4L8CA

Crystal structure of the h2db in complex with the np-n3d peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 275
sequence length 275
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8cA01
1AC6A 5HDQL 3GBML 1MFAL 3O6KH 2BOCA 3WE6B 5HDBE 3EO0B 1D5XA 4OZHA 4Q9RL 2EEAA 1QBMH 4XMLL 1HNFA 3KG5A 4RWYL 4UQ3A 4OT1H 5IJKA 4TSCH 3QIWA 4POYA 1EK3A 4HWNA 4FZ8H 3VFPB 1MI5A 3GHBH 4NO3A 1I7ZB 1CR9H 4LLMA 2BSTB 5CJQH 5IFAH 5CJOL 1DCLA 1BX2B 1HH9A 4U7SA 3TFKD 1IC1A 2NY6B 1RULL 2EIZA 5CIPB 3AGVA 4MJ4A 3RHWK 5KSBE 5CP3A 4RWHA 3SE8H 3V5DB 4JQVA 5HYJB 2IADA 4ZODA 4WUUD 3IDGA 4O2EB 4QWWD 2RAMA 1MCPH 5J1TC 3MRDB 2N7BA 2W38A 3GSRA 1KFAL 1QLFA 5DF0A 2OR8A 2VAJA 4OZHE 4M7JH 1NCCL 4TQEL 1IFHL 1XIWA 4HC1H 5CMAA 4PJ9B 1R3LA 5KSUB 5EB9A 5JPNA 1OM3L 4YX2H 1JV5A 3CC5B 4H88H 1FRGH 4PGZA 3VFSA 5JMRA 5CCKH 3U0TA 3S35H 2DI7A 4DK3A 3PGFL 3T4YB 5ACLA 5MEQB 1RUAH 1SHMA 3KPRD 4NUGH 2A9ML 4CW1B 4MA1B 1LEKA 4HHAB 4OF6A 4JHWH 4JKPL 1T3FB 4MNGB 1K85A 4QTHA 1WTLA 4JRXD 1A6UH 5IQ9A 4N9OB 3BJ91 4M03A 1LO2L 3W81A 2NY0B 1TJGH 35C8L 4FQ1H 1MCRA 4L9DA 4OZFG 5DK3A 3OGCA 3W2DH 4NZUH 3QQ4B 4OLYL 1AFVL 3PG2A 4QHLA 2FJGB 2Y5TB 5DRNA 1VGEL 4XVJH 1XCTB 2ATPA 4X7TA 2PYFA 1JNHA 4TNWF 2X44D 4R97B 1A7QL 1RY7B 4FFYL 1QSVA 5IM7B 1NBYA 1MJJA 5DLML 2R2HA 3QPXL 5FKAA 2P24A 4OGYL 1IEAA 2GIYA 3MLSL 2ZOKA 4X6EA 5IB1B 3D2UA 4OIAA 3ARVA 4KQ3L 3JWOL 3LPGA 3WXWH 2X10A 5D4QA 4PJ9C 1U8QA 3CSYA 4D9LL 1MCKA 3LPWA 5BZWB 1T0PB 2GFBB 3OQ3B 4ACPA 2CKBA 3DSNA 2E7MA 4XT1C 3O6KL 4HIHB 1J5OL 2R0ZL 3KYMA 3GIZH 1F45A 3KLDA 2R0LL 1WBXB 4AL8H 3HUJB 1BZ9B 2X1QA 2V5MA 3O9WB 3PGCA 2AJSH 4ZNEE 3NABH 2XWJA 4K2UH 4O58L 5T5FH 1K8IB 3PUCA 1CR9L 1CGUA 4KKCD 4MA1C 3ZTNH 1GGUA 2AEQH 3DYOA 1T04A 2YD2A 1A6TA 5CWSA 5HGAA 5ID0A 3SY0A 3UTQB 3B3IA 3E8UL 2AP2A 4LCYA 1BQLL 4ISVB 1QEWA 4KK6C 1DQLL 2EDQA 3IFLL 2V7NB 4R97C 1Q9KA 3CLEL 3VXTA 1T21A 3FQNA 1TCRB 4NT6A 3HCVA 3RL1A 1P7KB 4ZO8A 5GSRB 3TBVA 4N5UA 5D7IB 4LVHB 3S96A 1JNLH 3BGAA 4XRCB 3MA7B 1GH7A 2LU3A 5ICXA 3GKZA 4CN1A 3QO1A 5CBAA 4QT5A 3HLAB 3CFEA 5T1KB 1GXEA 5FO7A 1KBGH 3P2TA 3CXHK 1RUQL 2NY4B 3WFCH 2O26U 3AY4A 5CCKL 4LHUD 2YUVA 4XNUL 1FQ9C 3BOVA 2BVUA 4EI5B 4YJZL 2GSGB 2WLZA 3WD5H 4ZFGL 5JW4M 1HE7A 2GK0A 2LE9A 3RJDA 1LNUB 1AR1D 2G75B 2NX5D 5SV4A 2XZCH 2EECA 4FQCL 1AP2B 1V3JA 4LEXL 3DO3A 4JHWL 2Q1EA 3O9WC 3QJHA 2P1YA 1A6UL 2OI9C 4NGHH 2NTFB 4LSUL 1U92A 3DV6B 1Q9OA 1P2CB 1N4XH 2X4OA 2YPLA 3DECA 3MRIB 1MJ7H 5CSGA 1P5UA 2IG2L 2WWKO 4MAYB 5D6CB 5DJZB 3U46A 2DM4A 2VXVL 1YNLH 4K07A 4HGKC 1FL5A 3X12A 1NGYB 5F7UA 4LLUA 4BH7B 1HN1A 4U1IA 2VQUA 1G7JB 2VIRB 4L5FL 4UDUA 4PLKD 1U8HA 1CLCA 4A6YB 4ZUSA 4P99A 1HHIA 1CGSL 3FQXA 3HE7A 5HVFB 2J3SA 4B7IA 2VDKL 4LLQA 4HEPG 2D31A 1S8DA 1KLGB 4RQQA 2JJTA 5IG7B 3ULVE 1X6LA 1AXIB 5HSFA 3C6LA 3F12B 4ZS7H 2AKRA 2IAMD 3L6FA 1T80A 4YE4H 4PFEA 3R1GL 1DEEA 1OSPH 4XCCL 1MJUH 4QHKI 2YPLE 4QNPF 3NFNB 1FNLA 1MHEB 4Q0XH 4DZ8B 4WU5B 4X6CA 3MNVA 4KWUA 4F7TB 1NANH 3TV3H 2Y9RT 1GGYA 3EOBA 3F7VB 1NPUA 4AL8L 4PJXE 4S0UC 3RY6A 4XGZB 3FO9A 1KJVA 3UC0L 2VC2L 1RJLB 4OF5A 1JUFB 2AEQL 3VGDA 3BIKA 1JFMA 4ZYKA 4GKZA 3WIHH 4XPTL 3CFKA 4M62L 4EUPB 1PFCA 3VGFA 1F42A 1AGEB 5F7FA 4NNXB 4DQOH 4LRIA 1A5FH 1TENA 5C0EB 4PGEA 4L4VA 2DM3A 2BNRD 15C8L 4HXBL 5K9QI 5TH2B 3GJFK 4ZO6A 2HH0H 4X6CE 4JFPA 1IT9L 3DI2B 2VDPH 4EVNB 1HQ4A 1YEKH 3CXHJ 2BC4A 4KDTC 3MRMA 2HT3C 2H2PD 2AVGA 1EVUA 3U7YL 1C7SA 5BOZG 1AGCB 1IM3A 4HXAH 4DGYH 1ZA3B 2PETA 1LWRA 2P49B 2FIKA 4L8DA 3O81A 5HHOE 4GG8B 3LKNA 3LQZA 4ERSH 1UWGL 3VXNB 2EKSB 3L3KB 3H7BA 3MLPA 1MELA 1VFUA 4LLVB 1A64A 3EHBC 3FN3A 9CGTA 5J6GB 4X4XB 5IB3A 5DQ9A 2XN9A 4JFHD 4ONFL 5CD5C 5CLWA 4KHTL 3L3OA 4L4VE 1HYSD 2V17H 2Y1VA 4EN3B 4JFFD 3JWDL 1BFTA 2VZOA 3ILQC 4QHKJ 3W0WB 1VPOL 4G43B 5JO5B 2X9YA 5EG6C 5CEZE 1T5XB 4P9HH 3TIEB 3O4LD 4G8IA 2D7QA 2JF1A 4XMKL 5T3XL 2CIIB 3MLTB 4F3FB 4PY8I 2X09A 4D3CH 4IOIB 4XNXH 5DC9B 3ZHDA 1HQRA 2X4TB 3KPMB 3MOAH 4X5LA 4GKSA 4Y89A 1PLGL 5L2JB 3A67H 4YR6B 4HWZB 4MQXD 3QO0A 4JPKL 4M8QB 1P1ZA 2B1AL 1H3VA 1ZANH 2VDOH 4KKNA 1X5AA 4R4BA 1V7NH 1EEYB 3ORJA 2MCPL 2ZCHH 1E4KC 3RL2B 2BHZA 4M7LL 5DUBA 3EZ8A 3GUTA 1OWWA 1WCBA 3LKQA 2B39A 2Z8SA 3NCJH 4KFZC 2F9BT 5I1DB 4AIOA 2H26A 4Z0XA 3RP1A 1NUFA 1RHHB 4NO0A 2P8PB 1JIBA 3O6FA 4NKMA 2WAHA 1NC4B 3MBXH 4HWBH 1R24A 5DR5H 3WFEL 5HHOD 1YEGL 2X7LA 3UBXB 3P9WB 4S1RL 5H2BA 3U0WL 5EUKB 3BKCL 3FB6B 4K7PL 1F5WA 5C2BH 4AZ8A 3QXTA 2IJ0C 3U6RA 2HFGL 4IOFC 1L9MA 2VDQL 1OTSD 5KANG 4EN3C 1WK0A 4F57H 4WV1B 3NIDE 4L4VD 1U6AL 1OPGL 1FJ1B 4YDVB 1HDMA 2VRAA 3D18A 5E8EA 5IEHB 4C56B 2YBRA 2D7MA 1HINL 3M17A 3G08B 4L29A 4ORGA 3PDDA 3O8XA 1UXWB 3BN9D 1MOEA 3WV0A 5CP7A 5I1JH 1D9KA 3S37H 2GY7B 4X4YA 4OI7A 3RGVB 3T3ME 3QIBC 1XFPA 4DTGH 2PTTA 5A3ID 3QUMH 3QUZB 4KJQD 2P44B 1XR9A 3P77A 2JB6B 4PY8J 1VFAA 3DRTB 3CZJA 2HJLA 2XG5A 1U41A 5L2KA 3P4NB 4PRPB 4DVBA 4QOKA 5FV1L 4CRPA 2HJKB 2D7TL 4QRUB 4FHBD 1FORH 1FL6A 4NOBA 2Z91A 4ZUTA 1L7TH 1D5ZB 2CQVA 4G9FA 3PL6A 1IC7L 3U4BH 2ARJB 4U1MA 4Q58C 1FP5A 3LB6D 5FECA 5CIPH 3FMGL 1X44A 2CDGB 4OCXH 2NPLX 5DVMA 2ORBH 2F53D 3FFCA 2ESVD 2IALA 4OLZL 4X7DC 4JQIL 3HZYA 1IQDB 4WV1C 2ZOLA 4RGNE 5E6IC 4YDJA 3CPLB 5TQ0H 4D3CL 5EO9B 1BZ7B 4HF5L 1BWMA 5L2KE 4NZRL 3TVMB 4QOKE 5FYKH 3A67L 5DA4A 1IGTB 3SGKC 1RURH 2IH1A 4PY7A 4HT1L 3RX7A 5FO8B 2UWEA 1IAOA 3ES6A 3G6AA 4TSBL 4Z78B 4HKZA 4J3XA 3IVKA 4AK1A 1MHCB 3QUZC 1UB5B 2QL1A 2ZCHL 4D9QE 4KGJA 4KI5F 5KOMC 3VH8B 3FFCE 4P5KB 3PDOA 5IW1B 3RAJL 1CLZH 1LO4L 3BVNA 4I5BB 2VWEE 2R4SL 3O3DA 3BD3A 3LV3B 2MCG1 1S7WB 4BSWB 1QSZA 2PYEA 1AR2A 3MV11 2YD1A 1JMZA 4HKJA 2YD4A 1EX0A 1W72L 1M7DA 1MFDL 2FLBT 1JPTL 5T1MA 5EU6B 4I3GA 2JCCA 1F8TH 3QEUA 3V4UL 4Q2ZA 1RAMA 5DURD 2QLVB 4LNRB 4LDOB 4X0KB 1HXMB 1UM4H 4GQ9L 4LBEA 2UWEE 3O8XD 3ZL4H 2A6JA 5EO0A 2G60H 1S7TB 4QF1A 1NGQH 4PJAF 1ES0B 3PWLA 1FFPA 1FSKB 5D6DA 2XXCB 4AM0B 2EH7L 1QPPA 1YEJL 2Y4SA 5DK2B 5DMKA 3EYQD 3QFJB 4HFWB 3RNKB 3RTQB 4R4FL 1MUJB 4POZD 5I6XB 1KENH 4QRRD 5F93C 5A2IH 1PW3A 5DD1L 3WJLA 3TVMC 1QG3A 4HAFA 3KPSB 2XTJD 5DHVB 2PYEE 2ZPKH 1VACB 1Y6NR 3IJHA 2F54A 3QUML 1XAUA 4PRNB 4N68A 4YO0A 1NUNB 5E5RB 3MJ9A 3QWQB 4M1DL 3SGJA 2MFNA 1AY1H 1NMCB 5F88B 4XVUD 1X5FA 2X89A 2LVCA 1J1OH 2VZTA 1QLEH 4OGAC 5C6PB 4P2OD 2H32A 1QBBA 4NNYB 4JPWH 5LAXB 3B83A 4LLYB 1UACH 4M1GH 2BNQD 1CICD 4YQXL 1PX4A 1PQZB 4KMTL 5EULV 3HC4H 3BFOA 3A6CL 3FFCD 3CFDB 3D3VB 4P23D 4PR5B 5GS2H 1YEHL 3MLYL 5DEGA 2VLRA 1FBIL 3DX7B 4Y4FA 5IMLA 2DQUH 4N90D 3SDCD 1IRAY 1Z9LA 2PTVA 5C9JA 4NQUA 3I84A 5CKGA 3B5TA 1L4IA 1JFQL 1G7MB 1LO0H 4MNQD 4PTTB 1NQBA 4NRXB 1OGAA 1TETH 2M8XA 4WY7L 1JHLH 1FO0L 1F3JB 2RHEA 1PSKH 4NBZB 4YXHL 2AEIT 4LEOB 1SM3H 2R8SL 4LMQI 1XGQA 4F80A 1FSKC 1FNHA 1I7UA 1KB9K 3D39A 3EDJA 3LOWA 4HUWB 5IESH 3GMNA 3SN6N 1N8ZB 3R0MA 2YEZB 1KN4H 4EXPX 5FYKL 4M6MH 3RTQC 4FQJH 1MHPH 2NQCA 2N1KA 5I6XC 4MXWH 4JDVB 3IF1A 4I48B 3QDMA 1CXLA 1KNOB 2VLRE 4JFQB 5DD5L 3PIQB 3DJ9A 5JXED 3G9AB 2XRAH 1WQVT 1A7PH 5JW3H 1I3GH 4FZEH 1NMCC 2L0DA 2R2BA 3GMQA 5JORB 1DN0A 3DPBA 4G8GA 2P47B 1VGKB 3E2HA 1OGAE 2NXZB 3NIFE 4YHKL 4QXTB 3QDHA 5L88H 1UH2A 1CFQB 5I19L 4FN0A 2QV2A 3THML 3WIIH 1J05B 4JG1H 3UZVB 3ZDZF 4PJBA 3IFOA 5FYKU 3CDGB 3D39E 3VXUA 2E27H 4OUUA 5IB5B 4OM0H 3F5WB 5IK3B 4PJ5B 1F8TL 3HZVA 4QHUB 2BHUA 5C0BB 2FZ3A 3T2PA 1QBLH 3ULUL 4J8RA 4P5MA 4WCYL 4ZD3L 3P9LA 1T5WB 2M26A 5DVKA 3BGMA 3QDME 3KHOA 1U2HA 3MRCA 1SJHA 3PABA 1KCSL 4QRTA 1YC7A 4G8GE 2A1WL 4A6YH 4OLWL 4NKOB 3OG4B 5JA8B 3DIFB 4HQQL 3H9ZA 4OLUH 2X70B 2APXA 5DJAB 2ADJB 3MXWL 3RVWD 1K6QL 3VE0B 2Z35A 2R0KL 4NQEA 3T1FB 1LP9F 4U1LA 1HSAA 4I0CC 5EOCJ 4YWGL 1W0WB 2LTQB 4PJBE 2VSDA 4NN5B 3OKLB 2OTPA 1SEBB 4NKIL 4LP4A 1P7QB 4LPWA 1JPSL 1MRCL 4XCNA 1T66D 1CIUA 4GKNB 2B1HL 4HFUH 1BWWA 1KYOK 3S88H 4UB0H 4N9GA 1QOKA 4KQ4H 3EJZD 2NW2A 5DEFA 4KAQH 5IEKB 5B3JF 2NXZC 4LCUA 4K3GA 4JO3H 1RZ8A 3KDMB 2MMXA 3C5SA 1LO5A 4IMKA 2ED9A 5ERWB 3MA9L 4BZ1L 3O2DA 1R5VB 2W60B 3B8SA 2CLRB 2X5PA 3V0VA 1PY9A 5JHDB 4NQEE 2AJVH 4D0DA 3OF6A 2UZYB 1KB9J 4CMHB 1HZHH 1RMFL 2R9HD 3L5JA 4F7EA 1CWVA 1OCWH 5KVMC 4RFEA 1QLRA 4PJ7F 1LDPH 5KN5A 4UIMA 3PQYA 4X5WB 5F1NB 4MHHG 3QJFB 1NBZB 2DQDL 3QDMD 5JR1L 3WS3B 3P73A 2HVKA 3V5HB 1ZLVK 3UEZA 4M7KH 2R1YB 4UT9L 4ZAKB 1CT8A 2Y23A 5IBTH 1JNNL 3GO1L 4GSDH 4JPVL 2VE6B 1ZHBA 3MRPA 1U3HD 4X9FA 1EO5A 2AXFA 3VXQB 5HHQA 1C08B 3BE1L 3MCKA 1TZGL 5JQHC 1BREA 2LTQC 2VL5A 4NN5C 2VITA 1FFRA 1RIUH 1MAMH 4FZEL 5FF6B 3VDAA 1S7QA 3QEGL 4R0LB 4MD4A 1IM9D 2YD6A 4ZFOB 4P3WA 1LEIA 1CN4A 5HPOA 3LN4A 5E94B 3S4SA 5DQDH 1I4FB 4MLSA 3H7LA 1QKZH 2LQRA 1DQMH 1XGTA 3PQYE 3FKUS 4JG1L 1T20A 4KROB 2HMIC 3EYVA 3KLHD 5C07A 4QRQB 4YNYB 4MNHB 3I75B 4ZDHB 1E4WH 4PJAB 5LGHL 1F4HA 3VDBA 5TDOA 3FOLA 3ALXA 3BRDA 5TE4L 4V1DB 4K71B 2QSTA 3BIBX 1A7OH 2H9GB 3UAJC 1E6JH 1I9RL 2OR9H 3NFSL 2CK0H 1JGEA 3BKJH 2VJXA 2XWBB 4R26L 1FNSH 4YZFF 1XGUB 1IL1B 3QH3B 3VXOB 3T3PF 4JRWA 1GGCL 3I50H 5BVJA 4L3CA 1VEMA 1KCUH 2HA1A 3MJ8B 4ODVL 4P2QB 2J8HA 3D0LA 4AEHH 3TGXA 1KYOJ 3O3UN 3R06B 1G7IB 4ZAKC 5C0CA 1AI1H 3CGTA 1VENA 2C1PB 2YN3A 5C07E 3VWJA 4KI5C 4AYFA 5DO2C 5ITFB 3BIAX 1G0YR 3D5OF 4E0RA 1T7ZA 2Y25A 4H1LA 2WWKT 3QHFL 1JGVH 1X5JA 4S1SL 1NDGB 4FP8L 4CKVX 3AFLA 3HN3A 1AGFA 1CDCA 5CHNB 4FABH 4KQ4L 2IBGA 2EC9U 5EZJB 4LPVA 2EE3A 4X83A 5LBSH 1AKJA 2K7QA 2WUCH 4M6OH 1X5LA 2DMKA 3X14A 3OF6D 3NACL 5FHBL 3ALPA 3GMMA 5JXAH 5GHWH 3P4MA 1LVEA 4PBWD 5F9OH 5TE6H 1NMBL 2RQ8A 4HK0B 3ARDD 1MREH 4U05A 1T1ZA 2G2RB 4R7NB 5C0CE 4BJLA 1FH5L 5J6HA 1A9BB 1NLDH 5J56B 5FCSH 4OZGA 2KQMA 3HR6A 4K94C 3K4DA 4WHCA 1YNTB 4KKAD 1MCJA 3EJYD 1LDPL 4C55A 3QCUL 1KXTB 1QP1A 2DQJL 2VXSL 4OFYD 1F4WH 3GB7B 3QDGD 1HH6B 3DSFH 4M7KL 3MCLL 4FG6C 1CF8L 1BM3H 5IBLD 3QUXB 3O2WL 4G6FB 4YHMH 1AXTH 4GSDL 2HKFL 1SJVA 3UTPE 1KB5A 2F74A 1CD8A 3MRQB 3BZEB 4JN1L 3DYPA 5C0GB 4NQDA 1JTPA 3I3BA 4RBPH 4Y5YC 4ZUUB 1ADQL 2OCFD 5H37H 3B2UC 3C5ZA 3I3DA 2H1PL 4FQLL 1EHLH 1BFVH 4P4KA 4U0RB 5EZIH 1XF3B 3ISWA 5DWUL 3MYJB 3MV9B 4ZS6D 4OZGE 4J1UB 3MMEA 4LU5H 2FR4B 5DI8A 1KLFA 4HKBA 1O7SA 4DAGL 1DQML 5DJDB 3MBEB 5ANME 3D9AH 5TFSH 5MI0B 4PRDA 2DMCA 1KLUB 5KSVB 2G5BB 3TH2T 1R5WB 3MLUH 1B2WH 1ZHNA 4NP4H 3HE6D 4MJ6A 4WWKB 1AGBB 4PRIB 2BVOB 2DQCH 1G1CA 2GI7A 4AY0A 2FATL 1EBPA 3WEXA 2OR7A 3EOAB 3TO2B 1GPOL 1HKLH 3HS0B 3N9GH 4JGJA 1LP9B 1DLHA 3JTCA 1RJZA 2W9LA 3INUL 1KCRL 4JQXA 2DYPA 4YAQA 5FXCH 3I50L 3VWJD 3SGEI 2YS4A 1WIPA 1RHFA 2DJSA 2PO6D 4C58B 3AXLA 5I1KH 3OAZH 4UUJB 4AEHL 2XY2A 3QUXC 4U1GB 1AXSA 1L6ZA 1AI1L 3B5GA 2L7JA 4JM2A 5FHAL 1S7SA 4HIEB 4MCYB 6FABH 4MQ7B 1Q94B 4ODXB 1FE8H 1AIFB 4FQ2H 1OTUD 2EDKA 3L3GA 1JGVL 5DSCA 5MEOB 4U6XB 2GHWB 3CSPA 2NY3D 2X4NA 4U0RC 3PWNA 1Q0XL 3GSOB 4O2FA 2HRPH 4MSWA 1BBJA 1IC4H 1MH5A 2A74B 4XHJD 2J2ZA 3IFNH 3UTTA 4X6DF 1I1AA 3ZDYE 3MBEC 2FSEA 4NYLA 5F9OL 4UT6H 5HDBF 1S7XB 4PJ7B 2WUBH 4L9LC 3EYFA 5DT1L 4QO1A 4LRNH 3OKDB 1KSRA 5C09A 1OAQL 4X8XA 1CFTA 4JZJA 3UP1A 3I85A 4WI5A 2ZSWB 1E27A 1OD7A 2BSSB 4NKDA 2YRPA 1QFWL 5DHVH 5KSBF 2A73B 1T2QH 3FT3A 3QULA 5B8CB 4JY4A 4F2MB 3LEVH 4O9HL 4M7ZB 5FUOH 1RIHH 2WBJD 3KPTA 3ILPB 4N0UE 4TUJB 5BRZE 5KSAC 1ZE3C 4U1GC 3BZDA 1FNGA 3WIHA 3QG6A 1H8OA 4FQPA 3Q3GA 2Q8BL 5D1QD 4W68A 1YECL 5DHYA 1LQSR 3KYAA 4OZHF 4RZCA 2IQAB 1NGPH 2FX8L 1R0AL 4LGRB 1Q8MA 5F1IB 2V9QA 3GBNL 5I1CL 2NY5L 3X3GH 4HLZH 5I30L 3S98A 2YK1H 3VWKA 3KJ4B 5GRZA 1V7MH 2WWMD 2H8PA 5CJXA 4H5SA 4Z7WE 1QRNB 4LVNB 3UCRA 3GNMH 3QPQC 4NQXB 2CJUL 4OZFB 4TVPD 4PG2A 5CILH 3BZFA 2E7LA 3S35X 1P7HL 1UM6L 2YSSB 3MO1B 2FBJL 2A6IB 1K4DA 1RUPL 3WJJC 5I1LA 1YQVL 3PP3H 4OCYL 3WLWD 3FQWA 4JM2D 4PLJD 1C1EL 2I60H 3CVIH 1I7TA 4XAWL 3S4SG 5C08D 5AWNL 3BX7C 3PDGA 3V6OC 1NCBL 5B8CC 4FQIH 4Z76B 1Y6MR 3MYZA 1X5ZA 5T3ZH 1F58L 4HGWB 3E6FA 4M7ZC 1F4YH 3P30L 4Y1AB 3F6IA 5MP6H 3U1SL 5E9DB 1DBKL 1ND0B 1EJ6A 2EDHA 3NA9L 3K7UA 4U1KA 3ARUA 2AERT 1GC1L 2DL9A 1CVRA 3LKSA 5BRZD 3ECBB 1IZJA 3V4PH 2XZQL 3MJ6A 2AJZA 4KXZI 1KJMB 2DI9A 5H94B 5KVGH 5GGSB 4I4WA 3RWFA 3LKOA 5J11B 2YD8A 1U8JB 2HRPL 1FVEA 4GAJH 3HB3D 4JB9L 1I8KA 3NFPB 4XZUB 4DGIL 1OAKL 3IT8D 3UJIH 1CU4H 4RFOH 2BJMH 2E8ZA 3KJ4C 1P9MC 3D85B 1KJ2B 4J3SA 5HY9A 4MWFB 1HEZA 1KJ3L 4U49A 3PWJB 3U7AA 4K9EC 3SCMD 1N2RA 4YDLC 4NZJA 3CX2A 4UIKL 3V9FA 4H1LG 4JFZL 3SE3C 4HWBA 5FYLD 3WCYA 4YXLH 2ICEB 3Q0HA 1G7LB 4JREC 5IF0B 4DK6A 5KW9L 1OTTD 4OD3H 4HJ0D 4AT6A 5SX5H 5IIEB 5LCVH 4Q9QH 4K3EH 5I1IH 4HIJB 3SJVA 1RIHL 1WBZB 3QXAA 4UU9A 4YUEL 1E28A 2QSCL 4R2GB 5ETUB 2OSLA 2YA1A 3DI3B 4GAYB 1BGXL 4NHCL 4MDIA 4ZSOA 1MWAB 2DKMA 2XKUA 4EI6A 4MD5A 3MLWL 2Y06H 1JWMB 5FYJL 4NKQB 4Q9CA 4PRHA 5F8RC 1JK8A 4PJDA 3BDXA 3FOMB 3STLA 1ERNA 4PP2B 5E8OB 3CLFL 3JVGA 4JY6B 3AU1A 2C3HA 4PRAB 1RZGB 1Z6JT 3ARYA 5J11C 4PJEA 1NBVH 1H3XA 2YK1L 3KPQB 1J88A 1V7ML 3GSQA 4ZMAT 3F7YB 5JNYB 4NUJA 3MNWA 4GRLC 2EYSB 3GNML 4WUUB 3CZFB 1KC5L 3O6ML 4YC2B 5FYJU 4TULH 4ZSOE 3T1WA 3VFWA 4IDJH 4IMLA 2P7TB 1TTFA 3L3JB 3KYOB 4Y4KD 3UBXI 1ZEAH 3R4DA 4RNRA 4GJTB 3DO7B 4PRHE 4DWHA 3QUYA 3NZ8A 2FHBA 4IRJA 5HDOA 1C5DB 4UT7L 5J8OA 1YUHA 3OR7A 4P46B 4FQIL 4M5YL 4K23H 1FGNL 4NC2B 1F4YL 1Y0LB 4PJEE 4J2XA 3W9DA 1KIPA 1BJ1H 1PKQB 4U6VH 1EAPA 4C83B 2DKUA 3V6FB 5HHXL 5J57B 2ARWA 3TIDA 3V0WH 3KPRB 2BSED 1A1OB 1PG7L 4X7FC 2BVQA 4TYUA 4WW1A 4X6DB 5EA0H 1HHJB 1QFWI 3ULVF 5GJSL 5FM8A 5I66A 1A3QA 1EZVX 4N5EA 1NFDA 3ARGD 4GAJL 4XB8A 1LE9B 5JHLH 3T4AB 3TJEL 2ADGB 1MEXH 1ZKAA 1PBYA 1QSFA 1A1NB 3EGSB 5CINH 4K94H 5T33H 5KJRH 4RFOL 2PXYB 2SEBB 4PV8A 3K80A 3EFDH 3RJQB 4NZTL 1ETZA 4BYHA 5BJTA 4Y2DD 4AH2B 1JI1A 1U3YA 5KSBB 4ODSH 1XF5A 3UO1H 4PP8C 4QWWC 3WKML 2HLAB 4JFDD 4CW1A 4YC2C 1ACYL 1BFSA 4U0QB 3LKRB 1OVZA 2X1XR 2AW2A 4KRLB 5I15L 5I76B 1Q9WB 4IIQA 5SWQA 5ADOH 5BW7A 2BOCB 4OCNC 4Q9QL 3FB8A 5FV2A 2Y5TA 1D5XB 4K3EL 2Z92A 4OZHB 5LXGH 2EXYD 3JWNC 2G9HA 1NFDE 1EFXD 4UQ3B 3OJDA 3QCVL 2RIKA 3BZ4B 3QIWB 1NAKH 5F96L 1MI5B 3LN5B 3MODH 5JTWA 4NO3B 4X6CF 4LLMB 1INDH 5IM7A 4WGWB 2VXTH 3MGTA 4LIQL 4ZXBD 3TZVA 2EIZB 2F19H 5HHMA 1T83A 2O61A 5IW3A 5H35B 3PWVA 4B50A 3QG7H 1E0OB 2IADB 4D8PA 4HCRL 3RY4A 4LK4A 5F89A 1U8PB 1YC8A 2CDEA 1U58A 4PJFA 3VXMA 3GSRB 1QLFB 4ZQKA 1AQKH 5D5MA 3P0YL 4HIHA 2LU4A 5E2UH 2PXYC 1CDBA 2KUTA 4R8WL 1XIWB 1XEDA 3QWOA 1WBXA 5CMAB 4D2NA 1R3LB 4N0CD 5GGVH 3IU3A 3TBYA 1YYML 4Y8AA 5GGTH 5DXWA 5JPNB 2VR5A 2OI9A 5DFVC 1I3RA 2ZUYA 3Q5OA 1YEIH 1JV5B 3F58L 5IT2L 4HBCL 1UWXH 5D7JA 2OM5A 1YMMA 3VFSB 3U0TB 3PV7A 3GFUA 3IJSA 5CUSL 2AI0L 2LVEA 3DGGA 1LEKB 4ZFOL 4H26A 5IJKC 1A4JA 3HFMH 4YHYB 5DQJA 1IAIM 4C54A 4PJFE 4QTHB 3D6GA 1N64H 3W11D 5D5ME 3TWCL 5GQBA 3W82A 3RGHA 2I25N 3OGCB 4XI5D 4Y0GA 5EBMA 2FO1A 4QHLB 1NC2A 3G5YA 5DRNB 1CL7H 4E41A 1QD0A 1T4KA 2ATPB 4X7TB 2PYFB 2VLJE 1IGIL 4DN3L 5INDA 1I1FA 5E8DH 1Q72H 4KKCC 4PUBL 2CK2A 4XAKD 2DDQH 1NBYB 1YMME 1ZS8A 4KUZL 3CX5K 5ID1B 1TZHA 1MJJB 4IRZH 3WSQH 4L8CA 2R2HB 3EFDL 2NYYD 3WHE0 5FKAB 2P24B 1IEAB 3VGBA 4UMGA 5HGDB 2ZOKB 4X6EB 4HDIA 3D2UB 3TBWA 2COQA 2P5EA 1XIWC 1B4RA 1U8QB 5AYUL 3CSYB 2XA8L 5D72L 4CVXA 2CKBB 3NIDF 4MB3A 5HGGS 4E5XA 4E41E 2W9EH 3BPLB 1BF8A 1KCVL 2WQ8A 5D6CA 3UYOD 3KYMB 3TZVD 1ONQA 2IAMB 4XXCC 3CFCH 5E2VH 1NGYA 4MJ5A 4GBXD 4PTUA 3PGCB 1TZIA 1DBJL 3VDCA 4YDKH 3T3MF 4DUWA 1KXVC 4H0GA 4AQ1B 4YHYC 3OXSB 4YBHA 1T04B 1A6TB 2F19L 3S37X 3B9KA 5CWSB 5HGAB 5ID0B 3SY0B 1AR1C 3B3IB 3QG7L 1WTGT 2P5EE 1VEOA 2J6EH 3QDAA 3RDTD 1KLGA 1BBDL 4KRMB 1QEWB 1UH3A 1J0HA 4H8WC 4ALAL 1TNMA 1Q9KB 1NGXA 5GZND 1XR8A 3VXTB 1T21B 2VLJD 3FQNB 2WP3O 1WAAA 3BKMH 4NT6B 1AQKL 3C8KA 3HCVB 1A6VL 4HJGA 3RL1B 1JZ6A 4XNYH 1OLZA 5E2UL 4P3CH 3TBVB 3DXAA 1P4BH 1A6PA 1YMMD 2EH8L 4QXGL 3S96B 3N1FC 4LSSH 3UDWA 4WW2C 1DQJA 5ICXB 1C5CH 3QO1B 1ORSA 5CBAB 4QT5B 5DMYA 1BP3B 4QHMA 1R5IA 3CFEB 3SQBA 1YEIL 5FO7B 5FUZH 1EGJL 1ZA6A 3DOSA 2NW3A 4CMMA 3MZGB 2IQ9H 4XC3H 2GJ6D 2KDGA 1JZ8A 2YWYA 3BPLC 2GK0B 4K3DH 5GGUA 3FRPA 2EYTA 2QQLH 2IAMC 5IQ7H 3CMOL 1M6OA 3H9SD 3QJHB 5C0AD 1P4IL 1WAAE 2W0PA 1EHNA 2YPVH 1FCGA 25C8L 1U92B 1Q9OB 2X4OB 3DXAE 2OXHA 2YPLB 1WZMA 3CX5J 1CL7L 3IDUA 3U46B 1Z3GL 1FL5B 3X12B 3IU4H 3FTGA 4LARL 4LLUB 5DK0A 3O45A 4U1IB 4F58L 1N0LA 4K9EH 4WHYG 2OXGA 4UDUB 2CKNA 4NQCD 1MCFA 4YBLB 3DNKA 2PW1A 4WO4A 1QQDA 1U8HB 4ZUSB 3LS4H 1HHIB 3FQXB 3HE7B 4P2CG 3VXPB 1YMHA 5J89A 5HVGB 4M5ZH 5I18L 3ROOA 4HUXA 4LLQB 2APVA 2D31B 4WWID 4G7VL 1S8DB 4RQQB 5CBEA 1JTOA 2HG5A 2UWEF 3C6LB 2X1WL 3H6JA 2AKRB 3L6FB 1PKOA 3QB7C 5J12B 1OP5K 5GRUH 5ITBL 4LCIH 1DEEB 3K2UL 2CRMA 1OY3B 1CQYA 3R8BB 2ICCA 2AK4A 5MERA 1SVCP 1ZVHA 4X6CB 3MNVB 3TA3D 4DGVL 3TT1H 7FABL 3AY4C 1N6QH 1AD9A 3EOBB 1YEFL 1K2DA 2W0FA 2BVYA 3WFZA 3B9KD 5EC1A 2ITCA 3FO9B 1P4LA 1KJVB 3QIBA 3VFMA 3ULVC 3TO4D 5HHOB 3BIKB 2Z93A 4ZYKB 2V9RA 4N0FA 5BV7B 4Y5VC 4GKZB 3SGEH 4AIZA 3SO5A 4BQ6A 4FFVD 1AQDA 3CFKB 5D2LE 1NFIA 4XXDA 2OX5A 3RL2A 1GOHA 4HMCA 2JJWA 4HPOL 3OX8A 1KJ2H 2XQYK 5D1ZA 1ZGLA 4X99A 4PGEB 4L4VB 4N8CL 4WI3A 2AK4E 4JKMA 3O3EA 3MREA 4JFPB 2JJVA 4JFEA 5FB8A 3RWGA 1S9YA 4YH6A 4P3CL 3OB0H 3O2VH 4OFVA 1HQ4B 4KZEH 3HE7C 2BC4B 1P4BL 3MRMB 4KZDL 4ELKA 3ZLQC 3UMTA 1IM3B 2ZJSH 4ZOBA 5DS8A 3UJTH 2FIKB 2JJTC 3CVHL 4L8DB 5FA4B 1SQ2N 1WV7T 5D1XD 3C6LC 3LKNB 5FGCE 1H3GA 5J12C 5HXMA 3UTSA 5GGSY 3H7BB 5E6IA 4MMXC 3WBDA 5KTEH 1MWAH 1Z2KA 2ZUUA 3C60A 4R90L 5IB3B 3NCEB 5CGYC 1BPVA 3G08A 4UZGA 3STZA 2XN9B 2AJ3A 4H25A 4S1DD 4EDWH 2V2TB 3L3OB 1I85A 1OAYL 4BZ2L 3QRGL 3KNBA 1T89A 3O0RL 4H0IA 4ONGL 2YPVL 2ADFL 3T2NH 4JFEE 2IPTH 2DLFL 5SV3A 1F3DH 4TUKH 1RD6A 5BV7C 3IDNA 4MA7H 4BSJA 3UZQA 1MCLA 2B5IB 3BP5A 3IU4L 5GRJH 1ZXQA 5FFLA 2R0WH 3NIFF 5E2TH 3H3PH 3VFGL 1HQRB 4GKSB 4DZBA 3TM6A 1OTSC 3QI9A 4P59L 3QO0B 1BVLA 2A83A 3S36H 3BEVA 4LRIC 1P1ZB 2DM7A 2PR4L 4LSQH 2LFGA 4F8TA 2I5YL 1HWGB 1K8DA 1YY9C 1UM5H 4R4BB 1OB1A 2AK4D 4NWUH 3BN9C 3ETBF 3MV8D 5DUBB 3GUTB 4NDMA 1WCBB 5SWSE 4DW2H 4HS8H 4HKXA 3LKQB 1A1MA 4LCIL 5M7QA 5EORH 1YA5A 3CFJA 1SEQH 3OB8A 2H26B 4KMQA 4Z0XB 5A3IC 4NO0B 5JLZA 2XYCA 1T6WA 4L3ED 3S34H 4NKMB 3O6FB 5IHBA 3TT1L 1R24B 1UCBH 2X7LB 5DJXA 3FQUA 3RVTC 3T0DA 5H2BB 3RWDA 3ZO0A 2IH3B 2UYLA 3U6RB 3KWWA 1RUKH 4PJBF 1YJDC 3GJFA 4P2RD 4HGMA 4U7KA 1F4AA 4GLRH 2OZ4H 4HV8A 4BQCA 2R4RL 1HDMB 3FAXA 4WNQA 5GS0L 3D18B 5E8EB 1FPTL 2ZUWA 2YBRB 5D7SH 3M17B 1OW0C 2Z8VC 3LB6C 4ORGB 3O8XB 4KTYA 1FG9C 2B5IC 2R2EA 4PRBA 1KJ2L 5CP7B 1D9KB 4BZYA 4X4YB 1G9NC 5E95B 2PTTB 1H3TA 5LKNA 3O2VL 3U30B 1XR9B 4KJWD 2EDDA 3P77B 4UAOB 5A40E 1YYLL 4K8RD 2WANA 4UILH 4RGNB 2MTPA 3BGFB 3L5XH 2HJLB 4MS8A 5L2KB 5FAAA 4DVBB 3G9VA 4QOKB 1B3JA 2A2QT 2YKLL 5CZVL 4I3RL 1FL6B 4KK8D 5SWSD 2P5WA 2Z91B 4ZUTB 3BP6A 5KTEL 4G9FB 3M07A 2AGJH 3PL6B 2DTSA 1UZ8A 4U1MB 1SBBA 3UYPA 3OBAA 1FGVL 2RB8A 4HH8A 5FECB 1MUJA 4NQVA 5CP3H 1F11A 3FFCB 3VG0L 5I16A 3T2NL 1Z0MA 2IALB 3GI9H 3OJMB 2DTMH 1YN6A 3C2AH 4TUKL 3SDCB 1NMAH 3I6GA 2ZOLB 4YDJB 2L4OA 5GRJL 3ROLA 5E2TL 1RZJC 4NNYA 4RCAA 4TPRH 4NIKB 1JYNA 3O8XC 1OARH 5IMOA 4OCWL 3UXFA 2IH1B 3LQAC 3BHBB 4WFEE 1D9KC 1DBMH 2UY7A 4HUUA 4PY7B 2UWEB 3TESA 2P5WE 1IAOB 1G9EA 3ES6B 3HNSL 2CO6B 3HI5H 3G6AB 4PR5A 3D3VA 4WEMB 1Y18A 5FDYA 4HKZB 3GRWL 2APBA 1J87A 3FRPG 5I1EH 1S3KL 3IVKB 1U8OA 1KIQA 3VXSE 5KZCD 1AGDA 3U30C 2KZWA 4G6KH 4POZC 2Q7YA 4UAOC 2OQJA 4L4JA 5KOVC 3BUYA 3PDOB 4AMKL 3HNTL 4RGNC 3JTSA 1JN6A 4XPBH 3BVNB 3VFVA 3BGFC 4KKLC 3GMRA 4Q74A 3V8OA 1JE6A 5T1LD 4ZO9A 1GAFL 4O02H 1NCNA 2PYEB 4HKJB 2J8OA 2QQNH 4M02A 3RVXD 1M7DB 3TBTA 5T1MB 3V8CA 2JCCB 32C2A 3QEUB 3PL6C 4Q2ZB 4RGOH 4Y19A 1CICC 4LBEB 1LEGA 2DOCA 1A6ZA 3WDHA 1RUKL 2A6JB 4H8WH 4W6YB 3KPNA 4QF1B 4X80H 4EOWL 5EZLA 2X1OA 3PWLB 1FFPB 4JM4L 2VAAA 3B2VH 3SDCC 5DMKB 5IFHL 4TVPL 3BXNA 4LCWA 2V6HA 1FAIH 1NSNL 2HT4D 2OL3A 4WFGE 4OCRL 2DI8A 1P84K 1H15A 1RIVH 1INEH 4MS8D 3IJHB 2F54B 4YO0B 3MRJA 2X1PA 4OTXL 2AJUH 2P5WD 4Y19E 2X42A 2H32B 5C0ND 5LGKA 1QYGL 1AJ7L 1MRFL 3VXSD 5JQ6H 3HC3L 2Y07H 3EW3B 1CG9A 5JIIA 3CH1A 4R9HA 2OBGA 5E8NA 2Q7NA 5DEGB 2VLRB 3L9RA 4WGVB 4U33A 2FO4A 3MFFA 4LCWE 4Y4FB 5DD3L 5IMLB 2A77H 1YNKH 5C9JB 3EO1A 3NAAH 3GDBA 4I3SL 1T7XA 3LN9A 5HI5D 3EJJX 5D9SB 1XGPA 1OGAB 4OBSA 5EWIH 3I6LE 1GOFA 3VFNA 4LQFH 2R56H 3U9UA 1ZT4A 2DTML 1N7ML 2CMRH 1N0XL 1C5BH 3CSBA 1S5IL 5AG8A 3ARSA 1NMAL 4Q7DA 3KXFA 2GCYA 1XGQB 4M43H 3FB5A 5D6DC 1I7UB 3D39B 3GMNB 4OZGF 3V0AC 3ARED 4C59B 4CJ1A 5JIHA 1OARL 5HYFA 4LP5A 4OV5A 5GISL 5HVWA 4Z7UA 3TN0A 4AJ0A 5ALBL 4ODUA 1C8PA 3IF1B 3HMXH 3QDMB 3MLZH 5D7LA 3AS0A 1FIGL 3WDIA 4L8SA 4WFGD 3VD9A 4MA8L 5JDJA 3LS5L 4F7PA 4I2XA 1BIIA 2ZKHL 1AO7A 1EJOH 5DVNA 3SGJC 1CVSC 3GMQB 2QBWA 4PGBB 1R5VA 1DN0B 1W2KT 4KK9D 4G8GB 3RVWC 5BS0D 3E2HB 4W81A 3N85L 5ENWB 3WFDH 4XPBL 5DYOA 5ALCL 4FQXA 3ELAT 4O5LL 1CLOH 1URLA 4DKFH 4O02L 3REWA 4XMPL 3ZYZA 3KXFE 3HMWH 2J1KA 3O6LH 2VXUL 4PJBB 3JV4A 2QQNL 4XWOC 5EIIA 3IFOB 3LQMA 3VXUB 1NBZA 4OUUB 4MJIA 5BOPA 1ZT7A 5H37G 1CXKA 3HZVB 2XFXA 4OCSH 4Z7UE 2JIXD 4ZAKA 3EJZC 4J8RB 4P5MB 2VE6A 3S6CA 3P9LB 1A6WL 2YD5A 3BGMB 5D7LE 5E8PA 5EU5A 1IGCL 3MRCB 1DVFD 1SJHB 4X6BA 2QQQA 3LSOA 3PABB 4I2XE 5K9QG 4KTEH 4Y16A 4NHUE 1DSFH 5ISZA 1S9WA 2Z35B 1KEGH 4NQEB 4RMQA 4U1LB 1HSAB 3AROA 1I4FA 5DJ8A 3MLXH 4ZTPH 1R3KA 5GS1A 2APTA 3ZDYF 4GXVH 3VFUA 1IZKA 2BVEA 3DVNA 1U3JA 5DC0A 4QRQA 4MJIE 4WEBL 3ARFA 4TOYL 4XCNB 4JZNA 2CKBL 4JR9H 5E5UB 1DLFH 3LHPL 4J6RH 3SBWC 4KY1H 2Y6SC 4N9GB 4JM2F 3E2HC 2Y07L 2NW2B 4WU7A 5DEFB 4LCUB 4TSAH 1X5HA 4EBQH 1RZ8B 4ZOCA 3GI8H 1D5BA 4UV4H 1A14H 1BQUA 1MAKA 4GXUN 4WJ5A 2CRZA 1CGWA 5KS9A 1SBSH 5FOBA 1MAJA 2A77L 5ISZE 5JIPA 5BV7H 4XC1H 3V0VB 4HWEH 3U7WL 3MRKA 4D0DB 4PJ8A 1Q0YL 4JZOA 1DUZA 4LMQE 2FRGP 1DBBH 2NZ9D 2QKIA 4F7EB 4Y5YA 2CMRL 5CEYA 3BMWA 3TCXA 4RFEB 1A3RH 1BEYL 1QLRB 3V95A 3B6SA 4UIMB 5KVEH 1E4XH 3PQYB 1FDLL 3MSPA 5D7LD 1IGFH 3P73B 2HVKB 5C71A 2AXJA 5L0QC 4WFFD 1CT8B 2DQHH 1T6VN 4QRSA 5CEZH 1ZHBB 1S9VA 3MRPB 3BESR 3OMZA 4ZUVA 2AXFB 5C9KA 5HHQB 3SPVA 1MIEL 4HIXL 5D71L 3RWEA 4NPYA 4HS6A 5C86A 5BMFH 4JRYD 3MLZL 3MCKB 1KPUA 2MHAA 2B7DT 4NN6B 3WMSA 4M6NL 4FQXD 2PUQT 2P48B 4YHZL 5GRVL 5KS9E 2VL5B 3DX6A 2VITB 4Z7WF 3GM8A 1EHXA 1CCZA 1S7QB 3OXRA 4L4TA 4MD4B 3AAZA 1FLTX 5T3XD 3WFDL 1LEIB 1A02N 3MUHL 4LAQL 3LN4B 3S4SB 3QEHA 1FFOB 2DL2A 2IPKA 2VDNH 5KVDL 1ULVA 1V3MA 5C7XH 5EBWA 1XGTB 5IB4A 1RZKL 3O6LL 3IGAA 4OQTH 1T20B 3ULVL 3EYVB 1YJDH 2FGWH 5C07B 3M1BA 1G9MC 5ECJE 4RX4D 5TDOB 3FOLB 4DN4H 4KTDL 5GGTA 3O41A 3U79A 2WIIA 5IVXA 4KJPD 1JGEB 5E99H 3BKYL 2CLZA 1I3UA 3C08H 1G9NH 5MENA 3VXRA 5BVJB 2XICA 4L3CB 3ARDC 1XF3A 2FHFA 3H0TA 4IM8A 3S3SA 1ZLUH 1OT1A 3CSGA 1I9IL 3D0LB 3D69A 1PG7X 2GYSA 5C0CB 3RNQA 1GCFA 1BVKB 3ZKQD 5AZEH 1T22B 3BDYL 4KKAC 3VWJB 1VKXA 4OF3A 1NDMA 1ZLWH 1FZMA 4E0RB 1JGUH 5TGBA 4H1LB 1IQWH 5ADPH 4L9LA 2K7PA 4KY1L 1U8IA 1AGFB 1U3ZA 2HTLD 1T03L 3ARPA 4LASL 4G5ZH 1AKJB 3X14B 4Z7OE 1H8NA 5MENE 2FB4H 2C3XA 3T0ED 1FV1A 4UV4L 3GMMB 1CZ8L 1WF5A 5EOTA 5I2IA 3P4MB 3E3QA 3MOBH 3F7RA 4ZS6C 2VLKD 1T1ZB 1A7RH 2A38A 3EYOA 3MACL 5J6HB 4LSRL 5KSAA 1DBBL 4OZGB 3BQUA 2BERA 2K3TA 3FQRA 3LQAH 2E7CA 2F5AL 3FZUD 1UG9A 4OF8A 5SX4I 4F15B 1RVFL 3OG6B 4JG0H 5F8QC 1IAII 3HE6C 4BFIA 4NO5B 4Y88A 3U9PH 3P11L 4G6MH 1KB5B 3UPRA 4ELME 5D8JH 5IGXH 2DIJA 4NQDB 4TRPH 3PWPA 2FX9L 5E5MA 3RX5A 1OGTA 1MQKL 2OMBA 2VR9A 3E3QE 3VWJC 3C5ZB 3QT2A 5D7KE 2PO6C 4P4KB 1FC1A 5A43C 2WBJB 1F2XK 4G6JL 4J3OC 4XCFL 1CDHA 3EDDA 1UGNA 4TNVF 5J06A 1AD0A 3MMEB 5DI8B 1FO0A 4HKBB 4Z7NE 1MIML 3W9EA 5JOPE 5KANI 1B0GA 4IDLA 3RVVD 1YJDL 1FYTA 3BEWA 3ARBA 4PRDB 4M93C 4J4PA 3SDDD 4JY5H 4PJDF 1WEJH 1ZWIA 5MEND 3Q6GH 3ESVF 1FFQA 1C7TA 4XWGH 4RSVA 3RVUD 1ZHNB 4MJ6B 4JHAH 1D6EA 4A2LA 4OM1L 5EO1A 3O3AA 3WEXB 4PJEF 4YHOL 2ZG3A 2HFTA 5AUMA 3PWPE 2V5TA 4XHJC 3OKKA 5I1AA 1RJZB 2DYPB 4YAQB 4ONOA 4I13B 2BVTA 3TNMA 4HUKB 3LIZL 1JWSA 3X3FH 3AXLB 5FGRA 3S5LB 1T7VA 4FTVA 4UINH 3IRPX 5F1IA 1BVZA 1AXSB 3QXDA 5L9DL 5IVZA 2FNBA 5K33A 1SYSA 1FYTE 1I8IA 3P4OA 3MLRL 4JM2B 5GRVK 1S7SB 2EE9A 3RKDD 3OKMA 4XCYA 3EFFA 1CD1A 1JGUL 4RAUA 1XCQB 1A2YA 5ADPL 4TTDD 2YD9A 1Z5LA 3L3GB 3OWEA 3GHEH 5DSCB 3C5ZC 1NKRA 5DMGD 1BD2A 3KPLB 2X4NB 3MV7A 4M9PA 4OQ1A 4P4KC 3PWNB 4UNUA 5SWZA 4J23A 4OGZA 3UJJL 2VZ1A 2WBJC 3P3YA 5MHSE 4O2FB 2C3GA 4NCC1 5ICYA 2B2XH 3HG1A 4MSWB 1BBJB 1MH5B 4N0UB 4WTXA 3HNVL 5BRZB 2OP4L 1OSZA 3UTTB 5LG1A 1I1AB 2I26N 3QEQA 2FSEB 4NYLB 1MJ8H 5IB2A 5IHUH 4FTVE 1NFDF 1N5YH 3RWJA 4G42A 3WIFA 5E1AA 1RZJL 3EYFB 1PY4A 5C09B 5E2JA 1WFUA 1CFTB 1R3IH 3I9GL 4JZJB 1D6VL 4GMSL 2HTKD 2X4QA 2P46B 1E27B 2NNAA 4NKDB 1LE5A 1BD2E 3MV7E 5SWZE 4JQXC 3ULUE 4HWUA 3FT3B 1OP3H 3QULB 4JY4B 5EFIA 1MFEL 1PZUB 3EOTL 1T7WA 2NY6D 3HG1E 1UA6H 3DUUA 4LAJH 1NL0H 5L7XH 4XPAH 1JF1A 5GSVA 3B43A 4P9MH 2H32H 1FNGB 1KULA 3QG6B 5C6TH 3Q3GB 5HYJD 5I8OH 2BVPA 3WLWC 1ZSDA 3QA3A 4JM2C 4NRYA 4PLJC 5DHYB 4RZCB 4GRLA 2APWA 3NTCL 3D85A 3VRLE 4J4PD 5D70L 3WFBL 3VRJA 3HI6L 1OLLA 2EE2A 1NLBH 4F8QA 3L95A 4BFBD 4NNPL 2RFXB 2ZUSA 5FYKD 1IGJA 1JWUA 4PJ9D 1FFNA 1NH6A 3VWKB 3BI9X 4LNVA 2H8PB 1I1AC 1SJXA 4H5SB 1RK0A 3MRLA 2LABA 3JXAA 4JLRA 2ADIA 3BZFB 3QR2A 4KPHH 2RGSA 4OJFH 4GAYA 4PJFF 4TVSa 1K4DB 1MVFA 3JBG7 5I1LB 5D5MF 2Q6WA 3EKCA 2D3VA 3CIQA 5BO1H 1GGBH 4JZJC 5C0FA 4D0BA 5DDHA 3FQWB 1EHAA 1I7TB 3BSZL 4LSPH 5C2UB 5B21A 4JO1L 2X2YA 2NY0D 3U82B 3P0VL 5DUML 1CFSA 4RAHA 3KJ6L 4G8EA 3E6FB 1F4XL 3LH2L 3OPZL 4ZTOL 3ULUD 1GGTA 2J4WH 3SDYL 5K9JH 3VA2C 3TFKA 3HG1D 1TQCB 4M6AA 3EIFA 4U1KB 1MPAL 4HJ0C 3LKSB 2R69L 2DJUA 4HULB 4LFHD 1CFVH 4OAWA 2AJZB 1PX3A 4I4WB 3RWFB 4NOFA 3LKOB 3F7PC 5FCUL 1RQ5A 1FVEB 1SMOA 4UV7L 5TDPA 2P7TA 3O11A 3K74B 5JUEL 2HYMA 2GITA 1MRDL 1MJ8L 3H2WA 3VWKC 3SKUD 5L6YH 4CJ0A 5HY9B 5CJXC 1HEZB 4HK3J 1MF2L 1EO8H 1N2RB 1TLKA 3KAAA 1UZ6F 1Y0LA 4OCLC 4PG2C 3MLVL 4OZ4A 1J0JA 3BD4A 2VLME 4XBPA 2VDRH 3MOQA 2QQKH 2HKHL 2D0FA 5GS2D 4CU7A 5GRYA 2R23A 3KPRA 4AT6B 3T65A 1A1OA 3MJ9L 1HHJA 3SJVB 5AAWA 4UU9B 1E28B 4Y5XA 4JRXA 2OSLB 2O5ZL 4Y4KC 2OZ4A 4MDIB 4ZSOB 5DA0B 1NCAH 4XP6L 2NZIA 4EI6B 4MD5B 3RHWF 1H3WM 1YPZA 4P9HC 5HHVL 1FVDA 3RY5A 5FGBA 4UOJA 3AC0A 1TXKA 4PRHB 1JTTA 1G9MH 2Q8AH 1JK8B 4F9LA 1UENA 4MZ3A 4PJDB 2FX7H 3STLB 2IPUG 2IFFL 5CS7A 3O2DH 2ATKA 3AU1B 1A21A 4ZOAA 1M7IA 4MQSB 5AAMA 5J13C 4YK4B 4PJEB 5IJVA 4G7YL 3ZKND 4OLXH 1T2XA 5GJTH 3GSQB 3LRSA 1Z9MA 3D1MC 1K4CA 4JN2A 4NUJB 3MNWB 4JO4H 4NQSA 4Z9KB 5T1KD 3ZSTA 1ED3A 2NY4D 3HZMA 3BPNC 4JRXE 3C9NA 2HT2D 3EOYG 2ZCLL 3LY6A 2D0HA 3BZ4A 1BAFL 4XVSL 4ZPVA 4LVOB 1OF2A 3KS0H 4EI5D 3H42H 1WAAF 3G6DH 4IMLB 3VFWB 3LN5A 1CXIA 1YPZE 5JOFA 1L0XA 5A1AA 4RNRB 5BO1L 2DBLL 3TPUA 3QUYB 3VCLA 5DD0H 1A6AA 2IFGA 4K8RL 3NZ8B 4IRJB 1YUHB 2VLMD 3OR7B 5H35A 1CE1H 4WEUD 1U8KA 3RI5K 2AQ1A 2QTEA 1Q1JH 1P6AB 5CD3A 5T1DL 1JHKH 4OUOA 4PJHA 2Q86A 4MAYD 4PB9L 3HZKA 3W9DB 1KIPB 1V8HA 5K9JL 2FEDD 3QHZL 1E6OH 1U8PA 1TPXC 1HNGA 4RDQG 1EAPB 2MQ0A 3A0OA 1QO3A 3K8LA 12E8H 3TIDB 2XQBH 3GK8H 1HI6A 3SQOL 2OK0H 2BVQB 3BT2L 4WW1B 1OP9A 3TCLA 5F44A 1H8SA 1JPGA 1S7VA 4GAGH 5I66B 3PP4H 4X7SL 3WXVH 2HT3D 1J18A 1OAUL 1NFDB 4ORZC 2B4CL 3ZZ1A 3NOIA 1CXHA 1NCWH 1FAKT 2VH5L 1QSFB 2MWCA 4QHNA 3JVGC 1PD6A 3DHMA 4QXUL 3TPUE 3CMGA 4XVTH 4YK4C 1DE4B 4PV8B 3PNWB 5KVFL 5JW4N 4JDTL 1ETZB 5BJTB 2C9AA 3OAYH 4XXCA 4ZUWA 3EHBD 4PJHE 1TVBA 1IAKA 1XF5B 3CD4A 3FHAA 3NGBB 4YBQD 1QFPA 3U4AA 5CD5D 4NM8H 3N1PC 4LVOC 4LHUA 4U1JA 4K3HA 4IIQB 1LK3L 5SWQB 5AEAA 1UYWL 4ODHH 2WSKA 2NX5A 1R3HA 1I9JH 1KIRA 3FB8B 5BZDA 3ARRA 5GIRA 3QUYC 1FL3B 2Z92B 4CAGA 2ZSVA 4N0CC 2G9HB 4IRJC 4KMLB 4MB5A 3OJDB 4H1LH 4N0YL 1KUMA 2ED8A 3BH8A 3K1DA 1CK0H 1NCAL 4ZNEA 4W4OA 4MA3A 1CLYH 2B0SH 2KZ1B 3GMPA 3ARQA 3PWUA 2XKNA 5ID1A 1WFTA 3MGTB 3TZVB 1IC5L 2AJYH 2DQGH 4JHZA 1G7HA 3EUUA 5HHMB 1G9ML 1GIGL 2O61B 4HUVA 3PWVB 5CFHA 4BA8A 5HGDA 2J88L 4WW2A 5E03A 4BH8A 4X4ZA 4XNQA 3O2DL 4XX1E 1YZZA 1K5NA 4L3AA 4PDCE 4LDLB 4D8PB 2DM2A 1GZPA 2X41A 5JW4R 1J9CT 1A7BA 4N5EC 5F89B 1MNUH 3W11C 3KR3L 2CDEB 1U58B 4PJFB 3VXMB 5DRZB 2NX5E 5GJTL 3MRBA 4ZQKB 5AZ2H 4BQ9A 5D5MB 5H8DA 3ZE1E 1U8NA 1RK1A 3QIUD 1DDHA 3CDYA 3QWOB 1QBML 2IAMA 4IBLT 4OT1L 3GSNH 4TSCL 3KYKH 3IU3B 4FZ8L 5DJ2A 3TBYB 2FL5A 2OI9B 4V2CB 3C6SA 3GHBL 5DGRA 3NGBC 3MC0A 2F5BH 1I3RB 1KB5H 5CJQL 5IFAL 2NY2B 3OXSA 5D7JB 1B88A 1YMMB 3ZYOA 4EN3D 4IIQC 2VSCA 2UUDH 5BW7C 1AHWC 3SE8L 5FKPA 4M7LT 3IJSB 1JHKL 3DGGB 2CR6A 3FT2A 3MUGA 1T1YA 4H26B 4HIIA 1A4JB 5DQJB 1MCPL 1MCWW 2MKWA 4M8VA 1SY6H 5TQ2H 4W6WB 3TJHA 3FRUA 1I1YA 4Y4HA 5EBMB 1KIUA 1JYVA 1P53A 4MXVE 3PV6A 1U8LA 4M7JL 4XP5H 1NC2B 3G5YB 3TZVC 3JV0A 4E41B 1T4KB 1EUUA 1T83C 4HC1L 4YIQA 3WLBA 3HMXA 5INDB 1I1FB 2BNRA 4YX2L 2LAGB 1ZS8B 1TZHB 1FRGL 4H88L 1NUDA 4L8CB 5F9JA 5FIEA 5FEBA 3S35L 3T0AA 4LCCA 1RUAL 2CXKA 1M05A 4NUGL 4HDIB 3VJ6A 4EDXA 1YEDA 3TBWB 1IKNA 2P5EB 2CDFA 5TPWH 2ZUQB 4CVXB 1F3RB 4Y5VA 1I9EA 4FQ1L 1TJGL 3W2DL 5F3BA 3FB7B 4NZUL 1QNZH 4HJJH 4E5XB 2NY2C 4JGUA 2A6DA 4GRWE 4NSKA 5D7JC 2H6PA 3DRQA 3J8F7 4XVJL 1ONQB 2BNRE 4PTUB 1A0QH 4MJ5B 4JFFA 1XGYH 4PJXA 4S0TD 1TZIB 2ARJQ 3MRRA 4C56D 5HVHB 2IBZY 5I1GH 2YN5A 2AJYL 2DQGL 2F8OA 3O4LA 1GHFH 1OAZH 3KHQA 4P57A 3B9KB 4X5XA 3V52H 3VXPA 5DUPH 3RGVD 5E70A 3MR9A 5E0QA 1VHPA 3QUZD 4F37K 3IKCA 1LO3H 3WXWL 2CSPA 4NBYB 1NGXB 6CGTA 1XR8B 4O4YH 2H2SC 2EZ0C 5AZ2L 3QBTB 3C8KB 4HJGB 4JFHE 4QTIH 1RUMH 4PRPD 1QVOA 2W0KA 3DXAB 2OYPA 2BXZA 2Z4QA 3GIZL 4JFFE 4K7FA 2NXYB 1IKFH 1GRWA 3G04A 1ORQA 4MMZC 1DL7H 1SJEA 5DVLA 5DJCA 1CYGA 1DQJB 2AJSL 3NABL 5EU4A 4K2UL 5T5FL 1ORSB 3SHSA 4QHMB 1R5IB 3O4LE 1KB5L 3ZTNL 3SOBH 4CMMB 1ZA6B 2NW3B 5HHOA 4NM4H 3UROR 2ZUQC 3S3JA 2W65B 1MY7A 3NIGF 3TJHD 4K3JH 4Y4HD 5CJ8A 3QFJE 1EZVY 3CFBA 4APQA 2WIMA 5GGUB 1ODAA 4LLWA 2EYTB 4YXKH 3CXDH 1UC6A 1R3JA 3DGCR 1CFNB 1M6OB 3I02A 3ALWA 5HGHA 2YWZA 1CTOA 5HVHC 3TVMD 5TF1H 2EO1A 4LVEA 1IAIH 4FXGA 2CRIA 1RJYA 2YC1B 2YR3A 3B9KC 3S97C 3JV5A 1JNLL 2BSRA 3FTGB 2C4FT 4WHTA 5DK0B 3O45B 1MCCA 4OGAD 2O5XH 3H9HA 2YMXH 3OV6A 5FA4A 2AQ2A 2PW1B 4WO4B 1KBGL 1QQDB 2Q3AA 3HHRB 3WFCL 1YMHB 5C0RH 3P9MA 2RCSH 5LWYH 4FFVC 2CRYA 3ROOB 3DTXA 4HUXB 3WD5L 5B4MD 3ZDXE 5CBEB 2X40A 2XZCL 4N0RA 2NXYC 2HG5B 2V2TA 4OQTA 3UDWC 2WZPD 2MSPA 2DQFA 5INCA 5EU6D 4OI9A 4NGHL 2AK4B 1BIHA 5MERB 1A9EA 1N4XL 3REVA 5BVPH 1MJ7L 1HK6A 1OW0A 2BK8A 1AD9B 3IDYB 1EA9C 1K2DB 2W0FB 1YNLL 1JRHH 2NY1B 2F53A 2XACC 2ESVA 1JL8A 2F8VA 5EU3A 2JK5A 5EC1B 2ITCB 1MCWM 3ZYJA 1P4LB 1XGRA 4OIIH 3QIBB 5CSBA 3VFMB 1TCMA 3QFJD 3RTQD 4KUCF 1J11A 2FYYA 2Z93B 5FGCB 1ZVYA 4N0FB 1ZLSH 3V52L 2EXWC 4AIZB 5BCAA 1J1XH 3LAFA 3KPSD 2O93L 1EEUA 4LKXA 1AQDB 2E5EA 2ED7A 1NFIB 4XXDB 4LHUG 1L7IH 2EIEA 3OX8B 4ZS7L 4PS4H 5D1ZB 3FCTA 1ZGLB 3DV4A 5I8EA 4X99B 4YE4L 4TUOA 3GM0A 1OSPL 3O3EB 1MJUL 3MREB 3RWIA 4AG4H 2FJFA 4JFEB 4Q0XL 4QTIL 3F65A 5FB8B 3RWGB 1S9YB 4WO4C 5FGSA 5FYJD 3TV3L 2F53E 2ESVE 4PJ5E 4ELKB 4KV5E 5A2JH 1BZQK 4MDJA 2D4FA 4NWTH 2IH3A 3KPPA 2HN7A 4JDZA 5DS8B 4APQD 5D93C 1NAMA 3T8XA 4LOUC 3IXAA 4XHQA 3UTSB 4NM4L 5E6IB 3WIHL 4ETQA 4OFKA 3C60B 3STZB 3IDYC 3GSVA 1KG0A 2AJ3B 4H25B 4OCMC 1J1PH 5DMIH 4YXKL 4CUCA 3CXDL 1IMHC 2NY1C 4DQOL 1A5FL 4KJYA 5AG9A 3KNBB 4X6FA 3U0PA 2XOTA 2HH0L 1QFWM 4FXLA 3X13B 4C57C 2VDPL 3AS3A 1YEKL 1G0DA 1MFCH 3IDNB 1HCVA 1NUGA 4IOSD 4QRRA 3BP5B 1MFBH 4HXAL 4DGYL 1MFNA 2O5XL 2QADB 4DZBB 3KPOA 4NJ9H 4LIQE 3QI9B 1WWBX 1BVLB 2A83B 2X4SA 3BEVB 5D1ZC 4ERSL 5I8KH 3K8MA 5IR1A 2NXZD 1XH3A 3BUTA 1K8DB 2RCSL 3TT3H 1UB6A 4GOSA 4P2OA 1OB1B 1XT5A 4HUNB 4FMFA 2BNQA 4WHYH 1CICA 4Z7UF 5HI3D 4NDMB 2AEPH 4XP1H 3O3BA 4HW6A 4YHPA 1DBAH 4HKXB 2V17L 1A1MB 3LZFH 4P23A 4PJ5D 5F21B 4QGTA 3CFJB 5C0BD 4KVNH 5JLZB 1JPST 5BVPL 5AYQA 3SDCA 2BNUA 4P9HL 4S1QH 4QRRE 5DJXB 3FQUB 4JHBA 3IDJA 4MNQA 2UV3A 3DMMA 2XTJE 5ESAA 3RWDB 4XNXL 3C60C 3FAWA 3MOAL 3T09A 2UYLB 4OIIL 4MD0A 3KWWB 1I85C 1TJHH 3IDMA 3BHBA 3OTTA 1EVTC 3GJFB 1T89C 1UXSB 1OHQA 3RU8H 4HV8B 2VMFA 5HBBA 1X5XA 1ZANL 2VDOL 3V7AE 3VFOA 1CFBA 4WNQB 2BNQE 4G3YH 1V7NL 2VXQH 3TLRA 3TPKA 2FD6H 3LD8B 5DD6B 1ZVSA 1P7QD 4JFYA 1CI5A 2R2EB 4PRBB 3KLAA 2A0LC 5JXEA 2QADC 3NCJL 1QFUH 1VEPA 2MPAH 1OAXH 3QI9C 4N90E 4Z0BH 3MBXL 4HWBL 4MNQE 4ODBD 5DR5L 1FN4A 2KL6A 4WENB 3DX8A 3OJ2C 4M1CC 4QYOA 4U1SA 1JYXA 1FNFA 5HD8D 1VDGA 5C2BL 3Q1SH 5HI4D 1P69B 3BO8A 3NA4A 3OKNA 3UAJD 4BK5A 2OMNA 5JHDD 1WUNT 4F57L 4HD9A 2P5WB 2ERJB 3BP6B 3T77A 3PXHA 4RAVA 2VQTA 4M3KB 1UZ8B 4HX1B 1F90H 3Q5TA 2ZCKH 4S10A 2GY5A 4P2QE 1IARB 1T0NA 2BDNH 5I1JL 4NQVB 1BFOA 1F11B 3S37L 4YFLI 5I16B 1BJ8A 2Y5EA 3MROA 3VD4A 4DTGL 5KS9F 1YN6B 1RJCA 3RVXC 4KI5D 3I6GB 1IEBA 5DO2D 1CBVH 1HHKA 4XP9H 5ICZB 2DQEH 3ROLB 3VU2A 1U9KA 4JJHA 3V6BR 1BLNA 3LD8C 1RFDH 3CU1A 3JWOC 5IMOB 2WMPA 4OF7A 4GG6A 1EGJA 4HUUB 2BRRH 1KTDA 4MVBA 1FORL 1Y18B 5DZLA 1L7TL 4OD1H 1U8OB 1KIQB 1GOGA 1AGDB 2NLJA 3U4BL 4PGJA 4KROD 2Q7YB 2OQJB 3FHQA 3BUYB 2JB5H 4XP1L 4OCXL 3JTSB 1DBAL 3DMMD 1JN6B 4D9RD 5D9SA 2A9NH 2ORBL 3WUWA 3VFVB 3GMRB 3QCTH 2IF7A 1G6VK 4MS8C 4V1DD 3TBTB 2ERJC 3WFHA 5TQ0L 1IGMH 32C2B 4XCEA 3VI4E 4Y19B 1NANI 2E6QA 3NMEA 4GG6E 4FG6D 1LEGB 3PHQA 1A6ZB 2Y36H 1RURL 1TJHL 3KPNB 4P2QD 5EZLB 1D5IH 2GW5A 2VAAB 4NJAH 2EDXA 3ZDZE 5DJ6A 1FLRH 1I8MA 3B2UD 3SBWA 3BXNB 4PGBA 4LCWB 5IVXF 3MV9E 1U3HA 1U42A 2OL3B 5ENWA 4FNLH 5J1SC 1CLZL 3GMLB 2Q87A 4Z7OF 1H15B 3ZE2E 1QFUL 5GGQH 3L5WA 3MRJB 1FNEA 3SEPA 1IM9A 2R1WA 3MNZA 3AREC 3HR5A 1ZTXH 3TYGH 4Z7VE 3UYRH 2AJXH 3Q1SL 4MXQD 2FWOB 1UM4L 3ZL4L 1CG9B 3CH1B 2IMNA 2G60L 5E8NB 1NGQL 2DD8H 2R29H 2V2WB 1CDYA 5LGJA 4D0CA 3TNNB 3L9RB 5DRXA 4WUKH 2FO4B 3MFFB 4KK9C 3EO1B 5EU7E 3L1OH 2AK1H 4ELMF 1KEMH 1EERB 1KENL 1XGPB 3SDAD 4IHOA 3VFNB 3UX9B 2ZPKL 5DMJB 3U9UB 1ZT4B 4G6FD 4S0SD 2YUWA 1AY1L 5KAQF 3KXFB 4N8VA 4MVBD 2GCYB 4GH7B 1HIMH 3FB5B 3EO9H 2EEDA 1J1OL 4UDTA 1QLEL 5IV2A 5F7EH 3BPOB 4JPWL 4BQBA 3CVHA 4U3XA 1UACL 4M1GL 4OV5B 4Z7UB 4Z7NF 3TN0B 1M7XA 2QHLA 4QRPE 4ODUB 3MV9D 3HC4L 4YFEA 2Q76A 5D7LB 4L8SB 4E9LA 4OD1L 2VQ1A 4F7PB 4I2XB 1BIIB 1UWEH 2VERN 3LEYH 2XG4A 4P0DA 4PJ7E 1AO7B 2DQUL 4R96A 1JZ7A 1DQDH 1LO0L 4AEIH 5D96B 1KN2H 4G6AD 5DYOB 3HAEH 1TETL 4FQXB 2XTLA 3SE9H 1JHLL 2GQHA 4WWKD 3OJVC 3WO4B 4Y2OA 3REWB 1KCLA 1PSKL 3JTTA 3JV4B 4TNVK 5EIIB 4FA8A 3ARDA 1SM3L 1L0YA 2AXHA 4MJIB 1IGML 1ZT7B 5IESL 5FK9A 2DWEA 2XFXB 1NJ9A 1QPXA 1KN4L 2WNGA 4M6ML 3WDJA 2J7LA 3ZKMD 1NGWA 1MHPL 4FQJL 4NFCA 5E8PB 5EU5B 4MXWL 4C4KO 4X6BB 3V7AG 1QUNA 3LSOB 4MX7A 4OFYA 3QDGA 2XRAL 4RDQF 1A7PL 5JW3L 5F1SA 4Y16B 2DJ4A 1I3GL 4YGVA 1NBQA 2Z31A 4PREA 4I0PA 3RUGA 3CK0H 5F7HA 1DFBH 5FA3A 5ISZB 1S9WB 2BOBA 1E4JA 4U1NA 3QXVA 4OZIA 4FNLL 1LDSA 5E1HB 3BPOC 4V3EB 1FFOA 5L88L 5DJ8B 5IOPA 1R3KB 1D5MA 3TN0C 5GS1B 2ICWI 3WIIL 3VFUB 1EUTA 4PJIA 4S11A 3DVNB 5J7CC 1IE5A 5CAYB 3F6LA 3ARFB 1VB9A 4L8SC 2E27L 2E9IA 4QRPD 2XQYG 4JZNB 5LQBH 4OM0L 3TYGL 2V5YA 2F58H 3JSSA 2P4AB 5B38A 4HG4K 1MCBA 2Z0BA 1QBLL 3WNMA 3RPKA 4WU7B 1DEDA 5D96C 4MJ2A 5IFJA 3G5ZA 3JWDC 3QDGE 3LKPA 4FQXC 4OGXH 4ONHA 1D5BB 3A6BH 3RUGE 3WO4C 4WJ5B 3HE6A 5KS9B 1T0MA 5FOBB 4NFDA 4TN9A 4A6YL 4OZIE 1WITA 4OLUL 3MRKB 3RBGA 4PJ8B 4JZOB 1DUZB 4Y1AE 3LRHA 1SYVA 2QKIB 1BVKA 4Y5YB 5EIVA 1T22A 4PJIE 4QY8A 1WT5A 4S2SA 5CEYB 1MHHA 3B6SB 1TJIH 2PO6A 1XMWA 1KXQE 3CFIC 3VRLF 4R7DA 1CD0A 4HFUL 4XH2A 4Y16C 3GBMH 1MFAH 3S88L 4UB0L 5C70A 4QRSB 4Q9RH 4QLRA 1S9VB 4XMLH 4ZUVB 2DQTH 2ID5A 3MRHA 4KAQL 3SPVB 3RWEB 4NPYB 3BN3B 3QWRD 4HS6B 1KPUB 2MHAB 1EEZA 4JO3L 2XWTB 4OD2A 2HFFA 3DX6B 4OV6F 5GS1C 4DOHE 5CJOH 3OXRB 4L4TB 3ARFC 1RULH 3AAZB 1MCQA 3B5HA 2AJVL 1KN2L 1CE6A 1HZHL 1QRND 3QEHB 3WHE1 2IPKB 3RIAK 2DB8A 1GL4B 4AEEA 2ICWJ 2CLVA 5EBWB 1OCWL 3FFDA 5IB4B 3IGAB 4WI7A 1TMCA 3M1BB 3SDXA 5ANMA 4OSUH 3EDKA 1KFAH 3GSNA 4LF3B 4UTBH 4NRZA 1HOCA 3FONA 5HJ3A 2HTLC 4NO5A 3L3DA 2Z31D 3O41B 4I0PD 4RGMB 4TQEH 4U1HA 5IBTL 1IFHH 2WIIB 2W07A 1N3NA 1KTLA 3HRZA 5IVXB 1JMXA 3MRFA 1OOAA 2FHCA 4U4BA 4PJ8C 2VN4A 1KTRL 2CLZB 3SDDB 2YD3A 5MENB 1OM3H 4YHLH 1RIUL 2E6JA 1MAML 4Y1AD 5CZXC 3VXRB 4ODWA 5F1OB 3WUWG 3BYTA 3H0TB 3OGOE 2WBJA 3TC9A 3ZHKA 1H0DA 1VFOA 3JUZA 1II4E 3SKNA 3D69B 1SY6A 4F33A 3RNQB 5DQDL 4HG4J 5D1QA 2A9MH 2MQCA 4Z77A 1QKZL 3SDXE 4ZO7A 3FZUC 4JKPH 1VKXB 2XZAH 3BP7A 1NDMB 1ZHKA 1FZMB 2DLIA 5TGBB 1LO2H 4QEGA 1E4WL 35C8H 1SMAA 4L9LB 5GS0D 4OLYH 1AFVH 2EDEA 1U8IB 1TTGA 2E7BA 1A7OL 1VGEH 2VLLA 3MFGB 1E6JL 4BFEA 2OR9L 1TQBB 4NQTA 4ZFZA 2CK0L 3BKJL 4ELMB 5HPMA 3NCYS 3QNZB 4UNTA 1FV1B 1Y6KR 3A6BL 1FNSL 4FFYH 5EOTB 5I2IB 1WSST 2IANA 3GJFH 1Z9SA 2ZUXA 4KKBC 5DLMH 2N4IA 3QPXH 1KCUL 3IFPA 4OGYH 3S5LA 3EYOB 4RMSA 3MLSH 5KSAB 1CQKA 3QDJA 4RGMC 1GYAA 5EC2A 3BQUB 3JWOH 2KKQA 4MYWB 3K46A 1EAJA 3FQRB 1UH4A 4IS6A 3SDDC 4D9LH 4XBGA 1JF6A 2Z9TA 4R2GD 5C08A 4BK4A 1XCQA 2VISA 4LPYA 3RVUC 1O0VA 4BFIB 1J5OH 3KPLA 2R0ZH 4FABL 1WLHA 3UPRB 2YRLA 3TH3T 2R0LH 5LBSL 2DQTL 2WUCL 4M6OL 3SE4C 4EJ1C 2X4PB 4N0UA 4UBDC 3FT4A 4O58H 3PWPB 3OKYA 4R3SA 5E5MB 5BRZA 1OGTB 2IANE 5JXAL 5GHWL 4TVPE 5ILTH 4WI8A 5TE6L 1FC2D 2I9LA 5AD0A 1MREL 1RZIA 3QDJE 3E8UH 1NLDL 3WYRA 1S9KC 1AD0B 1BQLH 2X9XA 1FO0B 5HHPA 4N8VG 2YUZA 3BH9A 1YPZF 1DQLH 1NEZA 3W9EB 1TQBC 3IFLH 3QNYA 1B0GB 3RKDC 5C08E 3C2SA 1FYTB 3BEWB 3SKMA 5DJYA 2DMBA 3ARBB 3CLEH 4TTDC 4OSUL 1F4WL 4LHQB 1ZWIB 4UTBL 5DMGC 3DSFL 3SCMA 1MVUA 3QQNA 3E3QC 1BM3L 4Z7WA 1PYWA 1D6EB 3CCHA 1AXTL 4YHML 3GSXA 5EO1B 3O3AB 1MI5E 3BWUC 5AUMB 3AM8A 4P46D 3OKKB 4MCZA 4YHLL 5I1AB 3BQUC 2R2CA 4I8DA 1RUQH 1EHLL 1BFVL 5D2NA 5EZIL 3TNMB 3E6HA 1JWSB 3MUJA 4XNUH 5FM4A 2EKJA 4U2YA 4FTVB 4ZFGH 3MTRA 4EIGB 1WWCA 4LU5L 1TVHA 3QXDB 1L8JA 5IVZB 2RFXA 1SYSB 4FQCH 2E8YA 4LEXH 2YA2A 1I8IB 3FQTA 2HTKC 3P4OB 2XZAL 3D9AL 3GJEA 3OKMB 5TFSL 4XCYB 3EFFB 2GAZA 1CD1B 4R4NC 2DICA 4RAUB 5C8JA 3ARZA 1A2YB 2NTSP 4LSUH 4EKXA 1Z5LB 2XI9A 5GGRA 1BD2B 1LK2B 3MLUL 1B2WL 3MV7B 2D9CA 4NP4L 4PJHF 5SWZB 5CSZA 3BYYA 2IAND 2IG2H 5FYLE 4YDLB 2NY6C 2DQCL 2PXYD 4FQQA 1T1XA 4BSVB 1UJTA 2VXVH 3V2AR 4JAMA 5ICYB 3HG1B 1EXUA 2JLLA 4JREB 1HKLL 3N9GL 3RRQA 4FMKA 3QDJD 1OSZB 4L5FH 5D2NE 3QEQB 2H3NA 5DFVD 5IB2B 3HI1A 3ARBC 1CGSH 4J4PC 2DN7A 5K9OA 5I1KL 2VDKH 3RWJB 1O7VA 4G42B 3WIFB 5E1AB 4Y4KA 4B41A 2BCKA 3N1QC 2OL3H 2X4QB 3QIWD 3R1GH 2NNAB 5B38G 6FABL 4XCCH 1LE5B 1MI5D 1FE8L 4FQ2L 3F8UB 1ZHLA 5EFIB 5B39A 1AC0A 2VABA 3DUUB 1JF1B 2OJZH 5GSVB 1IC4L 4QKXB 3IFNL 2BVPB 3UC0H 2VC2H 5ILTL 3B8YA 1ZSDB 3QA3B 4TNWK 4LKCA 1NFKA 4NRYB 2PCPA 2HJFA 4GRLB 4UT6L 3ZE1F 2D4DA 4XPTH 2NY0C 2WUBL 3VRJB 3ARGA 4G9DA 3L95B 4M62H 2UVEA 4LRNL 3ULUC 4XP4H 2X4RA 4IRSA 4ZPTA 5EOQH 1XIWD 1IGJB 3CDCA 1JWUB 4CVZA 1FFNB 4Y2DA 3T08A 2UZXB 15C8H 4HXBH 1FZOA 3VA6A 5FO9A 4WW2F 1HKFA 1IT9H 1RK0B 1T2QL 1H9VA 4P4RA 1UADC 5HYQB 3MRLB 4JLRB 3LEVL 4JFDA 3RZCA 5FUOL 2ADIB 2WINA 3U7YH 3GZKA 5HYSA 3MUY1 3RZWA 2Q6WB 5CLTA 5CJBA 5C0FB 4D0BB 4GAFB 5DDHB 1Q9LA 1UWGH 4MXVF 5DEZA 3CJJA 4X9HA 1NGPL 1Q38A 1EFXA 1AE6H 1CFSB 4G8EB 4ZNCD 4ONFH 3X3GL 4KHTH 4OKVA 3S8WA 4P5TA 4ZXBA 2FLRT 4WTZA 3JWDH 2IBZX 1VPOH 1S9XA 2VDLH 4KC3B 3QXWA 4X9GA 4JFDE 2JTDA 4OAWB 3MRNB 5E4EB 1J12A 4JE4B 4XMKH 5T3XH 5CILL 4QCIA 3OHXA 3IS1X 5TDPB 1J8KA 1IGYA 4FXKB 3O11B 3D2UD 1PLGH 4CNIA 4I18B 2J8UA 1XF2A 2GITB 4JPKH 5F7DB 1C12A 2B1AH 4GRWF 3QFDA 2I60L 3CVIL 4YDIH 1F6AA 3P0GB 4N0CA 1P5VA 4J3WA 2MCPH 3PHOA 5T3ZL 3QNXA 5CEXA 5JZ7C 4M7LH 4PLNC 4LVHC 5MP6L 5EOCH 5A16A 4OZ4B 2OL3L 4RBPK 3ZKNC 2CIKA 4XBPB 4U31A 5J9PA 2P43B 2R23B 3T65B 1FCCA 3V4PL 1UEYA 2NY4C 3Q6FA 3VI3E 3WFEH 1YEGH 5KVGL 1U91A 2HT2C 3ARWA 4S1RH 5EH1A 1S7RB 3U0WH 4Y5XB 1QSEA 2OJZL 4EI5C 4HMEA 2IEPA 4JRXB 3BKCH 4K7PH 2J8UE 4WIQA 2W0LA 2HFGH 3UJIL 4FFWD 4LL9A 2VDQH 2MKLC 4IRSD 3TFKC 1CU4L 1YPZB 2EDJA 1FVDB 3S5LG 3ULSB 2BJML 1DE4A 3SO3B 3PNWA 1U6AH 3M45A 4CBPA 1OPGH 4DVRH 2C5DC 4PJXF 3M8OH 1WZKA 3ARTA 1DN2A 4LLDA 5JIKA 1HINH 5E4EC 4MAYC 4XP4L 2ATKB 5EOQL 2FEDC 2EDFA 3RZCD 1M7IB 5F6IB 5IMMA 4YXLL 5IJVB 3RIFF 3ET9F 4I18C 3LRSB 3OKEA 4FFEX 1UJ3A 1K4CB 4OD3L 4BKLA 5DTFA 4JN2B 1AHWA 3FO0H 5ABDE 5LCVL 4NQSB 2IWGA 3OAZK 1ED3B 1FL3A 5I1IL 3HZMB 1QSEE 3C9NB 2VOTA 4ZPVB 4BELD 1XZ0A 1OF2B 1QBAA 2DRUA 3V5KA 5JOFB 4K7PY 1QZ1A 2BP3A 2Y06L 1XF1A 5FOJA 1KT2A 4P5TD 3QIUB 3ULVD 3TPUB 2D7TH 3FO2A 3VCLB 1A6AB 4GBXA 1AE6L 1NEZG 5DHXB 1U8KB 4XAKE 1IC7H 2YPLD 5CD3B 5DFTA 5KG9A 4XPFH 4YBQC 5BXFB 4PJHB 2Q86B 3FMGH 3HZKB 4Y5XC 1NBVL 5E6YA 2VDLL 1QO3B 5DRZA 4OLZH 4PP1D 2OTUA 1HI6B 4JQIH 3RDTA 3WN5A 2D03H 3HTLX 3K4AA 3SO3C 3ZDXF 5FGBC 3TCLB 1BQHA 3LEXA 1JPGB 2AAVA 4LGSB 1S7VB 4F9LC 3HE7D 5HYIA 3TF7A 1PJ9A 4TULL 4HF5H 2VLJA 4IDJL 4NZRH 2P8LA 5GZOD 4QHNB 1DP0A 4U7MA 1C16A 1ZEAL 4M00A 3W39B 5ESQA 1GJIA 5F6IC 4HT1H 3C6LD 4YDIL 2ZUTA 4TSBH 3Q2CA 4ZUWB 1DANT 1TVBB 1IAKB 2XN9E 1NKOA 2YOCA 4JVWA 3AS2A 4AQOA 4K23L 1BQSA 2NY7H 2AV7A 1G7PA 5CGYD 2HVJA 5EOCL 4AENA 5TJWK 3RAJH 1LO4H 4LHUB 1QSED 4U6VL 43C9A 5EIQA 2GJ6A 1YY8A 4U1JB 3A6OA 3D0VA 2R4SH 3B9VA 3V0WL 4G80A 2NX5B 4M48H 5EA0L 1R3HB 4XTRD 3QIUC 1KIRB 5BZDB 5GIRB 1W72H 2ZSVB 2BY0A 1MFDH 1AH1A 1JPTH 1S78D 3H9SA 2MJWA 5C0AA 3V4UH 3BH8B 1HXYA 5JHLL 4C4KT 1MEXL 4GQ9H 4MA3B 1JGDA 4HK3N 5CINL 5GGVY 5J1AA 3GMPB 4B53A 4K94L 3PWUB 5T33L 2XKNB 5KJRL 4DCQA 1G7HB 4F7CA 2CGRH 4HUVB 4DVRL 1PGRB 2EH7H 3M8OL 4KV5