK5D 2QHRL 3HMXA 3CUPA 4JO1L 4ODTH 3ARBD 1T20B 3MUZ1 3ZL4L 5DS8B 4PRPD 4R90L 2ED9A 3ZKMC 5HI5C 3SDAD 1F6FB 1U36A 4XVSH 3KHQA 1LP9E 3JTSA 1QBLH 5I16A 4MNQE 2WIIB 2LVCA 2B2XH 1F2XK 3VCLA 1GGCH 1N0XL 5AWNH 2VITA 3F7QA 4V2BA 2BNQD 1A1MA 5HHOE 1HH9A 4TOYL 4KJQC 1YEKL 3C08H 5E1AB 5GGSA 3QFJA 3EW3B 1XGQA 1ADQH 4UTBL 4N90D 5GIRA 1R5IB 3CLEH 1C5BH 2R15A 3E1F1 3LHPL 4XH2A 5L2KA 4HK0A 4YO0B 5FYLL 3U4EA 1GZPA 1MJUH 4OZGE 2XNAA 3PQYA 4FQLL 1GGBL 3T08A 1UB6B 2I24N 5KAQF 5HJ3A 3PJSA 1FYTB 1A0QL 4HUNB 2GITA 5F9WC 2F74B 1SHMA 1EBAA 1QFUL 3D1MC 2FEDD 3KLDA 4G43B 5DVMA 5LKNA 2VR4A 1EMTH 1ZEAL 3IS1X 4J3WA 5D70L 3PWJA 5JW5A 1L7IH 1P9MA 1CGXA 4D8PB 4RWYL 1CVSC 2B5IC 5I9QB 2YD3A 5L8KB 1DQLL 4K23H 1D5MA 4ODTL 3OHXA 2ZPKL 3P9MB 4O2CB 3FRPG 1TZIB 5I1DB 4G3YL 3MYZA 3IJSA 3D25B 1N5AA 2GK0A 1BQSA 3K4ZA 4XVSL 1FPTH 3UO1H 2DIJA 2IAMB 1S5HB 1QBLL 3O3DB 5FHBH 5F70A 1GGCL 1YMMA 4V2CB 1MCIA 5AWNL 4NNYB 5E8PA 2UZIH 2Q7NA 1ZHBB 4TSCH 4UAOB 1LO2H 4KROB 5L7XL 1NL0H 2MKWA 3C08L 4KVNH 3MZGB 3QUZD 5INCA 3SOBH 4A6YB 5JOPD 3WL9A 1AHWC 1XH3A 4Y5VB 4L9LA 3CLEL 3DMMB 1SMAA 4YX2L 5KSBE 3MLZH 5A2FA 3E6HB 1VEOA 1IEBA 1MJUL 1MI5D 4XC3H 25C8L 1J0KA 2DLHA 1UZ8B 3FRUA 4HIIA 4OUOA 3EOTH 1RZJH 4NYLB 2J6EH 1OPGH 1A5FH 5D6CA 5CIPB 5F7HA 3T2PA 2DWDB 5FF6A 4R2GC 3X3FL 5EN2A 3EDJA 4GW1B 4P46B 5CZXC 3T0EB 1I1AA 1L7IL 1QSFA 2QQQA 5H2BA 1S78D 3FZUD 4MS8D 5E6IB 5HY9B 2X1QA 1W72A 4MD0A 2CXGA 3AS0A 4NUJA 3HMWH 3HCVB 2AK1H 3I02A 4WUUA 3TPUA 4PJ5D 4OGXL 5DMGC 2BVUA 2D03H 4Y4KA 3U0PA 1FPTL 3OKNB 3OR7B 3LN4A 2DBLH 5IJKC 1U8OB 3I2CL 4ZUUB 3O41B 3I6GB 4JHBA 1WZMA 3KXFE 3F12B 2UZIL 1AGCB 3F7YA 1X3DA 5E2UH 4U6HB 4XVUD 3HR6A 4TSCL 2IANB 1LO2L 4QGYA 3OQ3B 3KLAA 5I8CB 3UPAA 1NL0L 2XV6B 4KVNL 3SOBL 3RTQD 2CLRA 1SYVA 4PRID 4LAQH 3CVHA 3HI1A 4MQ7B 3VD3A 2ADFH 4R7DA 3CPLA 4HUKB 4BH7A 3WHE0 1MNUH 3MLZL 2VLKB 4M1CC 1OAYH 1P6FA 4X6EB 1NGYA 4XC3L 3BP6B 3KPSE 4QYOB 3NH7H 1FIEA 3EOTL 2WLZA 1RZJL 2J6EL 1A5FL 2FCBA 2GFBA 2W9EH 1BGXH 4QXTA 4PJ8B 3L7EB 2IFFL 3PABB 4F33A 1UQSA 5TH2A 3QPXH 5EO0A 5D2LE 5MERB 1IGFL 3GSUB 4J8RA 1E27B 5C09A 4CADA 1QLFB 3ESVF 4DKAA 3HMWL 1NCNA 1H15A 2AK1L 1BM3L 3BPNC 1OTTC 5CGTA 3NCFB 2VDOH 4GG6A 2JCCE 4P49A 3G5XA 4OGAC 4HUWA 4AIZB 4EDWH 3U9UB 3DO7A 2DBLL 5KOMC 5I1IH 3V6FA 3VWKB 3BD4A 3TF7A 3QNXA 1DE4B 4AT6A 5HGBB 5DJYA 4HV8B 5E2UL 4HBCL 1VADA 5KSUB 4YE4H 1P9MC 4P5TC 5C71A 5GS0C 1YNTB 3HG1D 1DLHA 1A7RH 2ADFL 2DM2A 2VLJD 3O2WH 2EDJA 3DVIA 2F5BH 4P4RB 1MNUL 4MHHG 5GRUH 3HE7D 3MGTA 1QEWA 3BHBB 1T2QL 1G9NC 4KZDH 2FD6L 1E0OB 5FOJA 3NH7L 4TUJB 4PJ7E 1BFOA 3HA0A 1ZT4A 3U1SL 2W9EL 1BGXL 2X4OB 1B4RA 3LD8B 4LLDA 5FO9A 4G8EB 1CDBA 1KIQA 5EIIB 4UNTA 4OLVH 4YHZH 1JIBA 3VXTA 3WN5B 1CT8A 3O81A 1MHHA 3FFCA 4Q6YA 1MCOH 4NWTH 7FABH 3WDJA 3LB6C 5IEKB 3J8F7 3MXVH 4JG0L 3P9LB 4EN3D 4EDWL 2YZ8A 5K9KA 1JRHL 1L4IA 5I1IL 1QA9A 2APXA 1AR2A 2NY2C 4YDVB 4R4BA 5KZCD 5EULV 3SDCB 1H3WM 1ROWA 1R3LB 2G9HB 3SJVE 4ZXBD 2FH6A 3DXAA 3MNWA 1YC8A 2X70A 1YEFH 4HIHB 2APWA 2OZ4H 4NSKA 5F7NC 4NO3B 3BAEL 1HQ4A 4HCRL 3CSGA 4YE4L 4HC1H 1I1AC 3BDXA 4FQXA 1U8KA 4P2QA 3KPRE 4X5LA 1WCQA 3WFDH 2ITCB 4JJHA 4I2XE 3ULSA 3H9SA 3QDJE 5FYKE 4HKJB 1J7VR 2ERJB 1MPAH 4OZ4B 4RDQG 5GRUL 2CUMA 5EBMA 1TQBB 1QLRA 3QDAA 1F3DH 4KZDL 4Y4KC 3LSOB 3SE9H 1VGKB 3I6KB 4R8WH 3LKQA 5F93C 3D2UB 2VWEC 2JK5B 4MA1B 4WHYG 3TA3D 5DUPH 3WFCL 1TJHH 3TYFB 4ODXB 4PDCE 3HUJB 4NHUB 4OLVL 1JNJA 4YHZL 3O8XD 4JRYE 3EIFA 1M4KA 2AQ3A 1A9BA 2JB6A 2X2YA 2IEPA 2HLAA 3TCXA 2Q76A 5J3HD 3IDNA 4MJ5A 3FL7A 3MXVL 4YDIL 4PG2A 1DUZA 5HDLA 2AXFB 1V3KA 1FL5B 5JZ7D 2E8YA 3S3SA 1DN2A 4NQEA 2FATL 1W8OA 2CMRL 3KG5A 3QO1A 5EFIA 2DYPA 3CH8A 1LEKB 1CFQB 1QFHA 1NEZG 3UYRH 4XZUA 3UZEA 1MCPL 2Z0BA 4F15C 2RQ8A 4PRHD 5CP3A 4PD4J 3AS2A 4HC1L 1C5CL 1FV1A 3RWJB 3WFDL 1XIWB 2H32H 4S1SL 5JQ6L 3IU3A 4GBXB 4S2SA 2J5LB 3RVXC 3IAQA 5BVJB 4JFXA 1MPAL 3QNYA 3GO1L 4LEXH 3UBXI 3QUXD 3LKOB 3ARGD 3BJ91 4I48B 1OM3H 4P48A 1S7QB 3WO4B 4RRPG 2AK4E 4R8WL 5HDBE 3FAWA 4HUXA 5K59E 3TF7C 4EIZC 1FGVH 2NY1C 4HH9B 1N4XL 4XBPB 4HWEH 5DUPL 1IL1A 5C0BE 5C0IA 1EHLH 1TJHL 4RFEA 3K2UL 2EE2A 1KNOA 4NKMA 5JHDE 1EV2E 1ZWIA 3B43A 5D5MF 1EIBA 3SO5A 2R8SH 4DN4H 2AJZA 3VXMD 4F8TA 5B38A 2CIKA 2LVEA 4IS6B 4MXVE 4PJFF 4OUUB 4LCYB 3SDXB 4HLJA 4WRLA 4C56A 2BY3A 1WBZB 2NTFA 3GBLA 3O4LD 4IOIA 5LAXB 4XNMB 4C4KT 3UYRL 5C07D 2W0FA 5DGQA 2A6DB 1UM4H 4RMVA 4K3DH 4GKOA 1GGIL 5F97E 5B8CB 1EAJA 1MFAL 5IMLA 3RQ3A 1DQQA 4AEHH 5B39B 1Y6NR 3TGXA 5DF0A 4JPKH 5AAWA 5IVXE 3L9RB 1AE6L 2Z35A 2NZ9D 3C60D 3FAXA 5MI0B 4XC1L 4LEXL 4Y4HD 1NGPH 1NDGA 1T0MB 4F8QA 2FWOA 1ZT1B 4YNYB 1OM3L 3QDGD 2V5RA 3P73B 1TDQA 2JELH 2D4DA 3BIBX 3NN8A 4FZ8L 3FOLA 3ULUH 1FGVL 4KRPB 2DQDH 1LE9B 3DVGA 2HP4A 4HWEL 2Z31D 2YKLH 1EHLL 5DRZB 3CSBA 1S7XA 1NJ9B 2ARJB 1NFDA 2OJEA 5HYSB 4FQXC 1IZKA 1VFAB 5MEPA 2R8SL 5AZ2H 4NJAL 4OB5H 4H0GA 1O7SA 2VJXA 2VR5A 1JGUH 2HJFB 3C5ZD 4DCQB 5HYJB 4Z7UB 2IH3A 3WXWH 4LAJH 1TITA 1T3FB 1SJHA 1UCBH 4S0SD 1GJIA 4L4VE 4LMQE 1QR1B 1DANT 3QRGL 4IMKA 3ARBB 1S9YB 5C0FA 1MCKA 1DDHB 4K3DL 4PRPB 3VG9B 4WW2B 4KGJA 1N59B 2OLDA 3SDAB 1SJVA 3C6SA 4AEHL 2BJMH 5AG8A 1T0PB 2P8LB 4JPKL 1UADC 1HEZB 2ESVB 2Y5TB 1A4KA 1T89C 4WJ5A 5CBEB 2GCYA 5A2JH 4L3CB 1CL7I 3U6RB 1G7HA 4PG2C 1EA9C 2BNQB 4JPVH 4HFWB 3EJZD 1T6WA 2WZPD 3Q5TA 3HC0A 2JELL 3GRWA 1B88A 2ADIA 2V9QA 3ULUL 3QWRA 3IFNL 3DV6A 3Q6FB 2NY5C 2PO6B 4KXZH 4LQ1A 3HZVA 5DD3H 2BVYA 5E8EA 5FK9A 4K3EH 4KQ4H 3QUMA 1WFNA 2FYYB 4XAWH 4ELMA 4KUZL 1WISA 4JANB 2CDGA 5K33A 1EGJA 4FQCH 3VA6A 3O3BB 2VABB 1J88A 4WHDA 4OB5L 1UXWA 4ZUSA 4G6JH 4NPYB 1CXIA 1JGUL 3LDBC 5H35A 3T1WA 1LO5A 3VRIB 2DKUA 3TEUA 1QRNB 3KR3H 4GSDH 2C9AA 4P3WA 5DJ0B 2FX9H 3GMLB 4X83A 1WWAX 1FFOB 2JJTA 3VD7A 1X5GA 2WM0A 4U6VH 5GJSL 1IEHA 1YEDA 1TIUA 1HHJB 1KLGA 1IAOA 2EIZA 4DKEH 4DZ8A 1G7IB 1FCCA 4BH8B 1FNAA 2PYEE 4J12A 4MQXC 5C0EB 1J87A 1G9MH 2HTLC 4GOSA 3EJJX 4U1NA 4CDGC 1AXSB 1JPGB 3LVEA 1CBVH 3QH3A 3MRMA 4L4TD 4PJBF 2EC9T 3B9VA 3VMOA 5EZOL 3NGBC 2DJUA 4KK9D 2UWEA 4Y2DD 1FORH 4HEME 4JPVL 3EYOA 1JHTA 4OM1H 1IM9B 1Q38A 1VEMA 1B0GB 3HI6L 3DRQA 5C8JB 2UY7A 3QUZB 3MRCA 4OZHF 2MPAH 3W0WD 5DD3L 1ED3B 1WAAA 1AXIB 3RI5K 1NKRA 4K3EL 1SM3L 4KQ4L 5CEZE 1G6RL 1PDKA 4XAWL 4GFTB 2BVEA 1MI5B 1BOGA 3UC0H 1A3QA 3Q1SL 3KPNA 4FQCL 4HX1B 2X4QA 4OGZA 4LKCA 5BXFB 3V4UH 4C4KO 4W4OA 3DECA 4H5SB 4Z95L 4DGVH 2DJSA 1I9EA 4G6JL 5I73B 3FOMA 1EEZB 3QZWB 5GGUA 5ANMA 1F3DJ 2DKMA 1D5BA 3OTTA 4JN1H 3L3GA 4MNGE 3ZT6A 4GSDL 5IFJB 2FX9L 5C0JA 3EYSH 4QRSB 1U92A 3L7FA 1PLGH 1I7ZB 3PGCA 5DK0B 4FS0A 4LHUA 2E6QA 4ZTPH 4XX1G 3HAEB 4U6VL 4FG6D 4DKEL 4LLAA 5IIEA 1CICB 3DSFH 5TE4H 3HE6D 4AL8H 1G9ML 2ZCKH 3TN0D 5HYQA 4PJEA 2KZWA 5GZOC 3KAAA 3S5LG 1CTOA 4GJTB 3BWAA 1J8HE 5HHMB 1FORL 4JE4B 5EUOF 4OM1L 3ZDXE 2OJZH 4WW1B 3MPCA 4PLNC 4JHZA 2R2CA 4Y2OA 4ZYKB 5DJXA 3RTQB 3WMSA 2MPAL 3I9GH 2C7UA 4PRIB 4L8SC 4PRNA 1OB1A 5CEYB 4IMKC 3O11B 3FFDA 3DBXB 5IJVA 3MV01 3VGBA 3MJ8B 3FN0H 3OAUH 1C7TA 3V7AE 5HD8D 1MWAH 1CDYA 4ONGH 5D7JD 3UC0L 2YC1A 3SN6N 4QT5A 3L5XH 5DFVD 3H3PH 1UH3A 3L3OA 2H9GB 3V5DB 5C3LD 1U8PA 3IDJA 1LD9B 4HHAB 5A3ID 1K5NB 5EZIL 4G8GE 1YY9C 3BRFA 2B0SL 4S1DD 4P23C 1RJZB 4W81A 8CGTA 5L8JB 4QRPE 1FVEA 3TESA 1U9KA 5HVHC 4YBLC 4MD4A 4AEFA 5IF0A 4CNIA 3MRNB 3SGKA 2IALA 3D39E 4NKOA 1OP3K 5DD5H 5GRZA 3C6LA 4ZTPL 4LPYA 1BIIB 3K1DA 3DETD 1DBMH 4BA8A 1BP3B 1WCBA 3DSFL 2P7TB 2C3VB 3VGAB 3HZMA 1M7IA 3LV3B 4I8DA 5DYOA 2ZCKL 5GGVH 1HSBA 4PJDB 4NQCE 1R3HA 5CFHA 3IDYB 5IKCA 5EORH 2YD6A 3VH8G 3MRJA 1J1OL 4JPIB 3NCYS 4H0IA 5BOPA 2BHUA 2OJZL 1KCVH 2VIRA 3MLUH 1FVDA 1WBXB 2DF3A 2JJTC 3TT3H 1AI1H 3GUTA 3HG1B 1KIUA 5F88A 3MV8E 2VLJB 1RFDH 3V5HA 5GGRA 5CSBA 1GHFH 3FN0L 3P11L 2DI9A 1MWAL 3HE7B 2P8PA 3N1QC 3L5XL 4KDWA 3H3PL 3CU7A 4FXGA 1LEGB 4ZNCD 2RFXA 4X6DE 1T5WA 1H3TA 4M7ZC 4QRUA 1NGQH 2JB5L 2BOCA 2EIEA 4WU5A 1TCMA 4JDTH 1C12A 5I74B 4ZFOL 2HKHH 2P8MB 4KKAC 3WO3B 1KLFA 3S34H 5DD5L 1JN6B 4QHKI 1AFVL 4LSRH 2ZUYA 5L2JB 1DBML 3LKNA 2GAZB 2MWCA 3FB7B 2W0PA 4WHTA 1W0YT 3P77A 4G42A 2Y7QA 3KJ4B 1FL6B 4EN3B 5AZEH 5GGVL 1S7TB 4M9OA 3GSRB 1KOAA 2VDLH 4CBPA 1BJ8A 2YBRA 5EORL 5C08D 1D7FA 5KZCB 1BF8A 4JR9L 4LHJB 1D5XA 2PETA 3QFJE 1KENL 3RAJL 4ZXBB 4M3KB 3SKMB 5FECA 5DQJB 3EDDA 4V1DD 1KCVL 5L2KE 3DIFB 3MLUL 1NBZB 2ICWB 3G5VA 4HKXA 1RQ5A 3E0GA 4MD5A 5I1EH 5E8NA 1KGCD 5IMKA 3TT3L 2BNUA 2M2DA 2BVTA 1AI1L 1DANU 3QCVH 1OHQA 4JFDA 1F58H 3VI3E 1RFDL 4PV9B 4C59B 2J12B 3WO4C 1GHFL 1BX2B 4KK8D 3FO9B 4S1QL 3A6OA 1ZKAA 1UENA 2P5ED 3SGDH 3W82A 5E95B 1YYMH 2DIBA 4GRLA 5L6YH 3T77A 3CH1A 3ALXA 3KWWA 1EH9A 1F13A 1FQ9C 5F7DA 1NCAH 4G7VH 2IG2H 4JDTL 5JDJA 3TA3B 3AS3A 2GUOB 1SJEA 1MRDH 3UTTA 3HZYA 3QQ4A 2P43B 4LSRL 1VKXA 4TNVK 2N7BA 5CLWA 1R5WB 2XXCB 3MJ9H 1ZA3A 3QXUA 4WFGE 3RHWK 1QPPA 2R0KH 4CN1A 1K2DA 3PWUB 1YMME 3VD9A 3BZEA 4J3OC 3SKUD 2NX5A 5AZEL 1V05A 5F9OL 5DJ2B 2IGFH 5K9QI 1HSAA 2VDLL 4OIIH 3V4PH 2XZCH 1C1EH 4LSQH 1ERNA 1NAMH 2AEQH 2QR0A 3RDTD 4QHMA 4M4RA 3B2UD 1FIGL 4PBXA 4I5BA 1I8MB 1O5DT 1YNKH 1T80A 5JPNB 4IOFC 3IDMB 1ZHKA 4LSTH 1KJMA 1VERA 5I1EL 3U30C 1ZTXH 3SGKC 2ID5A 1SYSB 3QCVL 5T33H 3EO9L 6FABL 4KK6C 4HJ0C 4HPYL 3C6LC 5I1LB 2R2HA 2V9TA 4LGRB 4AG4H 1JBJA 4NT6A 4Z7WF 1WBYA 2XZAL 4X6FB 4XVJH 3FONB 3QUXB 1CU4L 4JFFD 2QV2A 4JB9H 1AD9B 1QSFE 3ARGB 2EC9U 1CGYA 2EDXA 1YYML 4EQ3A 5L6YL 1JVKA 3FMGH 2V7NB 4QLRA 1TXKA 4LIQH 1BFSA 5KJRL 5IK3A 3GSNA 2IG2L 4WUUE 3TPUE 4LF3B 5FM5M 2NY6B 5E00A 2V2XA 1ZA6A 5F44A 4N8CL 2K7PA 1MRDL 5EC2A 4U1KA 4YK4C 3ECBA 4RBPH 1QR4A 4ETQA 4WI6A 1FN4B 2Y72A 3ZKXC 2OR7A 2VWEE 5MHSD 5GRWA 3UZVB 3EBAA 4DGIL 5ERWB 1KPRA 2UUDH 2O5XH 5D4QA 4PS4L 1U3HB 2IGFL 5T5NG 4HUVA 4WI8A 4OIIL 1C1EL 3T0AA 4LSQL 4YXKL 3BD5A 3SGEH 2AEQL 5FDWA 2JIXA 4GRWB 1LP9F 5C07B 2KH2B 2FSEA 1YNKL 4KMLB 1OAQH 1A9EB 2V5MA 5TFSH 2MHAB 5ICYA 4GXUM 1O0VA 3GIZL 4LSTL 3ZHKA 3G5ZB 1A1OB 3VXNA 1XCTB 5SX5H 2VLRD 5JLZA 1P53A 5T33L 4ZAKC 4U1MA 1A7NH 4QRQA 1YN6A 4K94C 1MEXH 5DMYA 1WUNT 2MQCA 3IDIA 3HLAB 3K4DA 3J7HA 5TDOA 4P5MB 3B9EA 4LSSL 1KJ2A 5FYKL 4Y4HB 5IM7A 4N0RA 2X4SA 1UVQA 4MNHB 3T3MF 1P84J 1UGNA 4JB9L 3GI9L 5C09E 3ULVE 3VFSB 1JGEB 4UUJB 3CFCH 2CKBA 2AXJA 4HIXH 1XGUB 4PJIA 1MF2H 3D0LB 1OGTA 4YHMH 4ZO6A 2Z31B 2V7HB 4GG6E 1I7TB 3L5IA 3N06B 1LQVA 1PYWA 1JZ8A 4X6CA 5CMAA 4OFYA 1C08B 4JREB 5GQBA 4MCZA 3IKCB 3ARPA 4UILH 4CMMB 2VDNL 1IM3B 4U1HA 5IHBA 3C5ZB 4KV5F 2D31B 5BS0A 5ILTH 4LEOA 3CDGA 4PLJC 3SO3C 2R9HD 3MRBA 4ZO7A 2VE6A 5T5NF 2OM5A 5EOQL 2E9BA 5EZLB 4NQVB 2I9LA 1SBBA 5DMJB 3CSYB 1CQYA 4RGMB 4UDTB 5GS1A 2JF1A 3TBVA 1OP5K 1QSVA 3EGSA 2WAHA 3DUUA 4G8FA 3O3AB 4JZJB 4XB8A 3WFEH 1T83A 3VFRA 2AJ3B 4RA0C 5E2WH 4LOUD 3PHQA 2HT3D 2H2SD 4GAGH 3GMQA 3BRDA 1UM6L 4OCRL 4LLUB 1NEZB 4RSVA 4U3XA 4UNUA 4XXCA 3PDDA 4Y19D 4YDKH 2DD8L 4FQ2H 4CU6A 4L8BA 3RVTC 3CFCL 3EYVB 4JLRB 4OZIA 2F5AH 3FFCE 3LS4L 2W60A 4HIXL 1MF2L 1MCRA 1ORSA 2Z4QA 5HDQH 5FUOL 1ETZA 2EYSA 1IT9H 4YC2B 2VISA 4E0RB 3M07A 4XGZB 5E8DH 3TH2T 1P5UA 3ERYA 2J8HA 1PY