4PGEA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgeA01
3GGWB 5DK3A 2BSTB 3VFTA 3R0MA 1QLRB 3REVA 3PXHA 3RVVD 2W9LA 3ARBB 4X7TB 3VXRE 2UV3A 5DJCA 4RGMC 3IKKA 1MELA 3T2NH 1QFUL 3MLTB 5IMLB 3ROLA 3BDYH 1G7HA 1KLFA 5JOEA 3STLA 4ODWA 4KJYA 2I9TB 3UAJC 3TO2B 1RULL 4WY7H 4P23C 2ENYA 3LN4B 5DD6A 4XCEA 4XNYL 4R90L 4MA7H 5DO2C 3MFFA 3VG9B 4Z7UB 1OGAA 3MRKB 1YEHH 4GKSB 1IAIM 4OJFH 4YUEH 3IDUA 3MRFA 5TQ2L 2BERA 2DQCH 3SDXF 2P24A 3HRZB 1DBBH 1KJ3H 5D6DA 4F9LA 2H32H 4P3WA 1OAZL 4P2QD 4E9LA 1CD1B 3NCEB 4NQSA 1A6UL 4JZJA 4DK6A 5HYEA 4TTDD 5FKAB 1MFEH 3CDCA 5I76A 4LPXA 4X4ME 1RJYB 5C0BE 2X89D 2I60L 3QG6A 2W65B 5EFIA 4EI5B 4GG6A 2Y1VA 4PB9H 5DT1H 3VU2A 4CW1B 2Q3ZA 4P9HL 1F00I 3Q6GL 3TBWB 3BRFA 4NDMA 4OM1H 3BPOC 1IKNA 4FTVD 1WTLA 1AR1C 4IMKA 4X8JB 3CU7A 5F3BA 1ZHLB 1X5KA 2R2HB 5EBLB 5KSBE 4Q0XL 1DEDA 3BH8A 3IFOA 4LL9A 2F8OA 3RWDB 3U1SL 3JV6A 4MA8L 3P0VH 3V95A 4OLXL 2IAND 3KXFE 4PJFE 3GRWL 1AI1L 2NNAA 4OLZH 2PXYB 1QLFA 4R7NA 2R1WA 1JHLL 1T7YA 3SKUD 3TYFA 4XC3L 4XP6L 1UXSA 3WBDA 3IRPX 1S9YA 3S3PA 1FDLL 5EIIA 4UI2A 3OBAA 4AG4H 3QUMH 4FMFA 5I1GL 2R4RL 4GRLB 3OAZK 2D9QB 1CQYA 2UVFA 1CT8A 4LSVH 5KG9B 3AC0A 1I3VA 4JM2D 1I8KB 1JGLH 1AY1H 3C5SB 1SYVA 1KPRB 5T1KB 2X1WL 1A6TB 1IMHC 4FZ8L 1MCWM 3HI6L 3Q1SH 1OGAE 5EU7E 3CLFL 2EE3A 3MJ6A 4UDUB 1A6AA 2PO6D 3O8XD 3KVQA 4PTTA 1JWUA 4XVJL 1X6LA 4JFEB 4JFPB 3QQ4B 4ZUTA 1HXMB 5B22A 5F9WC 4PRID 1YUHA 4PBVC 4G9DB 1G7LB 4FXLA 3SDXB 1GOHA 1E6OL 1F58H 1T66D 4NYLB 2BSRA 1HI6A 2DLHA 5T1MA 4P46B 5LQBL 5A2JH 2NLJA 3HPJB 4GQ9H 3EZ8A 3WS3B 4LLYB 3V6OA 3D85D 3RIFK 2VZSA 2D7NA 2PYFB 2B1AH 2EC8A 4PGBB 1D5IH 3QCVH 3W39A 3R06A 3DROB 5JIIA 1ADQL 1OPGH 2DWEB 4CAGA 4P4KA 3WJJC 1YNTB 3MJ9A 3O4OC 4V1DA 3U30B 5JA9A 1I85A 4GBXC 4MA7L 2Q6WA 2B2XL 2WBJC 5BS0A 2VIRB 5BVJB 1JI1A 4K3GA 3WIFA 3TF7A 1MUJB 4OJFL 2VWEC 4YUEL 4EJ1C 3MV8A 1ETZA 5FA3B 1LP9F 4NWTH 1W0YT 1AHWC 5J4MA 1RUML 1LDSA 1KJ3L 4H88H 4ZO9A 4LOUC 3RVXC 4N5EC 1IQWL 1NKOA 3NIFF 4NUJB 2X4TB 2JJTC 4XNMA 2BSED 1AGBB 4R2GC 2A6DB 2XV6B 4LHUD 4M1GL 4MDJB 2ZUXA 3CFKA 2FX7H 3RZCC 1MCRA 3HI5H 5FO8B 4Y5YC 5IK3A 3BUTA 5HYJB 4POZC 4YFLI 5E99H 3VRJB 3VFOB 3D25A 4GFTB 4YXHH 2WLZA 5DT1L 1I1YA 4RIRB 1T03H 3GSNA 4BQ9A 4GUPB 4MD5B 2B7DT 1B0GB 1KIPA 4U1GB 2VDLH 4HQQH 4HPYH 4OFYD 4R4NC 5F1OB 5IBUG 1NGZB 4CMMB 5K9KA 3S3SA 3FN3A 4N0CC 3EBAA 4M93B 2X1PA 1FL3A 3QUZB 4FFWD 3PABB 4ZODA 4DFIA 4QLRA 1SJEB 4M43L 4U1HA 5A3IC 4WWKA 3P0VL 4G8IB 1WUNT 1IE5A 2V2WB 2VDOH 4RA0C 3X13A 1D6EA 5GRJH 1GXEA 3N1QC 3RWJA 2ITDA 2VXQH 4NKDB 2KH2B 3IJSA 3ZTJH 4KKAC 5ESQB 3SJVD 2Z93A 1OVZA 1T20B 3OKEA 4OZ4B 4TPRL 1B88A 1DQJA 4DGVH 3MREB 1I1AC 3V6OE 2HFEB 4UUJA 5J6GB 2HKHH 5E4IA 1N64H 3W11C 1BZ9B 3KS0H 5ESAB 4WW2A 3U83A 3D3VA 3RA7L 4RMTA 4XC1H 4LSVL 1FFQA 3T4YB 4MNHB 3NPZB 4V1DE 1DDHB 1JZ7A 4JN2A 1BQLH 3MNWA 4RFOH 1N0XL 3GSRB 4G5ZL 2IBGA 5KW9H 4TULL 2ADGB 4M02A 1RY7B 1KJVB 2Y36H 4DN3H 3DV4B 1KNOA 3GKWH 4AENA 2ZUSA 2FO4B 4PBXA 3JTSA 4QCIA 4WDIA 4ZFGL 4YO0B 2VLKE 4Y4HB 3L3JA 3PXJA 2NTFB 1LP9B 2OBGA 1F58L 4KK8D 4M00A 1OW0C 2BDNH 2UYLA 4QRPD 1JNJA 5L2KB 1WCBB 4XAKD 2VR9A 3DPBA 5JPNB 4LNVA 5DQJB 3O41B 4HS8H 1WBYB 1D5IL 4K94H 1ZANH 4JO3L 4OT1H 4YEEA 3NZ8A 1OPGL 4UQ2B 5EC1B 1BLNA 1B6DA 2EDWA 2YK1H 1QZ1A 2RCSH 4GOSA 4M48L 1IT9H 4O5LH 3PHQA 3E6FA 1NEUA 3T1WA 3U4AA 3IAQA 5C3LD 4P23A 3Q48A 2ZJSH 4KUZH 4G8GB 5E1HB 3L1OL 3W2DH 3CVIH 1PLGH 4U1SA 3PWVB 2OZ4A 3WLWC 5F21B 2FWOB 2CLZA 2ED8A 4NWTL 3RVWC 4JFXB 3H6JA 5C0AB 1ZVSB 3MNVB 4NRZB 3RBGA 5E9DE 5EA0L 2C26A 4OUUB 2I07A 1W8OA 4WWID 4DTGH 2WINB 3GHBH 1TETL 1DBJL 1EH9A 4K9EC 4A2LA 4JDZA 5JUEH 1X5GA 5JDSA 4JN1H 3RDTC 3V79C 1FN4B 3PGDB 2ZPKH 1X5HA 1D5XA 1FGVH 2YZ1A 3H9SE 4YXHL 3SCMD 1LEKA 4JCMA 1HH6A 4EXPX 3VXPA 4LPYA 3D3VE 3KPMB 5C07A 4KTEH 4M7LL 2VDLL 3VWJC 2WWMD 5DJ8A 5LBSL 2CIIB 3L3OB 5F7NC 4OCYH 3NOIA 5C09B 5E5MB 5DJ0A 4KTYA 2MOVA 5IWLC 2R29H 4I3RH 3K8KA 1KB9K 2YEZA 1NGXB 4GKZA 1QSEE 2VDOL 3NFSL 4LGSB 2R0LH 1WZ1H 5GRJL 3JTTB 3ULUH 2VXQL 3HC0B 4YC2C 4CGTA 5E6ID 4I0KA 1LK2B 3QDAA 2BC4A 2VDQH 4PRAB 3ZKMD 3TNNA 3AY4A 3B9KA 2FJGA 4ZNEA 1MLBB 2PYED 3ARZA 3HCVB 2P5EE 3IKCB 4I9WE 1ZT7B 3ZDXF 4HG4K 4ELKA 1JZ6A 1NBYA 4NQXB 4K2UH 1T0NB 3HUJA 3G5YB 3BHBA 4NBXB 3L5HA 4QOKB 4UNUA 4MJIB 3RVVC 1AGEB 2W0KA 4KXZH 1R5IA 2ESVD 1FSKC 1IM9D 3TA3B 1S7SB 3FQXB 4RFOL 4LCWA 4S0SD 4NO0D 5BQ7B 2A6IB 1Q0XH 1A6ZB 1YC8A 5HGAB 2X4QB 5HSFA 3GKWL 1KTLB 2A83A 4BZ1H 8FABB 1RMFH 5H2BA 4U7MA 1Q9LB 2ENSA 2HVJA 5DEGB 4ZFZB 5C0NC 1MHHA 3X3GH 3QFJD 4TTGA 1KYOK 3BPNC 3OX8A 4U3XA 1I4FB 4PJGF 1MFAH 1ORSA 1A14H 3BPOB 2BRRL 3QUYB 3HZVA 3L3KB 5DHVA 5DQ9A 2G5BA 4HS8L 4K94L 4OT1L 3O6FD 4HWBL 1MHEA 4TTDC 3IU4H 2JJSC 4JFOB 2YK1L 4XT1C 2GJ6B 5C07E 4ZO7A 1A3LH 1CDYA 2RCSL 3CVHH 4OLUL 4CDGC 3TN0D 2YPKB 1IT9L 2VKXA 3Q3GB 4N0FB 4O5LL 2ED7A 1P4LA 1ZT4A 1TJIL 4Y4FC 3RIFF 5DMKA 5JMRA 1EK3A 5DRNB 1CGVA 4KUZL 3W2DL 3VGBA 3AMLA 1U0QA 1A2YA 3CVIL 2WBWB 1PLGL 4IRJD 1P7HL 4S1QL 4H1LG 5D2NB 3RTQA 3BIKB 4N9GA 4IDJH 4OGXH 1I7TA 3FB7A 4XVSL 4I5BA 4JY6B 3DX9A 1UM5H 4L9LC 3EO9H 3U2SB 3D0VA 1A7NL 4DTGL 3UJIL 2N7AA 1WF5A 3GSUA 4JO2H 2F5AH 3M45A 4L4TB 4N5EA 5JUEL 2ICEA 3EJYD 2JJTA 4AEIH 3V7AE 4M3JA 2YWZA 4G7YL 3EAKA 5KN5B 2ADIB 3HUJE 4M7ZB 4UINH 1NMAH 4N8PA 3ARDA 5I30H 4U0RB 1R3IH 1MLCB 4WFFE 4HZLB 4BJLA 4Z7NE 1UWGH 4LSPH 4E5XB 4JRYD 2A73B 4JRXA 3U82B 4WU7B 5GRWA 1J5OH 1JGEB 3D9AH 2FL5A 3FQUB 3KLHD 3OB8A 3QNXA 4YHPB 5T3XH 3B3IA 4GLRH 2LTQC 1J1XH 2WWKO 2NY5C 3W0WE 3KPRB 3VJ6B 1MJJB 4YHNB 1I7ZA 3U4EB 1QKZH 4U6VL 2VABB 4XGZA 3A67L 4AY0A 3LHPL 3UXFA 5JW4Q 1ES0B 2FGZA 5SWSD 2R2CA 4QRSB 3OPZH 4I8DA 2G2RB 5CBEB 2BNUB 2PO6C 3O8XC 5FA4A 3ZO0A 4PJHA 3V7AG 4U1NA 4BUGA 5DFWH 3O4OB 3VH8A 2CXGA 1M6OA 3INUH 4DGYH 5KAQG 4PJGB 4K2UL 2DTML 3MRLA 5D7KD 5C0RH 1UWEH 4L3ED 3MLVH 4PJIF 4X9FA 5IM7A 2NR6D 2YD6A 4XHQA 4EUPA 3VI4F 1T66C 4X6DA 4LSRH 3PUCA 1G7MB 2ICCA 5C8JA 2OTWA 1T1XB 1Q0XL 4IIQA 4FFEX 4LLVA 5EOTA 1FC1A 1T04A 3WKMH 3GO1H 2OK0H 2BX5A 4PJ5A 3HE7D 4K8RL 4R2GB 5IROC 2CDEB 4QWWD 4OLYL 1NCUA 3RU8H 5DRWB 3FRUA 1WWBX 1OP5K 3WN5C 3S36X 3RZCB 3V4PL 3QRFM 5JXEA 1PD6A 4TUOA 3S88H 1CDBA 1WIPA 1EHXA 1EBAA 5DLMH 1QFWM 3GSVA 5A16A 1T4KB 3IDNA 2XZZA 5DJYB 4HK3N 4HUWA 4CU6A 2BOBB 1ZA6B 2YR3A 3ARGB 3MOAH 4OF7A 3I6GB 3TBYB 4JG1L 2VZVA 1IL1B 4LHJB 3O6KL 4DCQA 3T0DA 5FYKE 1OW0A 3RWEA 4JFDD 5LXGL 1AXSB 1IC7L 4MSWB 4R6UA 1VENA 1FH5H 3ULSB 3WO3B 1PDKA 2FBJH 3MO1A 3CVHL 3TIEA 3EOYG 1XIWA 4F33B 32C2B 4X8XA 1PKQB 4TVPE 1GHFH 5E6ZA 5HDBF 1DQDH 4JPKH 5MEQA 5FEBA 4XCYB 5KTEH 3QFDA 1CFVL 4LCYB 4ZQKB 2F15A 4CN1A 4JREB 1H3WM 5F9JA 3MRRB 1SHMA 1YA5A 4H8WH 4IDJL 4L1HA 1RUPH 6FABH 3ULVC 1I1AB 1MCEA 4F2MA 3O3EA 1KCRL 3EO9L 4J8RA 4RGOH 3QRGH 4FFWC 1RUAH 5KS9E 1CDUA 3H7BA 4ZFFB 2WIIA 1AIFB 3DJ9A 2H45A 4YR6A 1U2HA 3S5LA 4TSAH 5I1AA 3L3HA 3W9EB 1P84K 3WFZA 1CI5A 2VQTA 4PJ9D 4TUJA 4Y2DB 2W38A 3BGMB 4P4RB 4X6DE 1A8JH 2C3XA 1UWGL 4QXGL 4B7LA 2GSGA 3LIZL 1J5OL 3D9AL 4ZUVA 4PJIB 1UCBL 1ED3A 1G6VK 5A43C 2DQTL 1E4XH 4DOHE 2HKFH 5I1KH 4PJ7F 4PJ5E 2Z4QA 5C0EA 2B5IB 1JWSB 3EYUH 3FB6B 3SQOH 4X6EB 2Y06H 4HJ0D 1F2QA 3BP5A 5IVXA 1QKZL 2K7QA 1SJXA 5FYLE 2VLRB 3N1MC 1UVQA 3FFCA 3QR2A 4U3HA 5IWLA 2VH5L 2VDML 2EE2A 2ERJC 3WNLA 3QZWG 4Z78A 4GRWE 3DHJA 5DK0A 3JTCA 1YEFH 1QNZL 5CIPH 2MQ0A 1YMHB 4MCZA 1MWAA 3VH8G 3HAEB 4XMKH 3O9WB 4I13B 5C0RL 3WE6B 2NZ9D 3MJ7A 3V6FB 1OF2A 4EUPG 5GGQH 1V05A 1F90H 2W60A 1ZHKA 1GGCL 4LSRL 4Y4KD 5ACMA 3LKRA 6CGTA 5MHSD 4XCFH 1H15A 3GMNA 3CFDB 4XNUL 1OSZA 1PYWB 1BHGA 3Q5YA 2XFXB 5F1NB 3LQAC 3GO1L 4WU5A 3RAJH 35C8H 2EDBA 1MCOH 4X9GA 5KSUA 3TVMD 3LS4L 4R4BB 5EBWB 5SV4A 1Q1JH 5LJYH 1W72A 1XGQB 3OKKA 4MA3B 3H8NA 4YXKH 3RDTB 4FXGA 4PR5A 4BKLB 1BWWA 1VCAA 3TZVB 5EB9A 3C2SA 43CAB 4QRTA 2J4WH 3GUTA 1LE5A 1JZ2A 4OZFH 2QR0A 4UOJA 1EUUA 2UY7A 5J3HD 4WV1C 5J12B 5EO0A 4ZTPH 1HEZB 3V4UL 3JV4B 4ZUSB 4FP8H 2WK2A 1FH5L 4ZUUB 1MCFA 4XXDA 3I6LD 3U36B 3HN3A 3TH3T 2D7QA 5IHUL 3MLWH 4UV4L 5E08H 2DN7A 1DQDL 1HWGB 3HAEG 4YXLL 3V5DA 2OMBA 1WV7T 4JGJA 5FK9A 3SCMC 5KTEL 5EORH 3MMEB 4P5KB 2X89A 1T3FB 3S35X 3DX8A 1RZJC 2H8PA 4R8WH 5IVXE 4HFUL 2BHUA 3GSWA 3HHRB 4RX4D 5F7MC 1QRNE 1RUPL 6FABL 5KVDH 2WWMC 3FFCE 4PJ7B 2YA2A 4PV8A 3AXLB 1ZGLP 3L3GB 5E2WH 4YQXL 1A1NA 4RGOL 3U7WH 1CL7H 1RUAL 1A1MA 5B3JE 4B41A 2X4SB 3MRMB 3S5LG 1FFOA 2AK4B 3CPLB 4QTHB 1OCWL 4TSAL 3N85L 2GT9A 2JCCF 4JQIH 2X4NA 3KYKL 2QQNL 5EOCJ 4C57C 2AJSH 5F9AC 4D3CH 2IANA 2QKIA 1HILB 4JAMA 2L7JA 5E6IC 5MEOA 2D0GA 1KN2H 1R24B 1SQ2N 1C12A 4EDXB 5DJ2A 1QTYT 4KI5F 4IS6B 3OF6D 5HPOA 2WBKA 4TNVF 2HKFL 5I1KL 5HHXH 1CDJA 2MSPA 1VA9A 1PVHA 1U3HD 1ZGLB 1OARH 2Y06L 3QEQA 3V4VL 2R2EB 2LE9A 1AFVH 4NRYA 2FX8H 2GTWB 1NDGB 2O5ZL 1YEDA 3TBVA 1U58B 5DD5H 5JNYB 2NY4C 5D8JL 4HLZH 4JM2A 5C0JA 5IB3B 3M8OH 2CLVB 2Q87A 1YEFL 3E1F1 1N3NA 3MYZA 4JHBA 5DGQA 4F57H 1DP0A 3GMOA 3DUUB 1ROWA 3IFPB 3WHE0 2PO6A 4GW5B 4Y4FB 5IGXH 4AMKH 4ZPVB 3DI2B 4PS4H 4OD1H 4UT6L 1CVSC 1F90L 2VMFA 1CXKA 3STZB 4KY1H 1DFBH 3I02A 1U8QA 2WAHA 1KPVB 3BE1L 4P2QE 5SWQA 5DRZA 3NBNA 4RNRA 4K7PH 4LAJH 4YNYB 3SPVA 3TWCH 3FCTB 1BJMA 4QNPF 3RAJL 2JTDA 3O6FC 3C6LD 4PJBA 2ZUQB 2AXJA 2BNQD 4L9LB 4P49A 5A1AA 5IFAH 3UTTB 3O6MH 1TVHA 2VXVH 3WNPA 2BXZA 1MCQA 1BFTA 3TN0C 2BXYA 1JZ5A 4BSJA 1J88A 1OAKL 2VL4A 2IPUK 4PY8J 2KBGA 4YLQT 4JFQA 3ZTNH 5I1EH 1U2CA 4FTVE 3I50L 3O11A 3LV3A 4ZNCD 5JORB 5GGVY 1JYVA 2O61B 5JW4R 1ZHNA 4CMHB 4IRJC 2J4WL 5CEYB 3V7MA 2EC9T 3P9MB 2DL2A 5EULV 1GL4B 5LWYL 2NCMA 2XPGB 4A6YB 1EXUB 3V0WH 3BKYH 4X80H 5FOBB 5J57B 4KHXL 5GZND 4O9HH 2D0HA 2IANE 5MERB 3IS1X 4Y1AD 3ULVF 2JCCB 1CFNB 4WI4A 4JKWA 3EJYC 4FQLH 2ZOLA 3MLWL 5H8DA 2A38A 5E08L 3OAUH 3EDDA 4Z5RA 4X5XA 5E56A 1GZPB 1IKFL 1I9IL 3GMPB 2A0LC 2W07A 1SEQH 3QEQE 1DEEA 3QIUD 5I1JH 3HLAB 1FYTD 4UB0L 5KVDL 3CZFB 4JDVB 2ZKHL 4JQVC 1J86A 3U0WL 2HT3C 4JO4H 3KLHC 2DBJA 5E2WL 3W9DA 3G5XB 3CAFA 3TYGL 3UC0L 5FIEA 3U7WL 1CL7L 1JPGA 4NQDD 4M8QB 4PRIB 2DLGA 3V8OA 4MYWB 5HHVH 2I9LA 4RBPH 1U8LA 4FQXB 3RVTD 4JQIL 4JM4H 2AJSL 1ZMYA 3BUYA 4YBQD 2JB6B 3OR7A 1FNGB 4ZXBB 3UTOA 1U8KA 4L8CA 1J05A 1F4YH 3NZHL 3CX2A 1KN2L 5DDHB 4WI2A 5F7FA 2OJZH 3O81A 4WUUD 4IMLB 1GC1C 4M6AA 3SJVA 3VFUB 1JZ8A 4CJ0A 3CD4A 3MRNA 3WN5B 1XZ0A 3MBEA 3QEHA 3AS3A 3NA4A 5HHXL 2VE6A 1JHKH 4PJBE 1NAKH 5GS0H 2NR6C 3VXTB 4GMSH 2P44B 5IEKA 2R2BA 2Z31A 1N5AB 4LLUB 4FQJL 4HGWB 2X2YA 3UTZB 3WXWH 1TLKA 2OTUB 2H41A 5HVFB 3VGFA 2FX8L 3NN8B 3BQUB 3KPTA 1JPSH 1JBJA 3L6FA 4ETQB 1YMMD 2HJKA 5IV2B 5J13C 3N1PC 5CGTA 5DA4A 1U6AL 4PJXF 3M8OL 3HE7C 2CR6A 1WBZA 3PJSB 2BNRB 3KLAA 1NFKA 4QWWC 3TJHD 3D2UD 3NMEA 5DRXB 4QNPE 4X6FB 3CFIC 3VE0A 1XR9A 1HKLH 4OD1L 3KPLA 3MZTA 1DFBL 1C7SA 1W0VA 2APXA 4HKXB 1WTGT 4YDLB 5L2JB 2HG5A 3QEGL 4TNWF 5CEXB 4GAGH 3BAEL 3IXAA 3BO8A 4F3FB 3B8SA 4TQEL 5B4MD 3FAXA 4MD4A 2BJMH 1E27A 5IFAL 4U1JA 4D94A 4GLRI 4ZDHA 1MY5A 3ZE2F 3U7AA 2BCKA 4OGYH 1BAFH 2ZCHL 1U8OB 4ZS7H 2YPLD 5IG7A 1JNNH 4S1DD 3QIBD 3FONA 1SMOA 2FH6A 3ROOA 4KHTL 3C8KA 4QXTA 4YGVB 5BV7B 5HVWA 1H5BA 4PJDB 5HGDA 1IGCL 3WS6C 3ALPA 2AKRA 1AP2B 1BBDH 1LNUB 4M6ML 4XPFH 4LIQH 1T5WB 3JWOH 1PW3A 5F71A 3BZ4B 3QEUA 1FZMB 3V0WL 3SE8H 1A6WL 4X80L 1CTNA 3NFPA 4Q6IC 4O9HL 5E94B 4MHHI 1RZ7H 4BH7B 4UT9H 3EFFB 1BGXL 2L7UA 1UA6L 1VPOL 3HMXL 5FGCE 5L88H 1JF6A 2CO7B 4FQLL 4LHUG 3SJVE 5ICZB 1HSAA 3WV0A 4QT5B 1HZHH 4PJ9C 3DXAB 5DFTA 4FQ1L 1MVUA 4OUOA 5TE4H 1FIGH 4MXQC 4PJ8D 2XTJD 1B4RA 3ROLB 3STLB 2J8UF 4ODWB 5HHMD 4O02H 1URLA 2Q7NA 2BHYA 5IB4B 2FECI 3UTPD 5DGRA 4HJ0C 3GSQB 5GGTA 1CIUA 2FX9H 4ZTOH 4XCNB 4PJXB 1EHNA 1CK0H 2I25N 2EIZA 4YPGA 2G75B 1F97A 4G9FD 3VXOA 5E8DL 1NLBL 1QA9B 3DVGB 3TFKD 3J8F7 2FATL 4S1RL 4OF5A 5LGHL 1CFSA 3EYSH 1DE4A 5E6IA 4C56B 3BEVB 2F19L 3NA9H 2NZ9C 3LRSA 3NPSB 1JHKL 4HXBH 4QRPE 4MGXA 1XGPA 2CKBH 4GMSL 4UTBH 4Y4KC 5I1HH 1MCPH 3QG7H 3QA3B 4OQTH 4EEEA 3KYOB 2XKNB 4OCXH 3B9VA 4M6OL 2F53D 3B6SA 2VXSH 3B4NA 4GG6B 3MA9L 4WV1B 4ZYKA 3OHXA 1KCKA 5E2TL 2DIAA 4X7SL 4HPOL 1FNHA 4GW4A 4NDMB 4DGIL 3TVMC 3MRCA 3UYPA 3B5HA 3QDJD 1NUNB 3L3IA 4F9PC 1JGDA 2XA3A 3CFBA 4JR9H 5F3BB 3PWUA 4KRPB 1S7VA 1A0QL 3OKMB 5I15H 1HHGA 3BH8B 3IFOB 3ES6A 3I3DA 1VFBB 3LS5H 4P2OA 5EU5B 2YKLL 1S7RA 1TZGL 3HMWH 1PFCA 5SX5H 3CK0L 4LSSL 4NJAH 5J3HC 4S2SB 2W9DH 1J7VR 4J3OC 1U92A 1EGJA 3DUSB 4D9QD 2BJML 1CYGA 2EDFA 3TYFB 1VEOA 3V9FA 1UXSB 2NW3A 3FN9A 4Z6AT 1JHTA 3O6FA 2OX5A 5IB1A 4ZS7L 3EKCA 1KJMB 1LO4H 4F7TA 3D87B 1JNNL 2W92A 1JZ3A 3BMVA 4YHYB 1SBBA 5CSBA 4ALAH 5HD8D 5HVHC 4PLNC 3RKPA 1BFVH 5JQ6H 3T4AA 2DAVA 2J8UB 3B9DA 4GAYB 3JWOL 1KBGH 4OLEA 3O2VH 5ETUA 3SE8L 4QY8B 4IJ3B 2AK1H 1QRKA 1DLFH 4L1DA 1QBML 1J0HA 4HW6A 3O4LD 4MNQA 4LQ1A 2BVQA 4UT9L 5D2LA 5L88L 2R15A 3QQ3B 2MMXA 4JJHA 4F7PA 5D5MA 1XAUA 2R23B 2AEWA 3PWNB 5BW7A 3AU1A 3F8UB 4X7FC 3RL2B 3KNBB 2CD0A 1HZHL 4J3XA 3RUGA 1Z9OA 4WENB 2NY4B 3L7FA 5T1MB 4Z0XA 1NCAL 5E5UB 5TE4L 5CEZL 3WHXA 1ZE3C 5DMYA 3N0PB 1HHHA 5DSCA 4X9IA 2ESVE 4OM0L 4D0BA 5JOPD 5DUMH 5F1SA 3VFMA 1P7KA 4LLQA 1G9MC 4P4KB 5IJVA 5BOPA 3DIFA 1LE9B 2ICWA 1UH3A 1AH1A 1ZHBA 4XX1E 5BS0B 2DL9A 3JWDH 4JPIA 3AB0C 1PEZA 5C0DA 4CADA 4U49A 3SDYL 5CJXC 2QSCH 3MV8B 4HMCA 2OJEB 1DL7H 4HKZA 1BD2B 4Z95L 2D3VA 1HINL 1RJCA 1MCBA 4XNMB 1TJHH 5DC0A 1I8IB 4UTBL 1NMBH 2F74B 1MCPL 1K4DA 3LKPB 4PGJA 3L5XL 4L3EA 3EOAB 4OCXL 2Q76B 1CDIA 5CJOL 5JMOC 1A02N 2VXSL 1VESA 3F6LA 4OAWA 3TBSB 1N7MH 2UVEA 5TDOA 3C6LC 4NQEB 2DTSA 5E2VL 3GSNB 1CL7I 3MLXL 3KAAA 1FV1B 5J9PB 3HE7A 5CP3A 3ISWA 4URTB 4FQCH 5ENWB 1FL3B 2Q7YB 2RR3A 2HTLD 3KLDA 4MNQE 4LPVA 4U1HB 3MRPB 1ZKAA 5D2LE 2P5WB 3LS5L 5K93A 1T1WA 4XBPB 5D5ME 3VXNB 1UH4A 2GFBA 4OCRL 2RHEA 2R9HD 2ATPA 4NJAL 5E2JA 1DVFA 1BOGA 3RWJB 3IJSB 3SDCB 4EQ3A 2J6EH 4U05A 5J1AB 2Z8VC 5DD1L 3VFSA 5GZNC 2ZOKA 3RUGE 2Z93B 5GGSY 1BQSA 1T1ZA 4TN9A 3GBLA 4UIMA 2AV1A 1Q38A 4HUKB 2VAJA 4JPVL 1RK1B 4LRNH 2DI9A 3QXAB 5SWSB 1VKXA 4WW2B 3IU3A 4HULB 1BFVL 1CR9H 3QIUC 3GBML 1I3GL 3QP3A 1KBGL 1HDMB 2RJMA 2E8ZA 1U8HA 3QDMB 1M7XA 3WSQH 4JFFA 4PJCA 1P4IH 3LQZA 1LO2H 1IAKB 3JTSB 4TVSa 2VLJA 4WDIB 1L9NA 3RVTC 1RZIA 1A7QL 1FNFA 4K23H 4LCUA 5DD3H 1UZ8B 3ZLQC 1GRWA 4YBQC 5DHYA 1DQQA 4DKDC 1ZT1A 2AS5M 5F8QC 3ECBB 5E8EA 4Y5XC 1FO0A 4KAQH 2FH8A 4ZAKD 2UYLB 3GMQA 3T2OA 5D7KE 3O0RL 2IPUG 4KJPD 4L3EE 2CRMA 3OAYH 1QP1A 3TT1H 4ISVB 5HVGB 5ID0A 2QADD 5DUML 4F7CB 3NZ8B 4H5SB 2W0FA 3LPWA 1J12A 2B39A 3PHQB 4F7EB 3G04A 1B0RB 3AMKA 1ZEAH 1IJ9A 4P9HC 4KROD 3HRPA 3JWDL 4I0PA 4QHNB 4AK1A 5I66A 3Q6FA 3ARFB 4GJTB 2QSCL 3NACL 1FL6A 2IADB 2C7UA 2CLZB 1JGVH 4XPGL 4M62H 3T04D 5HYSB 3QQNA 2GAZA 3H9HB 2P8LA 4JFHD 3TPKA 5ISZA 4YHZH 1WFUA 1OLZA 2KUTA 3GEWB 2A9NH 4NKOA 3D18B 4P5TD 1CE1H 1T6WA 1EMTH 4LDLB 3HZYA 4JDZB 4JFDE 5JDSB 1HOCA 5D7LD 3ZT6A 5FDWB 1LD9B 3OG4B 4LF3B 4MDIA 1H3PH 1OAXH 2XKSA 4O2FB 1T22A 2EDDA 4OZIF 3WUZA 3WNKA 1HH6B 1N7ML 4UNTA 4DKFH 4P3DB 4OGZA 4Y19D 4OCWL 3H9ZA 1KCVH 1PSKL 2W9EL 4FQCL 4XI5D 3DO7A 3QIBC 1WAAA 1N5YL 4YHMH 4Z0BH 4F9PA 4W70A 1LO3L 2JJWA 4PJCE 3GSXA 1ZTXL 2YEZB 1CVRA 4GKZB 4HBQA 3WIHL 1R3HB 1T0PB 2HN7B 2J6EL 3SKMA 4NKMA 5CKAA 1PG7H 1Q8MA 4YAQB 4JGUA 2PCPA 3DX6A 1XF5A 3MLZL 4NM4H 5DEFB 2FD6H 4JZOA 4PDCE 3CMOH 4GXUN 3OSKA 3RNKA 3B9KB 2FJGB 4L3CB 2W59A 4ESKA 3UJJH 4HDIB 4X6CA 3OXRB 5I1DB 4OSUH 3F62A 4ELKB 4LRNL 1J8HD 1G9NH 1K8DB 4MQXD 3ZL4L 1R5IB 1CR9L 3H7LA 4KK5D 3MRJB 4P57A 1I3UA 4Q58C 4QTIH 2XTJC 3KYNB 2BY1A 1HYSD 4LCWB 4O4YH 2WUCH 2NPLX 3P73B 3BKCL 1Z3GL 4K8RD 5DC9B 3FQRB 1FPTH 3RBSA 5BJTB 2HFTA 1HSBB 3KPQA 5FM4A 2A83B 2VQ1A 4U2YA 1QBBA 1P4IL 4LSQH 2E7MA 3G6JF 4K3HA 2YUWA 3LCYA 2HVJB 5DD3L 4PJHF 1MHHB 1UB6A 3TLRA 1VFMA 2FB4L 3CSYA 5I74B 5HDQH 1G7IB 4CVXA 4KQ3L 3OX8B 3RGVA 1IGFL 3E3QC 3TFKC 4KAQL 1ORSB 3MUJA 3RL1A 3TVMB 5DHXB 3HZVB 1NLDL 4Z7VF 3AROA 2AGJL 4Y16C 5TQ0H 1SBSH 3VXQA 2JELH 1VADA 5MHSE 2OL3A 2K1MA 5KJRL 1DQMH 3OF6A 5GHWH 2VXTL 4MMXC 3BEWA 1ERNA 4OZFA 3RZWA 3G6DL 4G6JL 5DMKB 1A7PH 4K9EL 1U3HA 4O2CA 3ME0A 3QNZA 1UJ3C 3I84A 1A2YB 3AVEA 3FT2B 2OM5A 1BIIA 3RTQB 4N9GB 2BFVH 2YS4A 4M62L 1T7ZA 1I7TB 3FB7B 4OZIE 1YC7A 3HPLB 4E41A 5KVGH 2O26U 3D0VB 4MQTB 1INQB 3VGAC 2A6KA 2IPTL 1EMTL 4PRDB 5JW4N 3K2MC 3PP4H 5J7CC 2CIKA 1ZLVH 3ZKNC 5MEPA 4X6CE 1T2QH 1H3PL 1OAXL 5T33L 1FRGH 2AJ3B 3I6LE 1IM3A 4J4PD 4JHWH 4LGRB 3ARDB 3QO1A 4TOYH 1L7TH 3E8UH 2FYYB 5CD3B 4JRXB 2D31B 1KCVL 1QG3A 1F4WH 1XF2B 4HZAA 1AGFA 1C5CH 4GG8A 3ARPA 3F5WB 1XCTA 4QHLB 5I19H 1BF8A 3PQYA 1CDGA 4MS8D 5IW3A 1BP3B 5HD8C 1KC5H 5L7XH 3T77B 4ENED 4XGZB 5LGJA 4LKCA 1YN7A 3HE6A 2IQ9H 3X12B 1NGWA 1PG7L 4E0RA 2AJZB 3TV3L 1Y6KR 3LEYH 4NM4L 3G6JB 4XHJD 4XMLL 3CMOL 5CWSB 3D48R 1YQVH 4Q7DA 4PJHB 5C0FA 4KPHL 5D1QD 3UJJL 1K8IA 4Y1AA 3VCLA 5DS8B 4XNXL 1AQKH 1NAMH 1QO3B 3MRLB 4LVNC 43C9A 1G9NL 5A2KH 2GK0B 1G6RH 4X5WB 3NCYS 1M7DA 2IBBA 4JEGB 1S9WA 4Z7VB 1KCUL 4MB5A 4G59A 4HC1H 4QRRA 4OCSL 1U91A 4XP9L 1VGKA 4QF1B 1AJ7L 4IIQB 4PP1D 2LFGA 3QIUA 1QFWI 3I2CH 3DSFH 3FQNB 4PJ5B 1FPTL 2YHGA 3V6ZB 1MCHA 2XNAA 4ORGA 5IQ9A 3D0LB 4GS7C 4LSQL 2NX5B 4QRQA 3FRUB 4H26A 3UPAA 3BN9C 2UWEF 3VGDA 1EEQA 3D69B 3GSVB 5SWZB 4ODUB 5HDQL 3IDNB 4XNQA 3C6LB 3O2WH 3C6SA 4HG4J 5C71A 3ZMRA 1E28A 2CGRH 4AIZB 3IYLW 3JWNC 1F45A 2NYYD 3C5ZD 4MQ7B 4X5LA 2X4RA 5TQ0L 7FABL 5GGSA 4WUUA 1DQML 3MO1B 4WEMB 1TZIA 1U36A 4WFHD 2FEDD 4IOFD 1F4HA 1G7QA 2H9GB 2BNQE 1A7PL 1HN1A 2HTKC 2P45B 1TZHB 2AABH 3QFDB 2P8PB 1FVCA 4YIQA 1JPTH 4JANA 5BV7H 1KCSL 2DQFA 4P5MA 5T5FL 3C60C 1WCQA 2EDKA 2DJSA 2PETA 4G42A 4Y8DC 4F2MB 4IHOA 1EAPA 1T2XA 2OP4H 1OTTD 3TJHA 5M94B 3BIBX 2MQCA 1KJ2H 4IOIA 1RHHA 4JFYB 3QAZC 2NY0D 3SGEI 1T2QL 4Y1AE 2R9HC 2WUBH 5F97E 1PAMA 4NC2B 1FRGL 1TCRA 1CLZL 5D1ZB 4MB4A 5E2UH 1FZKB 3ARBD 3WEXB 4TOYL 1L7TL 1S8DA 3JV0A 1PZUB 3WD5H 3KYAA 3EOTH 4D0DA 3ZE1E 1XF4B 5IW1B 3VW3H 3AREA 2GSGB 4NT6A 1PY9A 1MQKL 1F4WL 1NC4B 1KIUA 5IFHL 4I48A 3TEUA 1FYTE 3EO1A 1BJ8A 4N0UA 5T1DH 3TP4A 5ADOL 5C0EB 1KC5L 2YPLA 1OHQA 2WLYA 5DF0A 2X7LA 1MCNA 3BP5B 1VB9A 5DJDA 1C08A 2DYPA 1DLHB 1F2XK 3QIBA 5ESVB 1LEIA 1VSCA 2OMNA 3FFCB 4NQDE 4O51A 2Q8AL 5INCA 2IQ9L 2LVEA 2J1KA 3HZKA 1BJ1H 4OZHA 1BQHA 1ZAGA 5CGMA 3LEYL 1IC4L 2QJDA 4D8PA 1NGYA 3ZYZA 5ALCH 1YQVL 1IGYA 4JZNA 3MV9B 1MWAB 3TJEH 1A47A 2JLLA 1GIGH 3C5JA 3KPNB 1S9KC 1AQKL 3MOQA 4HIEB 3SGKC 5BMFL 3P9LA 4LVOB 4WUUE 5ABDE 3FFDA 1ZHKB 2D7OA 3DURA 1AD0A 4NJ9H 3ESVF 5CP7A 1EJOH 4HC1L 5FO9B 3FOMB 4ZAKC 1QPPA 1H15B 3GMNB 4U6TA 4KJPC 1YDPA 1OSZB 4K94C 4WCYH 3KPPA 2HP4A 3MCKA 2P47B 2QQLH 5IMMB 1FZJA 1I7UA 4Y5VA 3VXSB 2QADC 4PJ8A 3I2CL 1X5AA 1NBVH 1KEGH 1YQ2A 3OKLA 4D0CA 1ORQA 2JIXA 1KTDA 2YXMA 4N0YH 1RUKH 1DR9A 3CDGA 1OAQH 4WI5A 5HHMA 4I2XB 1YMME 5HXMA 1ZS8A 2B20A 1JNHA 3F7VA 5EG6C 1UKSA 1TXKA 4FXGB 2Y5TA 4CRPA 4DAGL 4Q2ZA 4ZPTA 4KROC 3M1BB 3CC5A 1VFOA 2V6HA 2XQBH 3QHZL 2QHRL 2YD4A 4QRTB 1BVLA 3S6CA 3O2WL 3EYVB 5B38G 4DUXA 3N9GL 3RX8A 1IVLA 4G9FA 1DBKL 4K7FA 3GJFB 4ZS6D 5TGBB 2PXYD 4NQCA 3ULVL 4YFEA 4GQPH 4IRZL 3FT4B 1KLGA 1HCFX 4WFED 4P5TC 2BMKB 5EBMA 4UDTB 4XXDB 5IHZA 5F89A 1LWRA 1XGRB 3RY6C 2O5XH 4PGDA 4AEHL 2H3NB 4N8CL 4OF6A 2KZWA 5GSVA 2AABL 1G7PA 5D7JA 5FK9B 4GRLD 2A9MH 5HGBB 4N0UE 5C0CA 5FHAH 2YPLE 3DX8B 2F53A 1E4KA 2H8PB 3CFEA 4HIIB 4MJ4A 5T1LB 5BV7L 2IH3A 4WVRA 2ORBL 3BI9X 4OLVL 1FNEB 3QI9C 4POUB 3D39B 4Z7QF 5T1KD 3ZDYE 4Y88A 4OZHE 4XI5C 2KKQA 3O3BB 3QDJA 5ADPH 2CKNA 4EI6A 1CBVH 5CUSH 1WIUA 1A1MB 5CZXD 3EDJA 4AYFA 4UBDD 4NCDA 3WFHB 5DMJB 3B8YA 1KJ2L 5F1IB 2QSVA 3I75A 4JFED 1A9BA 3U9PH 3IDYC 5EZJA 1I9JL 2GT9B 5F96H 2WUBL 2X4NB 3UBXA 3BKJH 1P2CA 5DZNA 4EN3D 1NFIB 5MEOB 5EO1A 4P46D 4IEFB 3SGJA 3RNQA 5EZIL 3EOTL 2B0SH 1ZSDA 4M5ZH 4LSDA 1B9ZA 1X3DA 1R5VA 5DJ2B 1M4KA 1NBZB 3P77A 2EYRB 2XTJE 3MPCA 5EU4A 4MQXC 3NIDF 4KK5C 1EEZA 5HHME 3BGFC 4U6HA 2DQHH 4PB0H 2H32B 3PL6B 3TBVB 1HYSC 3IFLH 3DYOA 4YE4L 4YH6A 3T1FA 3UTPE 5ILTH 1BQHG 4GMTH 1JI2A 4Y16B 1OGTA 4IOSD 1HHIB 2HRPH 5C0JB 3MRBA 1A21A 5KOMC 3ERYA 1IGJA 5ALCL 1XH3A 1U8IA 4UU9A 4G9FE 2VZOA 5CJ8A 1ZWIA 5T3ZL 4R0LB 3O4LA 4ODTH 9CGTA 4Q74A 4NQCE 3ARQA 2SEBB 3PP3K 1CDHA 3SY0A 1AC6A 3ZKQD 4HS3A 5SWQB 4PTUA 2OR9L 1EJOL 2DLEA 4NHCL 5D7IF 5C7XL 2QSQA 2ADFL 2Q86A 5HYJD 3L9RA 2EDLA 1AQDA 2VB5A 3HI1B 4KRMB 1JMXA 1JGUH 3BWAA 4MX7A 5C0CE 5TE6H 1TVHB 2F53E 3GSNH 5FB8B 1OAQL 2C1PB 5I0DA 3CH1B 4OIIL 4JFQB 4L4VA 3QUZD 3QDJE 3O11B 4F37K 3NTCH 5I0ZA 2M26A 1KIRA 1CLOL 4Y0GA 3VXMA 5CSZA 2FHBA 5JZ7D 4WJ5B 4L8DA 3B9EA 4NO5A 1FYHB 4FG6D 1ZVHA 3QUMB 1CD0A 3SE3A 3A6CL 1S7QA 3MA7B 4C58B 5F72S 4NZUL 4XBEH 3EOBA 1A5FL 3WFEH 4D9QE 2CLRB 2O5XL 1OP3H 2QHLA 5FYJH 4X5XB 1EPFA 5E8PB 4J4PC 4NZTL 2BOCA 4KKLD 3BJ91 1DEEB 2AP2A 2XG5A 3HR6A 2HH0H 4LEOA 3LDBC 1MJ8L 5B8CA 3MACH 4OKDA 2Y7QA 5E03A 5ADPL 5DC4B 1CBVL 5CUSL 1JPGB 4MVBA 4X98A 2J5LC 4FQ2H 3BISA 4M61A 3KG5A 1Y0LA 2AJXL 3G5ZB 5L0QC 1JJUA 4YHIA 5C9KA 1ACYH 1U8LB 4PREA 3U9PL 2VSCA 3FL7A 4AZ8A 3O4LE 3T2PA 2LU4A 4Y4HD 2V7HA 5E7BA 2JK5A 1GH7A 3BP7A 4L8CB 1J05B 1AXTH 4NUGH 4XHJC 4ONHB 3OL2A 2B0SL 5L2KD 1EHAA 3ARYA 4EDWL 5E4EC 4GS7B 5CJ5A 1MY7A 3U46A 1NL0L 4BZ2L 1XZ0B 4RMUA 3MBEB 3V5HA 3QEHB 4KK9D 4OF0A 5D7IB 3DHMA 1NC2B 3DX7A 4N1CA 4RSVA 3VFWA 4WO4A 1RIVL 2PW2B 4DFHA 2Z31B 5IEKB 1JFMA 3VMOA 2AJVH 3BVNA 5JOPE 4PB0L 3T3MF 3MJ9L 2XWJA 1BBJB 4PUBL 3U4BL 3SEPA 3U9UA 2GY5A 3MROA 3IFLL 5ILTL 4GMTL 2APVA 4KDTA 3UTSA 4G8GD 1TJGH 3X14B 2FNBA 1AGCB 2HRPL 2R4SL 1WC7A 1UKQA 3BYTA 3KLAB 5IMKB 3NGBB 4IRSB 5C0AD 2OZ4H 3NVQA 2MHAB 4RA3A 4BM7A 4GAJH 3OMZA 4OZGA 5IB5A 3O3UN 2UY6A 4ODTL 4MLSA 1A22B 1GGYA 1NQBA 3H0TB 1DUYB 2VYRE 1JPST 2DQEH 4OD3L 1CG9B 4LCCC 3SGKA 4PGZA 3OWEA 5JOFA 3C60B 3IXAB 3BO8B 1F3DH 1CU4L 2NYYC 3C5ZC 4HCRL 4PJEF 4NQVB 3C09B 1FVEA 1JGUL 1K85A 1QSFA 5H94A 12E8L 3RGHA 5ERWA 1DN0B 1N0LA 4HWBA 3GSNL 2BCKB 3TPUE 1LGVA 2EZ0D 2FEDC 4PRNA 1DCLA 1R3JA 4IOFC 3OV6A 1N26A 1XFPA 5EU6A 3QAZB 3SE4C 4RDQG 3NCJL 5IG7B 5C09D 3GSOA 1OM3H 2A6JB 1Y18B 4GW1A 5C6WH 3BYYA 3ROOB 5I8KH 1CFTA 1KCGC 1FL5A 1C5BH 3OKOB 1H5BB 4H8WC 1EIBA 1V8HA 5HGDB 4Q9RL 2EIBA 3MYJA 5IR1A 5HHPB 3BXNB 2DQIH 4LSUH 4XPTL 1OTTC 3UAJD 1K5NB 3U48A 3NFNB 3QHTC 2E7LC 2VN4A 3WFEL 4HT1H 2Y6SC 2NY0C 4HF5H 3ARRA 4DUWA 5AZ2L 3UO1L 5IESL 1HSAB 3K80A 5FYJL 5EUOE 3KYMB 3RIAK 3RY6A 4QOKD 2HFGH 4Z77A 3ARBC 3ULUF 3EDKA 5CEZD 5IKCA 3SKOB 3UPCA 3SO3C 2YC1A 3TA3D 4KZDH 4U1KA 2HH0L 3DGGB 5GS3A 3LQMA 1J0ZA 3HG1A 5GRUL 3QJHA 1NCDH 3T0XA 4ZD3H 3KJ6H 3M17A 4Y19A 4FQ2L 1Q0YH 5DA0B 1IEAB 3H9YA 1F4XL 1CE6B 3PGCA 3CXHJ 3DRQA 1XCQA 2DQUH 4OZGE 4ZAKB 4FRWA 4LVHC 3T2QA 4W4OC 4L8SA 2YSSB 4YPGB 4EOWH 1KB5H 5GIRA 3ZTJG 5BVPH 4U33A 1M71A 1MI5A 2DIJA 3QUYD 3T3ME 1CFSB 4DVRH 2IF7A 2FDBP 4PPTA 5DHVH 3UROR 1CGSH 3LRSB 3F7RA 5F9DC 1QSFE 2GKIA 2GJ6D 1KFAL 4RQQA 1HIMH 3OAZH 4MCYA 4PJEB 2AJVL 3C2AH 4R97B 4F7MA 5EU6E 1MRCH 3W81A 2HFFA 4WHTB 4Z76B 1DQLL 1NDMA 1WFOA 5I18L 1OAUL 1K6QH 3DLQR 3OHXB 3MBXL 3MRCB 2ARWA 5DJZA 3VRLF 3MLRH 2OZ4L 1NEZA 4GAJL 2IAMA 4Z7WA 2CQVA 1UYWH 3TCXA 5D7LB 4HGMA 2VNCA 1S7VB 5ITBH 2V9RA 2V17H 5D4QA 5FGSA 4LDOB 5D9SB 5FFLA 3EYOA 1R0AL 4L4TD 3WMSA 4JFHE 4P2OB 4MNGB 2NW2A 1R3KA 1RIHH 4X0KB 5E7FA 1MF2H 5K9OA 3FB8B 5CILH 1IGIL 3QI9B 4PGEB 4ZS6C 2PXYC 3B43A 4DW2H 5FYKH 1IZJA 1U92B 5D96B 3U6RA 1Q9WA 1OT2A 3VFRB 2WP3O 1UZ6E 3K0WA 5H35A 2Z92A 4U6XB 1SY6A 4Z9KB 2B8OT 4EVNA 3IDYB 1OM3L 4F7TB 1A6VH 1C7TA 2OI9A 3WIIH 1A9EA 4GRLC 4XB8A 1V7ML 4Y19E 3N1GC 3PV6A 3PGFH 1FAIH 4PJAF 1C5BL 3KPRD 2ATKA 3SOBL 4RMQA 4J6RH 2KDGA 3LEXB 5D71L 4PRHA 1OWWA 1S5HA 1UKTA 1FORL 4XWGH 2A1WH 4WTZG 2XZCL 1UB5A 1WICA 1CICB 2CJUH 5CZXC 2HJFB 1J8HB 4UBDC 5DI8A 4DKEH 5DR5H 4KV5F 4FNLH 4HF5L 5J11B 3BGFB 3AU1B 4KI1A 1KCLA 5K9QG 2BY3A 4HUUB 4EN3C 5E24E 2X6MA 3L7FB 4P46C 4EUPH 4LARH 1YNKL 3QUXD 2DB8A 1RJLA 4XRCA 5GGRB 2DBLL 4J4PA 4XXCC 5DSCB 4LOUD 5GQBA 4D0BB 3K8LA 1GYAA 4HK0A 4JJ5A 5JO5B 1UXWA 4F80A 2Y5EA 5C9JB 3IGAA 3RWCB 5IJVB 3BP4A 3U30C 4TSCH 3C8DA 4MS8A 4Z7WE 5J6HA 2P49B 1ZHBB 4POZD 4D9RD 1MJUL 4HX1A 3CFCH 5EWIL 4EOWL 5JHLH 5C0DB 4N1EA 5BVPL 2AV7A 1JIBA 3L95B 4HV8B 1GAFH 4Q9BA 1ZLWK 3LN5A 3ARGD 4KGJA 5IEHA 4LAQH 2COQA 1U8JB 3OGCA 2X10A 4R4ND 4TUKL 3IDXH 1HXYB 2YMXL 2R0KL 1T80A 1JE6A 4YDKL 2IGFH 4HIJA 1SEBB 3I9GL 5D1QA 3WNOA 2E7CA 2NY2B 1EFXA 1YYML 1K4DB 4MXVE 5MENA 1FNSH 1CXHA 4JB9H 1NUDA 1F3JA 1UM6H 5JW5A 5D93B 2WP3T 4YDVB 4OAWB 1FVDB 3PIQA 4XPBH 1DSFH 1HQRA 4M3KB 2XY1A 1RVFH 4YDJA 5EH1A 3MLRL 4M03A 1I1AD 4HJGB 1UT9A 1WFTA 3WFBL 5IVZB 1MIMH 4M93C 3OJDA 2NXZD 3QUZC 1H3UA 2BVEA 2WW8A 4X7CC 2KQNA 4ZOBA 5IW6A 5ECJE 2OR7A 3QULA 5JZ7C 2GFBB 1S7TA 1MF2L 1YEKH 5CILL 2ATPB 1JPFA 2V9QA 1BOGB 4FG6C 5DYOA 2A77H 4MAYA 5JW3H 5FYKL 4N8VA 4RZCB 4LCCA 3LH2H 3WUWG 4Y2DD 4PJAE 2ZOKB 5EZLB 3DOSA 2J5LB 1T1ZB 1F4AA 5SX4I 2LQRA 4M7JH 4UIMB 5L0QB 1R5WA 2AV1B 5AEAA 3X17A 1WEJH 1S7UB 2FJFA 4M4PA 3FO1B 1YN6B 1FAIL 1VKXB 1S9XA 3MJGX 3IU3B 1IEBB 4KKLC 1KN4H 1YECL 4OV5A 1KTKE 3O3AA 3F7QA 3MCLL 1YEEH 2VUOA 4J6RL 1WAAF 2XA8H 5AD0A 2JB5H 5FYJU 4EQ2A 2VLRD 4LKXA 1EERB 3RP1A 1Z9LA 4JO1H 4OFPA 2PTTB 4G43B 4NHUA 4UT7H 3P0YH 5DMIH 1U8PA 1A3QA 2X4OA 5DTFA 3WKNA 4JFFB 3JZ7A 4PY7B 3GB7B 1B6UA 2ZSWA 3DYMA 2CO6B 3LQZB 5DR5L 3ALWA 2VSDA 5CBAB 3O9WD 1MWAH 2VLJB 3NH7H 5KZCB 1RZIB 2N1KA 3TC9A 3MLPA 2XXCB 4G6AD 1DQQB 4YHLH 2AEPH 3U0PA 1YZZA 3GGWA 1FO0B 2BSTA 3GMQB 1QLRA 1WJ3A 3LKQA 3ARBA 5GXBB 3OKDB 5ID0B 5D72H 4KK9C 3MLTA 1Q72L 5D70L 5EIVA 5D1XD 4AM0B 4DN4L 1MJ7H 2W0FB 3TESA 1PY4A 2I9TA 2IALA 1GZQB 3TO2A 1J10A 1N2RA 3G04B 1W72H 4LEXH 3LN4A 4NKIL 4HJJL 1WWCA 5D6CB 3MZGB 3T0ED 1EHLH 1EVTC 4ELMA 3C5ZB 3CFCL 3TZVD 2I5YH 5GSRB 5F7EH 3WFDL 4P2CG 2PUQT 4CDHA 1FL6B 2C7UB 4LAQL 3NABH 3MRKA 2MCPH 5C0BA 1QEWA 3IDXL 1HK6A 2GAZB 4LHQB 4WNQA 5ISZB 3IT8D 4MHHG 4NKOB 1IZKA 4U7SA 3TBTB 1CD1A 3NAAH 2LU3A 3CFJB 1FNSL 4HKJB 4JB9L 1HOCB 1RZFH 1UM6L 5FKAA 4F58H 1LO5B 4PV9A 4M1DH 4L8BB 4MDIB 3K4AA 1JRHH 2FLRT 5E95B 4WFHE 2CPCA 4XPBL 3QDHA 3TH2T 1IC5H 2W65A 4EI5A 1OSPH 1RVFL 1IGML 4CW1A 2XIDA 3SDAD 2EZ0C 1CCZA 2QQKH 3TBWA 5IBLD 1QLEH 4PJFA 4BSVB 3DO7B 4G6MH 4NHUE 2E5EA 5B39B 2R1XA 1JN6A 1ZHLA 2R2HA 3GSXB 5EBLA 1AKJB 3FO0H 2AK4D 1WZKA 5CSGA 2YUZA 3JWOC 3SO3B 2GJJA 3O45B 1TQCB 1YEKL 1F8TH 3S37X 3RWDA 4XVTL 3BH9B 4N8VG 4NKMB 4HXAH 4QHUB 3LH2L 5FUOH 3ZE0F 2EYTB 5INDA 3VI3F 4LLMB 5H37G 3FZUC 3SQBA 3PWPB 1PZ5B 3SE9H 5GGUB 2F9BT 4NGHH 1VHPA 3T0AA 3FRPG 1NSNL 4LVHB 3G08B 2D7TH 5C0ND 3DRTA 5LCVH 2HVKB 3S36H 4D9LH 1KN4L 3BRGC 5CIPB 3TA3C 5KOVC 1HCVA 4GRLA 4L29B 1S5IH 2LV4A 2FEEL 1GOFA 1U93B 4QXUH 3MRGB 2FJHB 1H3GA 1QFPA 2NY5H 3V2AR 5JR1H 5KG9A 4G6FB 4ELME 4KJQC 3K1DA 3FO2B 3P0YL 1MFNA 1I8KA 1JV5B 1O5DT 4LBEA 1A6TA 5SV3A 4Z7UE 2CK0L 3A6BH 4UDUA 1MWAL 4Y4FD 4FFZL 2EEAA 5EU3B 2W1NA 1UB6B 4HIXL 2K9UA 3QQ4A 1CWVA 4CVXB 2Q8BL 2AEPL 1TTUA 3RGVB 4GAFB 1XF3A 5B39G 4ZFOB 1JNLH 1MHCA 4ORZC 1G7LA 1YJDH 2E3VA 3SDXA 3QUYC 3AM8A 5IBTL 5IF0B 4NYLA 1TQBC 4P46A 3HPJA 4NNYB 4XBGA 4FQIL 3WS3A 4LLYA 3IDGA 5SX5K 5GS1B 5B3NA 1VADB 2PYFA 4K55A 3UTTD 1FGNL 3GI9H 4Y8AA 2X1OA 2XN9B 3BEWB 3DROA 3QH3B 4HUMB 4OZFB 1EZVY 5DD0L 3VGHA 4B7IA 2DWEA 3G6AB 3K4DA 3WLBA 3VFNA 1YNTA 2E9IA 4XPAL 5GISH 2IWGA 4R4FH 4X4XA 1Z0MA 2I5YL 3KPOB 2VIRA 5BVJA 4ZOCA 5D2NC 3PWLA 3WYRA 1ITCA 4DZ8B 1MUJA 4U1LB 5BZDB 1KPUB 2CMRH 2XXMB 4MXWH 5C0GB 1EO8H 3MNZB 5GRXG 4WEBL 4E41B 3WL9A 4KMQA 5GJSL 4QEGA 2A6KB 5FV2A 2ZP0T 3KDMB 2PTUA 2RQ8A 1TVDA 3G5VA 3ILPB 1AGBA 2CIKB 4F58L 4HK3J 2A6DA 4WFEE 4PG9A 2YPVH 5CZKA 2E27H 4M7ZC 3I85A 3H3PH 4UZGA 5FO8A 1NCCH 1EVUA 4U0RC 1IC5L 5HYJA 4KI5D 1RI8A 2Z35A 4P59L 4HHAB 2EICA 3AAZA 5CJQH 1OSPL 1DBAH 1X7QB 2IBZY 1CLYH 2QQKL 3DVNA 1OP5H 4E42A 4GUPA 2NXYB 1QLEL 1B0GA 1FIEA 1XCTB 4G6ML 1NCBH 3KWWA 3PQYB 3VI3E 1UM4H 1NGZA 4CMMA 2WMPA 5I1IH 2APFA 1YEJH 4EN3B 3FO0L 3EYFB 1P5VA 3QWRD 3QUZA 4FQXD 3PABA 5LGJB 4BK5A 4LKCB 4BZYA 3T2NL 3CSGA 4WI6A 4HBCH 3HE6B 3BKMH 3CXDH 1WT5C 3BDYL 4HUXA 1NGWB 3C87A 4HXAL 1D5BA 5KSAB 4TYUA 1AO7D 4ZXBD 4JFEE 1ZLSH 1NANH 1RFDH 4NKDA 5FCSH 4WY7L 3MLYH 1VEMA 3SDXE 3IDMB 3SE9L 5ESQA 1K8IB 1Z2KA 2VAAA 4OZ4A 3VCLB 1HH9A 43C9B 2HFEA 2EDQA 5FF6B 1WFNA 4NIKB 1EAJA 4UOW0 1M7DB 1YEHL 2H6PA 1BZ9A 2DJUA 3QUXC 3AUVA 4QRRB 3BQUD 1U91B 5IIEA 2DQCL 1VGKB 3DTXB 4U3CA 1FBIH 4OD2B 1DBBL 5JR1L 1RPQA 3LPFA 1T5XB 4PRBB 1A64A 2VLKA 1DDHA 2BNRD 4BSWA 1V3JA 5DZLA 3IDJA 1EA9C 1EO7A 1K3IA 1MFEL 1W2KT 4ORGB 2ADGA 1MCWW 4YWGH 3T0VA 3A6BL 1KJVA 1TFHA 3L3DA 3VWKA 3DV4A 2VC2H 2HA1A 3JWDC 1EZVX 2FO4A 1B0WA 5I17B 3RPKA 1LVEA 3IXTB 4PB9L 4QO1A 4HWZB 4XNQB 4YO0A 3TNMB 4Y4HA 2GUOA 3ARGC 4OM1L 3G9VA 1KEMH 1YJDL 1LP9A 1GGIH 5CHNB 3GK8H 3ULVD 3IJHB 4V3DB 3HS0B 3S35H 2X4RB 2EC9U 4O58H 4PYHA 1QR1A 1WCBA 2IFGA 5HYJE 5JPNA 4JKKA 1MPAH 3L7EB 5DQJA 3GI9L 3O41A 1WBYA 4Y89A 1T2JA 1U3YA 4UQ2A 1NGQH 2R0ZH 3UTQB 5BO1H 1E4WH 5TFSH 5E9DA 4OLZL 2GTZA 5GISL 5A2LH 3WFCH 3ETBF 1FVCB 4JREC 4OB5H 2ZZUT 4P5MB 3FT3A 4FQPA 4HLZG 4RMSA 1U8MB 5LKNA 1FZOA 4RAUB 4X99B 1NFDF 5I75B 3PWVA 4AL8H 1EO8L 2IBZX 4LASH 3CDFA 3H9SA 4AG4L 2NXZC 4JFXA 3QUML 5HJ3B 5C0AA 3OR6B 2AXFB 1ZVSA 3MNVA 4NRZA 4UNVA 1DZBA 2K3TA 2D4FA 4GXUM 4OUUA 1I7RB 1EUTA 2YPVL 1JGLL 1AY1L 2GQHA 1BFSA 4ZSOB 3DXAD 4Y2DC 1FN4A 3PGDA 3Q1SL 2ARJQ 1JK8B 1ZXQA 4D0DB 1DBAL 1T1YB 3R8BB 3AREB 2MQ3A 4NT6B 1DBMH 1KLUA 3L5JA 1QSEA 4I48B 4Q6YA 1UM4L 3EO1B 1O0VA 2FO1A 2B5IC 3L3OA 4L5FH 1YEJL 5C1MB 5E5MA 5DJDB 2DYPB 2Q20A 3BOVA 2BVOB 4GQ9L 4O51B 4MMZC 5I6XC 5GGTH 5F7LB 2B1AL 2P5EA 3ORJA 1XGYH 1WSST 4KKNA 3QCVL 1P6AB 1RFDL 5TF1H 3S96B 4D8PB 3MLYL 3BGAA 1FJ1A 5T3ZD 1IGYB 4JZNB 1LP9E 1MCLA 4C56D 1LK2A 1I1FA 1TENA 3O9WC 3BZEB 1Z9MA 3FO9B 1HHKA 3GMRA 3NIFE 5L2KE 3P9LB 4G6AC 4UTAH 3ZKXC 3HCVA 4LLDB 1ZT7A 5HGHA 4MQSB 5EPMA 3IJYB 4EIZC 4NQXA 4NNPH 1IBGH 1MFBH 1T0NA 3G5YA 3T65B 4WFGD 4QOKA 4MJIA 1YDPB 1JYWA 3KPPB 3MCKB 4H1LA 3V0VB 4H88L 1FZJB 1I7UB 1MCCA 4Y5VB 3TA3A 2LAGB 1S7SA 3OKLB 5D1XC 2JIXB 4O00A 1KTDB 5BQ7A 2FHCA 3RRQA 2H26B 2ITCB 4YWGL 4G8GE 4NOBA 1IFHH 5HGAA 2FX7L 1ZS8B 2EDEA 3F7VB 2VC2L 3HI5L 5C0IB 4AT6A 4KRPD 1V7NH 5E99L 3T0EC 3CCHA 4RAVA 5C0AE 3TZVC 1Q9LA 2OTPA 3EJJX 1BVLB 1NFDB 5I8OH 2NQCA 1T03L 1GGIL 4HQQL 4HPYL 4K7FB 5J12C 3K1KC 4XP4H 3S35L 3MRQA 1EGJH 1OP9A 3L3KA 3VRIA 2CUHA 2GJZB 4JFZH 5F89B 5IHZB 4RMVA 3WXVH 2VO5A 3CIQA 1D9KB 4XCCH 1J1OH 1TVBB 1E4WL 3FB5A 2FEEI 5TFSL 2YPKA 5D7JB 1KIQA 3Q3GA 4N0FA 3HNTH 3V52H 5DJAB 2AXGB 5C09E 3FTGB 4EXKA 4CVWA 2IH3B 1XR8B 4DGVL 3SDAC 2Y07H 3RX5A 2VITA 3BW9A 5IBLC 4NO3A 2HKHL 4AL8L 4LASL 5D2NA 4HWUA 3KR3H 1N64L 4EI6B 3D6GA 2YXFA 3E6HA 1U3JA 1I9RH 2ZSVB 4JY6A 1X4YA 1C1EH 4XC1L 3DBXA 1BFOA 2D7PA 1A9BB 3FKUS 5JLZB 1U3ZA 1QVOB 2C3HA 4YZFF 4U7KA 1BQLL 3V5KB 1K2DB 1N8ZB 1P2CB 3DUHA 5KW9L 2NY4D 4U1MA 5EO1B 2Y36L 3W0WA 4DN3L 5KN5A 2ADIA 5F7UA 5FECA 4QOKE 4MJIE 1I8MB 5F8RC 1R5VB 5DVLA 5CEZE 3THMH 3VXUB 3EGSB 1G9NC 4E5XA 3KS0J 2A73A 5K59F 4WU7A 3VA6A 1J87A 1JGEA 1KB5A 4ZG1A 4OF3A 5EU4B 3FQUA 4P4KD 4V1DD 5F44A 2BDNL 4U6HB 3BZFB 3ARVA 1QUNA 5GGTL 5BS0D 1BZ7B 1MJJA 1KGCE 1XGYL 1TQBB 2BVTA 1TPXB 3U7YH 3PHOB 1ZANL 1OGTB 1N6QH 2CKBB 1ES0A 2AEQH 3MV8D 4R96A 4QRSA 4UU9B 4RAHA 1BD2D 1ZWIB 2BNUA 4APQC 2HMID 1O7SA 1P1ZB 1P9MC 2ZJSL 4D2NA 1YPZF 3HNVH 3WJJA 1GC1H 4PTUB 3E2HB 4GBXA 4NNPL 1IBGL 4PJGA 1MFBL 1LQSR 2WBJA 5DJ6B 2YUVA 2Q86B 3SHSA 2O5YH 2VDNH 1N59A 5HBBA 5LGKA 2GJ6E 4G80A 1AQDB 3P30H 1ZLVK 2YN3A 1BWMA 3QQ9D 3Q0HA 2ID5A 3B2VH 2ZUQC 3N50A 4NQED 5C08B 3MGTA 1AHWA 1I8LC 3MUGB 3GHBL 1A3RH 3GNMH 5EZOH 4JN1L 2ZPKL 1V7NL 4TNVK 5CP3H 1FGVL 4L4VB 5HYQB 5D2NE 3LKSA 3RZCA 1KIRB 5L8LB 3QIWC 4PRPB 4WWKD 4Y5YA 2P5WD 4CMHC 3VXMB 5I8OL 2A0LD 1B2WH 3QISA 5CSZB 4KTEL 1RQ5A 4L8DB 1D5MB 4NO5B 1T4KA 5I16A 5BRZA 3SDCD 3T8XB 2BOBA 4XP4L 2HT3D 4L4TE 1HHJA 1N6UA 4OCYL 3TBYA 1CN4A 1S7QB 5T5NF 2BSSA 2DQDH 5ELIA 2YWYA 2R29L 1BQUA 4I3RL 4JFZL 1MH5B 3O2DA 3EOBB 4N0CA 3WXVL 4LRIC 1AXSA 2YA1A 4NBZB 4K3DH 5FYJD 1FE8H 3QNYA 3ULSA 2R0LL 1WZ1L 3RI5F 3ZDXE 3ULUL 32C2A 1PKQA 1YY8A 4QKXB 3V52L 3D3VD 4JLRA 4KI5C 2EH8H 1TMCB 3TO4B 5KS9A 3QZWA 2OYPA 2VDQL 3LMJH 4G3YH 4LCYA 4ZQKA 4CVZA 2Y07L 5B8CB 5DQDH 3MRRA 4DVBA 2IPKB 4HH9A 2V5MA 3QDMD 3S4SB 1I1AA 3EZJB 4M61B 3S7GA 1I9RL 5F88B 5FAAA 4FQXC 5I71C 3QUXB 5FM5O 2DM3A 5CINH 2XOTA 1AIFA 1IGTB 2ZG1A 3CLEH 3WIHA 4ZXBC 1EEUA 3IDIB 1VACB 2OXHA 3UYRH 2HLFD 4PJGE 1F42A 1FO0H 4Y2DA 4BZ1L 5JHDB 2FGWH 3BGMA 1LK3H 4P4RA 1RMFL 1YPZB 5IMOA 3AS1A 2EO9A 3THML 1A1OA 2WANA 3I3EA 2VWEE 4WI7A 4GRMB 3X3GL 4BFBD 1M05B 1RJZA 3OKNB 4WO4B 3MV7B 4FXKB 2CDGA 1GCFA 3NCFB 1MFAL 3BQUC 1A14L 4LPWA 2D9CA 1JWSA 3U9UB 4X6EA 3GZKA 3UTSB 3U7YL 3KLSA 1DUZB 1J9CT 3ARFD 3IU4L 1CZ8H 1ND0B 4D9RE 1A3LL 5A2IH 1KENH 4LFHD 3JUYA 5BRZE 5IB5B 1F3RB 3HAEA 2PNDA 3EFDH 4YDLC 3EO0B 3BD3A 3V6FA 2PKDA 2WWKT 1ZLUH 5JXAH 4OGXL 1JL8A 2X1XR 1Y6MR 2Y4SA 5IJKC 1PKQE 1FVEB 3CFDA 4NN6B 1UM5L 3QSKB 1JTPA 5ANMB 2NXZB 5C07D 2XFXA 5F1NA 2J8HA 1A3RL 2XT1B 5HHQA 4JO2L 5EZOL 3QBTB 2F5AL 4PRNB 1R3JB 4XVUD 4AEIL 3QDGB 1JF1A 2EEDA 2VZ3A 4GW1B 4R9HA 2X9XA 3BPLC 4JQXC 3S98A 1BIHA 1FL5B 1NMAL 4UINL 5BV7C 2IMMA 4WHCA 3RDTA 2VLLB 1R3LB 1G1CA 1R3IL 5I30L 4CBPA 4NSKB 5DFVD 2FIKA 4MXQD 4LSPL 3MYJB 5DUPH 43CAA 5IR1B 3AFLA 3RY4A 3RJQB 3ARUA 2OSLB 4JHAH 2HJLB 3UDWC 1U95A 5T3XL 5FV1L 3VWJA 2DQDL 2Z91B 1J1XL 1HEZA 4Z7OF 3B9KD 3F6IA 5E00B 1FE8L 2VOTA 4ZUUA 1QRNA 2XRAH 5I6XB 1M7IA 1OQXA 4RMRA 1GPOH 1CGUA 3OKYA 3OPZL 4PJIE 2F54B 2EKSB 2X4UB 5IKCB 3VI4E 5IQ7H 4U1KB 1JFQH 4RFEA 2X1QA 3MMEA 4P5KA 3HG1B 4LCWD 4TNWK 3MUZ1 3QJHB 2YA0A 5KSVB 4PGCB 2YRZA 1MCSA 5T5NG 5HYFA 5IB2A 5KVFH 2LABA 3INUL 4DGYL 1I3RB 5HI3C 5I73C 4J12A 1UWEL 3MLVL 3AXLA 3ZKXB 4M7KH 3PGCB 1BECA 3DMMB 2H1PH 5J06A 1F6AB 4S0TD 5IVOA 2X4SA 3MRMA 1DANT 2AK4A 3CLEL 3CPLA 4L8SB 5EU7C 4KTDH 4QTHA 5GIRB 4I18B 2X05A 1FFPB 3WKML 1AGDA 2OK0L 1WVZA 4KMTH 3ZT5A 1MI5B 1Q9OA 5D1XB 3DWTA 3SDDB 1KV3A 1FO0L 5D6DC 3RU8L 1HILA 4F9LC 5I2IB 2A74B 5TDNB 1R24A 4JZJC 3NPSC 5D7SH 5HPMA 3TIDA 3S88L 4U1IA 4EDXA 2CUMA 3T0EB 5DLML 1CF8H 2OL3H 4RQQB 5GRVL 2JF1A 3VMNA 1PGRB 5I9QB 4LP5A 3MOAL 5ID1B 2Z8WC 5HDBE 2HFFB 2R2EA 3PNWB 1NDMB 1H0DA 2O93L 1G9MH 2GTWA 1NDGA 1NJ9B 3UMTA 1IKNC 2VLMD 1U58A 5DJZB 1M1SA 5EC2B 3RTQD 2FBJL 4JY5H 4IMKC 4P2QA 1NEZB 1MFDH 2IEPA 3MV11 2CLVA 2R8SH 1GHFL 2JJSA 4KRPC 4JPKL 1VEPA 4P99A 3EYOB 3IFPA 4GW5A 4Y4FA 1CFBA 2I24N 4LGPB 2NW2B 1IAOB 3GMMB 1P9MA 4H8WL 5K9OB 3TCLA 5FYKD 3SDAB 3RWFB 1C16A 4X9BA 3LVEA 3U6RB 1MAJA 3ARDD 4FTVA 2ICES 3QRGL 4YNYA 4JRXD 5H35B 2Z92B 3VGEA 1GGTA 4CU8A 2BY0A 2VDKH 4L9LA 3UTTA 4EVNB 1I8LA 2OI9B 4DEPC 4LNRB 4XP5H 4NWUH 4H0HB 4YHYC 4HUVA 4PJ7E 4BH8B 1X44A 2ATKB 1D5ZA 3VG0H 1T7XA 1FC2D 4PRHB 2WNGA 2O61A 3ILQD 4IJ3C 1UWXH 1E4XL 2AK4E 2UZXB 3P9MA 3X3FH 5FGRA 2XPGA 4A6YA 3WNNA 1EXUA 2EDRA 2NY6B 5DI8B 3EYUL 5FOBA 3SQOL 1X4ZA 1KTRL 4XAWH 4B53A 1K3ZA 5AYUH 1H8SA 3BWUC 5MERA 3F58H 3MGOA 2MPAH 2JCCA 1CFNA 5JQHC 2XRAL 3E0GA 5F1KC 4KRNA 5L6YH 1BX2B 2L0DA 4G7VH 5TH2B 5IQ7L 3V6OC 1GZPA 4S0UC 4XRCB 5HHOB 1JFQL 3ZDZF 3WJLC 2AW2A 4XMKL 3MJ8B 5KVFL 3SKNA 1U8NA 4PJ5D 4JJ5B 4APQB 3O8XA 2J3SA 3CZFA 2IQAB 5K9QI 4NCC1 5BZWB 5GGQL 3WDJA 3G5XA 4M7KL 4P4KC 2NX5D 2FSEB 3BP4B 2HWZH 1I85C 4PRIA 3OQ3B 5J6HB 4XCFL 2X40A 4BK4A 1P7QB 4XNYH 5SWZD 1X5IA 4R90H 3X11B 1J11A 1O7VA 5JPMA 35C8L 4KMTL 3D85A 3LN5B 4ODXB 3EHBC 4XWOC 5IEHB 1MCOL 4ZFOL 2GY7B 5ITFA 3EDFA 2H2PD 1FNGA 2IFFH 5F7DB 3OGCB 1Q1JL 1BPVA 2RFXB 4U2ZA 4MJ5A 4UAOB 5TQ2H 4YXKL 5EN2A 2HMIC 5D7SL 4HIJB 5IROA 1ZK9A 4ETYA 1CF8L 1EFXB 3WN5A 1XIWD 3QIWB 5MENB 4RGNB 1A6UH 2W0PA 3VD7A 3K4ZA 1V5JA 4NN5B 3UTTE 4LLUA 1N5AA 3FOLA 4HGWA 2OTUA 3L5IA 5DURD 4ZTPL 3CXHK 3PIQB 3NN8A 3QQ9C 1OP3K 3BQUA 1MVFA 3EYQD 5CJBA 2I60H 4FP8L 2R69H 1HQRB 3JSSA 1VFAB 2R39A 4JY5L 4UOW1 3Q6GH 4KXZI 4XH2A 3PJSA 2BNRA 5E1AA 2GI7A 4LHUA 4HLJA 1LQVA 3MCG1 3P4LA 3EIFA 5HY9B 5EORL 4WWKC 5IW6B 4R8WL 4Q0XH 3VFVA 4ODBD 2DM7A 2JCCE 3SDCC 4MAYB 3FQTB 4HKXA 5D1ZD 1ZGLM 4PJDF 4OLXH 1BVKB 3KPSB 4OFYA 3N1FC 1AI1H 4XZUA 2VL5A 3Q2CA 1JHLH 5KSBF 1NC4D 3LKNA 1R5WB 4KI5E 4J7RA 4XC3H 4XP6H 4LQFH 5I71B 2JJUA 2FJFB 5AUMA 2DRUA 4XP5L 5CGYD 3IETB 1CXEA 4AQOA 2C1OB 4WW2C 3MLUH 1FDLH 4D3CL 1AO7B 4PJFF 4OV5B 4P2RB 4QYOB 3OXSB 2WQRA 3CUPA 2R4RH 5I1GH 3RVUC 5AD0B 4NCC2 2EXWD 3FFCD 5KANI 4PRIE 4YGVA 4F15B 1EEYA 5ACZB 1NAMB 3RWHA 4QRUA 1LNUA 1T0MB 3MLSH 1G6RB 3X3FL 4OKVB 2X9YA 2X4OB 3BZ4A 5DTFB 3U0TB 1FZMA 1J0YA 4WTXA 3VXRB 1OARL 3HI6H 3MV9D 1L0YA 4XAWL 5E94A 3UPRA 4YDIH 5AYUL 1AFVL 2MPAL 4BH7A 3SBWC 2ADJA 2CR3A 3REWA 2QTEA 1UQSB 1PJ9A 5DD5L 2Y23A 1ZOXA 3U0PB 4G7VL 2QEJA 5ICZA 5BXFB 2FHFA 2HLFC 4BUHA 4QT5A 3LOWA 3QXDA 1KF9B 1N6VA 3DXAA 3LKQB 1E6OH 1I1RA 4I0CC 4F57L 1UGNA 3NCMA 5LQBH 4NQTA 3VXSD 1JZ4A 5IGXL 2YD5A 2BRQA 2VDPH 3R1GH 4AMKL 2P7TB 4PS4L 4U6YB 1FAKT 1I9EA 4KY1L 2D2OA 2IALB 1OD7A 2HWZL 1ADQH 1N2RB 2CK2A 3MUHL 1OQOA 4K7PL 3HZMA 5IB4A 2BNRE 2X4PA 1EJ6A 3RKDC 4ELMB 2AJYH 3GSQA 3TWCL 4QHMA 4QRPA 4XCNA 4PJXA 3ARFC 2B2XH 3O6ML 1XMWA 2VXVL 4GG6F 1MCJA 2G75A 1J8KA 2IFFL 5C0BB 1QEWB 1QA9A 3DVGA 3CSBA 4WNQB 1UFUA 2J7LA 3ZTNL 1J1PH 1J0IA 1RUMH 4CL7A 5I1EL 4C56A 3BEVA 3WDIA 2NTSP 3BPLB 3ULVE 2HLAA 1UCTA 1IQWH 4I4WB 2C3GA 4FQQA 4M1GH 4PV9B 5DJXA 2YD2A 3QA3A 3BKYL 3KYOA 4NFBA 2XKNA 5KSBB 2R69L 5T1LD 4WV1A 1KJ2B 4O2EB 3IVKB 2XYCA 3D39D 4XVUC 1SYSB 4RWHA 5CLWA 5DVNA 3KXFB 4HFWA 4PJDE 2ZG3A 4PJFB 4OTXH 1QACA 3ALXA 3OAUL 1CXFA 3VFTB 2R1XB 3REVB 1JN6B 1KOAA 4OBRA 5I1CH 3OB0H 5DJCB 1SEQL 5DFVC 3OKMA 5I1JL 1E6JH 3SCMA 4DJMA 4M43H 1J18A 1VFBA 3BP6A 1Z9SA 4QGYA 4JO4L 1G7HB 4HWNA 5EU5A 5A40E 1AXIB 4C55A 5INDB 4KJYB 3P4OA 5AWNH 3S97C 5I73B 4S2SA 2FZ3A 4WTWA 5E70A 3LSOA 3AY4C 3B9KC 3DUSA 2C3WA 4LDEB 3DXAE 5DD6B 5HHVL 4XCEB 4HEPG 5CD5D 4TPRH 5LAXA 4LQFL 3PHSA 2APWA 2EYSA 3VFPA 4JM4L 3MFFB 3DRTB 4ERSH 3MLUL 1OGAB 1KJMA 3QEQD 1F4YL 4OCMC 3MRFB 4NKQB 2OJZL 1L0XA 3RA7H 3PL6D 2P24B 2GCYA 2J8UA 4Y16D 1HYRC 4GAYA 4GKNA 4NQSB 3MLSL 4JZJB 1OL0A 1N0XH 1WK0A 2DIBA 4PJXE 4G5ZH 4LBEB 1OD9A 1NAKL 5GS0L 2PYEA 4QY8A 4XAKE 1AD9A 4TULH 5I76B 3BN3B 4YDIL 3WXWL 4YGAB 4BFEA 4NOFA 3MR9A 5CAYB 1JPSL 3I6KA 3UZEA 3QG6B 3QQ3A 5J8OA 1EFQA 1OB1A 5EFIB 5I74C 2ESVA 5T3ZE 2FR4A 3NCCB 1IM9A 4C56E 4XPHH 1PQZA 2R23A 3PWNA 1XF3B 3RL2A 4ZFGH 1MHCB 3KNBA 4NO0A 1CGWA 1V3MA 4L9DA 5IBUB 4XBGB 1LHZA 3IDGB 5DUBA 4WFGE 2VDPL 3R1GL 4MJ6A 1HKLL 3BSZH 3WJLA 3STBA 4GG6E 4JO3H 3ZE2E 3JV6B 3PDDA 2DI8A 3ZKND 3QFJA 4GAGL 3WLBB 1BZQK 3VFNB 4KH2A 2AJYL 4NBYB 4M48H 2NNAB 1LE9A 4J3WA 4X4XB 1KELH 1QLFB 2R1WB 2UUDH 4R7NB 3LZFH 1E4XI 4H25A 2R1YA 1I75A 3PWLB 3RTQC 3L1OH 2P42B 4OGYL 4LMQI 1S9YB 1BAFL 2P8MA 2I27N 2V5SA 5EIIB 1SM3H 2NY1C 4X4YA 2OJEA 1J1PL 3WL9B 3WO4B 5IOPA 4F8TA 1S9VA 4DEPB 4S1SH 3TN0A 4UQ3A 1BD2A 3PWJA 5EA0H 1FQ9C 3JXAA 3G5VB 1CT8B 3MXWH 3UZVB 1KXVC 5EUKA 1S7WA 1BBDL 1I8IA 4PG9B 4XPFL 4LIQL 2H2SC 1TETH 4J1UA 2F74A 4P0DA 3C8HA 3T09A 1AC0A 1DBJH 1SYVB 3LKPA 3ARDC 4HKBA 3EOAA 4IRJA 2Q76A 3TH4T 4HCRA 5E8OA 1HWHB 2Z35B 2CRIA 3AAZB 1A6AB 1RZ7L 4MWFA 2DF3A 3TBSA 4PTTB 1JWUB 5J1TC 4NQEA 3DVNB 4E42B 1WZLA 3P11H 4ZUTB 4M7LH 4OTXL 2DI7A 2J8UE 1J0KA 2FIRT 5FO7A 3KWWB 1FV1A 1XEDA 3HNSH 1YUHB 5LBSH 5J9PA 4YBLB 3ZZ1A 2PYEE 3P0GB 5I1CL 2BSRB 1HI6B 5ENWA 4DUVA 2Q7YA 1U42A 2NLJB 2DKSA 1E6JL 1FIGL 4KRLB 4WW2F 1GVIA 1A4JA 3RPIA 3MRPA 2P5WA 3ILQC 4HUXB 1D5BB 4XBPA 5LG1A 3VXNA 1JYNA 3W39B 3R06B 3NFSH 4O02L 5AWNL 4C4KO 1CGTA 3MXVH 4JRYA 3SDCA 4B5EA 5J0BA 4JQVA 3LPGA 5J1AA 1VERA 2ZUWA 4V1DB 2VAAB 2FX9L 3MBED 1HH9B 4ZTOL 2Q6WB 1NC2D 3BN9D 1CK0L 2MKLC 4ERSL 15C8H 3WIFB 3S8WA 2Z31D 1G84A 2H6PB 1HNFA 1RK1A 1MCIA 3QXAA 5SWSA 1ETZB 5IIEB 2ZWLT 3KJ4B 4IIQC 3QFJE 3EYSL 5HTSA 3PDGA 2VLKB 3NA9L 1HDMA 4HXBL 4BSWB 5BS0E 2CKBL 4C59B 3IDJB 4IRSD 4LLAA 3QDMA 5I1HL 3QG7L 3CFKB 4OQTL 1V3KA 3L3DB 5JXEC 3VWKB 5IK3B 2F58H 3MV8E 4FOMA 2HTKD 2BVPA 2ZUUA 3D25B 1IAKA 4FFYH 1I1YB 4XPHL 3SBWA 1BD2E 3ZT7A 1UZ8A 2GUOB 3QYCA 3LD8C 1KIPB 4KWUA 3NCBB 2H2PC 3C60D 3ECBA 4Y7MA 1H3XA 3DECA 5K9KB 4JR9L 5CLTA 1QR1B 2BRRH 1INEH 1NPUA 3BSZL 4ISVA 5I15L 3QXUA 1XIWC 4HWBH 4WWKB 4BQ8A 4F7CA 3VD5A 4NQEE 1T21A 3DVFA 4H5SA 3VGGA 5M95B 3HMWL 3X13B 1D6EB 4A2MA 4OLUH 2ITDB 3C08H 5E9DB 2W9DL 4F7EA 2GTZB 1B0RA 5AG9A 1TJIH 1KELL 2BHZA 3EYQC 3LZFL 3FT3B 3OKEB 4QHNA 1DQJB 1FZOB 4JFDA 4UUJB 4M8VA 1KT2A 3ARFA 1SJVA 1MOEA 2P5WE 2IADA 4S1QH 1SM3L 1LO4L 2NY3B 3H9SB 5HYSA 4S1SL 4JRYE 3H9HA 4XVSH 4ALAL 3D3VB 1TCMA 4P9MH 4FQHA 4ODSH 4C4KT 2OQJA 3MXWL 5JQ6L 4LLWA 1A7NH 3D18A 2K7PA 3UJIH 3S9DB 4JN2B 4Z18A 3MNWB 3T3PF 5D1ZC 3O2VL 3WS6A 2AK1L 5FDWA 1DLFL 1LD9A 2GYSA 5FYJE 4LF3A 4G7YH 4O2FA 1SVCP 3MC0A 4CN4A 3GBNH 1KNOB 1SJHA 4AENB 5SWSE 4JHZA 4P3DA 1KLUB 4Q6IA 1QSEB 3P11L 1WIOA 4P48A 4QCIB 3HNSL 5CGYC 3L3JB 4QHKJ 5EDXA 3QDME 3HUJF 5KAQF 1RZKH 2EXWC 4PJ9A 2P5EB 4Z7NF 4U6VH 4RGMB 4NO2A 3A67H 4MXQA 3MXVL 1R3HA 2HN7A 3LHPH 1BLNB 2CDFA 1FJ1B 4YFDB 4YAQA 4C54A 2IH1A 1U41A 1AE6H 5DEFA 1I1FB 4TSBH 4ZOEA 3E6FB 2Z9TA 1HHKB 1XF1A