4Z76A

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
total genus 75
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z76A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4z76A01
4QLRA 3BKCH 1HIMH 2XN9D 4LKXA 1WBYA 3VW3H 2J4WH 1NJ9B 4KI5C 3QUMA 1IL1B 4XC1L 3S36X 2ZPKL 4J7RA 5TH2A 5DJZA 3SCMC 4JRWA 4OUUA 1OLLA 4HUXA 3LVEA 4X6FA 3GSVB 3VFWB 5F7NC 4XXCA 3ZKSD 2VITA 4I5BA 2YEZB 3HNSH 5C0CB 3MLXL 1OPGH 4IMKC 3ARGD 2NY0B 4JY6A 5BW7A 2VIRA 5FYJL 5C08E 4MYWB 3QUYD 1IFHH 4L3EA 1HNFA 1WFNA 3S8WA 1XGRB 2B39A 3FO0L 3NFPA 3FJTA 5EZLA 2F53B 3T2NH 4JFZH 2LU3A 3C5ZB 5INCA 3NFSL 1ZT1B 3EIFA 1GGBL 3C5JA 4OLUH 5LXGH 1A6WL 3P77A 4JN2B 4HFWB 4HMDA 4PJ8C 4YPGB 5GS0C 5KBNC 1DBJL 3QIWC 4YHIA 1EGJH 4DOHE 2AERT 3WS6A 1T4KA 3ALWA 5LGHL 5JOPE 1H3GA 4FTVB 4KU1A 3G5YB 1JWSA 1R5IB 3CFDA 1PVHA 5CEXA 2HVJB 3BVNB 2XKNA 3QNXA 3RWCB 5CBEA 3O4LE 2VLKD 3DX6B 3RWJA 4M43L 4GMSH 3ZSTA 2F5BL 3W9DA 1CU4L 3RFZC 4ZXBD 2EKSB 3PWVA 2DYPA 2P43B 4KMQA 4RFEB 2CDEA 4I3RL 2CRMA 1I4FB 4WVRA 4R90H 1KULA 2OL3A 3GBNH 1M6OA 4K7FB 4NKOB 1HCVA 4TPRL 4V1DD 5DZNA 4PBVC 4MDIA 1I9IH 2C1OB 2BK8A 1UACL 5C0IB 1JYVA 5GGVL 3KYKL 5DMGD 5CCKL 3O11B 4L5FL 2IJ0C 5I75B 5SWZE 1ZSDA 5C6PB 2RGSA 5IB1A 4GRLA 3P30L 1S9VB 4L4VA 4J3WA 1KPRB 5ISZB 2AJXL 1H8NA 4D9LH 1U8NA 4JFYA 4M02A 1DEDA 1VGKB 3IFNH 4I18B 2ORBH 3TZVC 1X5IA 3OPZL 5D1XD 3L5XL 4I4WA 3UTOA 1IKFH 1OTUC 2JJTC 4PP1C 2R8SL 1KEML 3ME0A 5CIPH 2PXYB 4U3XA 2AEWA 3L3JA 4U1LB 4XPAH 2Q8BL 1JNLL 3CXHK 4JDZA 4YK4C 3X3GH 2P5WA 5ICYA 3JTSB 4S1DC 3W82A 4Y4KA 3HE7B 2YHGA 4UNTA 4R4ND 3B2VH 1B2WH 4XP5H 4ETQA 5IEHB 1UWEH 1I8IA 3LQZB 4P2QB 2AEPH 4FXLA 2ADIA 5IBLD 3NCBB 3PWUA 1U93B 1M1SA 5F1IB 3RTQD 1CIDA 1EJ6A 4IRSA 1OARH 4PRAA 1WTLA 3T4YB 3DNKA 1M7DB 3K1DA 2EC9U 5F9OH 4BSVA 3EO1B 1LQSR 2EO9A 4PRIA 4X6DB 4KK6C 5B39G 4GAFB 4O4YL 5SV3A 4K9EC 2ZJSH 1T1XA 3U46A 3M8OH 4BH8A 3VG9C 1NBZB 2OTPA 2UWEE 3NIGF 4PG2C 1IAII 4NN5C 1GL4B 2FJFB 3ARSA 4R2GD 2CGRH 4YZFE 3OWEA 4J3SA 2E7HA 2R4RH 4NO3A 3O8XB 5D93B 2DICA 3UTTE 4YQXL 3R0NA 1B6DA 2DQDH 3ZSSA 5EU5A 4EI5C 2A83B 4N8PA 3BPNC 4JR9H 5B39B 3TJHA 5E8EB 5FYLL 3PABB 2E9BA 2EH8L 3DUSB 1IC7H 5C0BD 2DI9A 3PL6A 3GB7B 3B2UD 5IFAL 3S9DB 2AJZB 3LMJL 5F9WC 5GQBA 3ARBC 2IPUG 1OGTA 4I48A 5I1EL 1JNJA 3RKDC 1T21B 3FONB 3OJMB 3P9LB 4P2RE 3MLUL 2AI0H 3MLWH 2VUYA 1UZ6E 4PREA 1JPFB 5KSUA 2HRPH 3OR6B 3ZL4L 4Z7WF 1NH6A 1FH5H 4QCIA 3R1GH 1NGPH 4LVOC 5C08A 3U48A 1RK1B 1XCTB 4WU5A 3C8KB 5ALBH 3QHFH 1C8PA 3T8XA 1ORSB 3DARA 4XVTH 2PETA 3Q5OA 4UV7L 3P2TA 4MAUH 5ALCH 3T4AB 4NQSB 1NCUA 2JIXA 4LBEB 4TSCL 1GPOL 3OJDB 3O9WB 5GRJH 3T0ED 32C2A 4QO1A 4HS8L 1N5AB 4OI9A 4LIQL 1S3KH 1NC4D 4V3EB 1FG9C 5ERWA 3B9EA 1TTUA 4KXZI 5K59F 3BGFC 2Z93A 5FA3A 3LKRB 3O4LA 3E0GA 3WN5A 4CVUA 2FL5B 3RPIB 3LKNA 4PJGF 1KCGC 1G9NH 5GS2D 4ODVL 4GKSB 5DEFA 4ZUWA 4WNQA 3RDTA 1SHMA 4P2OB 3QIBC 3DBXB 3GFUA 3MV7D 5INDA 4MD0B 5HY9A 1RULH 3NTCH 5HXMA 2VXVL 3BJ91 1HI6A 1ZHNB 3K81A 4HJ0D 5C0DA 4MHHI 5DR5H 1KLUB 2FEDC 4M7LT 1I85C 3ARDD 1ZS8B 3O6KL 4NQDE 2AJSH 4WWKD 2QJDA 1B4RA 1J0ZA 3CSGA 1N64H 4FQQB 4HJGA 4XTRD 1CGXA 4FQJL 5BO1L 3UAJC 1FZMA 2VLRD 2WLZA 4G6MH 3EFFB 1RU9L 5CFHA 3BDYH 2GTWA 4RDQG 4KI5D 3OKDA 4FQXB 4PJHA 5CLTA 1A6VH 5L8KB 3O3UN 5ENWA 3HI1A 1L6ZA 4GW5A 4YDLC 2DDQH 2PYFA 3JUZA 3WV0A 3WIIL 1IM3B 3BO8B 1JPGB 3QZWG 4FP8H 4FZ8H 3GDBA 3MRDA 2ITDA 3KPQB 4NCDA 4KKNA 2ZUQB 4Y5XC 4P3CH 2GQHA 3D2UA 3R06A 1FPTL 3G5VA 4XH2A 3O6FD 3MJGX 3G5XA 3HR6A 5ITBL 2WWKT 1Z0MA 5HHPB 1AGFA 4MAYB 5AZ2H 3MUGA 2Y36L 3IXTA 4NWUH 5TJWK 5GS0D 4KJPD 4OCSH 3NACH 1CXEA 1EHNA 1FO0B 3B9VA 3DROA 3QZWB 3ULUH 2QLVB 4LMQI 3WXVL 3MRGA 5E5MB 3VFOB 3HPJA 2CLVA 3MUZ1 5EUKB 3H42H 1D5XB 2A2QT 1JRHL 1J5OL 4MJIA 1MIML 4ZFZA 4G9DA 2HJLB 1JGLL 2CKBA 12E8L 4XCNB 5L7XL 2DTMH 4LASL 4MJ2A 3GI8H 1F4YL 1OAXH 3UTTA 4Y19E 4P48A 3ARFC 1S7WA 3NCYP 3HC3L 2B7DT 4U31A 3VXNA 3I6GA 1N6VA 3SBWA 1J1XL 2VXSL 4LKXB 4N5EA 1WBYB 3V6FA 5MHSD 4KUZL 5EBWA 3N1GC 3HTLX 3UPCA 4ZPVA 1GVIA 3RGVC 3ETBF 5E4EB 1MFAH 5TH2B 5DJZB 4PBXA 5JIKA 4JREB 4OUUB 4M3JA 1ACYH 4HUXB 4X6FB 5FCSH 3PP3H 4NQVB 1BHGA 1EEYB 2VITB 5D4QA 4P2RA 4HD9A 4E0RA 4JY6B 1NKOA 2VIRB 4PD4K 2BVTA 5CINH 4O02L 3EDFA 3QDMD 4L3EB 1G9EA 3QFDA 3SE9H 2EEBA 1OTUD 4D9RD 1CFBA 5J12C 3NFPB 1N0XH 4N0CA 4V3DB 5IVZB 3TH3T 5CWSA 5EZLB 4NC2B 1MI5D 5INCB 1GSMA 4Z7QF 3C5JB 3P77B 1F3JA 4LK4A 2AXGA 2DQTH 4U3HA 1FFOA 4U1SA 4YHIB 5EN2A 2EEDA 1T4KB 2XYCA 1AKJA 4NN7C 4ZTPL 4MVBA 4ODWB 5C3LD 3QSKB 1JWSB 4PJHF 3CFDB 1N3NA 5F6HJ 5CEXB 1F90H 1TLKA 2HWZL 5IB5A 2XKNB 3QNXB 2X9WA 5J1SC 5CBEB 4JKPH 4ALAL 3RWJB 5HHQA 3W9DB 4PJAF 2BY1A 3MROA 3KPOA 4KK6D 3EHBC 3U82B 3PWVB 2DYPB 1TVDA 2I9TA 1ORQA 1MHCB 2CDEB 4N0YL 1IGFL 4MXWL 1MEXL 2OL3B 3F58H 4HUVA 1M6OB 5DMKA 1DBAL 2HG5A 4YHMH 1MCPH 2VLKE 4LKCA 3G6DH 4MDIB 4UB0L 2C4XA 4M7LH 5CUSH 1MCQA 3DGCR 2D9CA 3S98A 5KTEH 2QR0A 1JL8A 3JTTA 5T5FH 4WI5A 1ZSDB 3NCFB 4NQDA 4DWHA 4GRLB 3QXAA 4L4VB 3VDCA 3JUYA 2R39A 5DVMA 5T1KD 1DSFL 4JZNA 3N1QC 1U8NB 3O81A 4JFYB 2D4DA 1ND0A 4WO4D 4K3HA 2YXMA 3H8NA 4S2SA 1D5ZA 2YPLD 4AG4L 2CSPA 3EO0A 5TDOA 4L8CB 4RGNE 2GW5A 4WFFD 2QHRL 2X09A 1JYXA 2WBKA 3QIUA 1UM4H 3NIFF 5H35A 2YD1A 3QH3A 4EOWH 3RKDD 4Q9QH 5K9JH 3L3JB 3NA9L 5GSVA 4JDZB 4RA3A 2P5WB 43CAA 4ONGH 5ICYB 4Y4KB 1FVDA 1I8IB 2ADIB 2VL4A 5IHZA 2PN5A 1OP3H 2Y5EA 4O51A 2BDNL 3PWUB 1MWAA 2CPCA 4IRSB 1CG9B 3FAWA 4PRAB 1MJ7L 4U0RC 4IRJA 2CJUH 5FUOH 4KAQL 5H37H 5HVHC 4BSVB 4RFOL 5HYEA 1QLFA 1MQKL 1YEGH 2DMCA 3STBA 4PRIB 5GGRA 1P4BL 1AC6A 1UJ3C 2V6HA 4BH7A 3JWOL 3VXQA 1HYSC 2O5YL 1C12A 1T1XB 4Z7UE 1DDHA 3U46B 3W0WE 4BH8B 1N2RA 2QADB 4V2CB 4P9MH 1V7NH 4RAHA 3V0AC 3MRRA 1BOYA 4C55A 4AQOA 1SEQH 2R2EA 4NO3B 1NDGA 5GRVL 2FX9L 5I30L 3GBLA 3IAPA 4K3DH 2MWCA 3ULVH 5EU5B 1KCRH 2ZP0T 5KVEH 3GSNA 5I8KH 3PQYE 1S7UA 5K93A 1JCKA 3VGDA 3RIAF 1MCBA 1RV6X 3PL6B 1DE4A 2UUDK 1ERNA 3IKCA 3CLEH 3BRGC 3VI3E 1OGTB 4QHNA 4I48B 4PGZA 1NGQH 3MLTA 2K7QA 2DKUA 3UAJD 1EA9C 3WJJA 4PGJA 1W72L 4G5ZH 1DBBH 3LY6A 4F2MA 1A7QH 1G7QA 2IWGA 4O2FA 1NCBL 5DEZA 4Y4FC 4PREB 5KSUB 3OAYK 4S10A 1Q0YH 4NHCL 1LO4L 4QCIB 2LVEA 4LLMA 5C08B 1VACA 3IU3A 2OL3H 4WU5B 3FRUA 5T3ZL 5HSFA 1FSKC 3WNKA 4KRPC 3T8XB 3P0YH 4AM0A 1LE9A 1TJHL 2ADFL 2EDTA 3WO3B 3QAZB 1VSCA 2JIXB 3MLVL 3DV4A 1MAML 1SY6L 1CZ8L 4DOHB 4YXLL 3K8KA 5KANG 2M8XA 3QUML 2XZQL 5ERWB 4TNVF 4GT7A 5IROA 5HI4C 2H32A 2ERJC 3OKNA 3QJHA 5L88L 2Y4SA 4XVJL 2Z93B 4HK3N 4I2XE 4EJ1C 1UFUA 1AY1H 2W60B 5FA3B 3O4LB 3DIFA 3WN5B 3DX8A 3LKNB 4NNPH 2FECL 1D6EA 2VQTA 4QHKJ 5DEFB 4ZUWB 1YEKH 2WUCL 4WNQB 3RDTB 2MFNA 2A6IA 2A9NL 3T0WA 1Z9SA 5IJVA 5INDB 5DMJB 5HY9B 2B4CL 3C6LC 2BVPA 2F58H 2VLKA 2APXA 3EAKA 1HI6B 1QKZH 4LRNL 5DRWA 5C0DB 1AFVL 2LU7A 4HIIA 1EAJA 1PKQE 3VGAB 2WUBH 1S7XA 1AI1H 2EH7H 2DLFH 2D0FA 4AT6A 4KWUA 4R26L 3QISA 4HWUA 5SWZB 3MV7E 1FZMB 4TULH 5I74C 3BZDA 1YEHL 4L8SA 4NKDA 5E9DD 3F5WA 5HI3D 2OYPA 4K2UH 2GTWB 4OCYH 2RCSH 2N7BA 3OKDB 2WV3A 3RGVD 3A67L 4PJHB 2QSQA 2ZG2A 5D7SL 3S35L 1TVHA 4HULB 2AJVL 4AEHL 4TVPH 3HI1B 1ZGLB 2J6EL 4GW5B 5JW4Q 1P9MC 4P3DA 5IQ7L 1A1OA 4IM8A 2PYFB 2VLRE 1QNZL 4RZCA 1MF2L 2ITDB 1FYTD 3AAZA 4S0SD 4KI5E 1FC2D 4GFTB 4NKMA 3D2UB 3R06B 4HF5L 3G5VB 3LKQA 3G5XB 1K9TA 4DGIH 1RZ8A 2VDNH 1XGUA 1FL3A 3BKYH 3QB7C 4OF3A 3FFCE 1AGFB 1G6RL 4LARL 1VB9A 3RZCC 3HZVA 3MUGB 4UT7L 3BP7A 3IXTB 3OF6D 5CILH 4QWWC 2JELL 4KDTC 2WW8A 4TQEH 3DROB 4WFED 5SX5K 4DN4H 1TFHA 2X2YA 3FQRA 2R15A 3MRGB 3HPJB 2CLVB 2E5EA 2GAZA 4HUMB 2J8HA 4MJIB 5EUOF 4JAMA 4Z7UA 4ZFZB 1OW0C 1GAFH 1UKSA 2V5YA 3W0WA 4NC1E 3KR3L 2NXYC 3MXVL 2UWEB 2CKBB 1KV3A 3VXSD 3I6KA 1WCBA 3IDYC 3SQBA 3WS3A 2G75A 1KLGA 3UTTB 1S7WB 2OP4L 3RVWC 2DQUL 5HGBA 1IE5A 3VXNB 1KN4H 2R0LH 4HIHB 5DSCA 1JK8A 3PQYA 1AJ7L 4XVSH 1MRCH 3D85D 5EBWB 3ZO0A 3NZHL 4PLJC 4Q0XH 1QSZA 4QOKD 4ZPVB 2GITA 2FH6A 4TUJA 2GJJA 2B1AH 3UP1A 1KJ2A 4I1NB 1PY4A 4I13B 1I9RH 2HLAA 2ZZUT 5AZEL 4PP8C 2AQ2A 4FMKA 5MHSE 3SY0A 4P2RB 4E0RB 1U8QA 1HHKA 1BBJA 4MXQD 5LCVH 3DSNA 1IBGH 3QFDB 2YC1A 5LKNA 3KLHC 3WLBA 1FZJB 2JJVA 5CWSB 1QSFA 3H7LA 3IXAB 4JFFD 5JXAL 1F3JB 4D8PA 1LEKB 4BQ6A 1JGVH 1MCWM 2AXGB 4WHCA 5B38A 5KAQG 1AIFA 1FFOB 4U1SB 5EN2B 4DN3H 4NRXB 5I18L 5F96H 4D9RE 4P5TD 4OZIA 1AKJB 3QEUA 1F4HA 1F5WA 2YD6A 5I1LA 3TBTA 4JCLA 5FV2A 1MI5E 2ZUWA 1P5VA 3DYOA 3QEHA 5TQ2H 1MHPH 1KJMA 4TOYL 5E08L 5IB5B 4U49A 1E6JH 4H1LA 1N5YH 4K7PH 2IADA 3LHPH 1YJDH 4BFEA 4I2XA 3AY4A 3KPOB 4YXHH 1PJ9A 5CAYB 5E24E 1OSPL 3IYLW 5DD3H 1HYSD 4M4PA 2I9TB 1ORQB 4UAOB 2VDKH 2X4UA 4OTXL 4X4YA 1NC4A 4HUVB 5DMKB 2HG5B 3CFCH 4Y2DD 5DVOA 4G7VH 1UJTA 4LKCB 3GM8A 1ULVA 1YUHA 4TRPL 1A9EA 1GIGL 1QG3A 2QR0B 5GS1B 2BC4A 3WXWL 4NQDB 1MFCL 4PJFA 4KVCL 2VN7A 3C09B 3NN8A 2DQHH 2AJUL 3QXAB 4NDMB 5HDQH 3TYFA 3RVVC 3ZTJG 3MV7A 4JZNB 3QEGH 3S37H 1ND0B 4LLUA 5FYKD 3V4VL 2ICWI 3PWNA 4S2SB 3FCTA 1D5ZB 4R97C 3EO0B 5TDOB 3V4UL 2FR4A 4NZRL 3ZDYE 1QEWA 1QSEE 3NCCB 2GCYA 3QIUB 4QXGL 5H35B 4PRHD 2IC2A 1NLDH 2AK4D 3AUVA 3HUJF 3QH3B 5AWNH 3U0WL 4B7LA 1CD8A 3IJHA 4PP2A 4D9QD 2CKBH 5GSVB 1BFSA 4R3SA 1EO8L 1CFSA 1P6AB 2VLRA 3JV4A 43CAB 4K8RC 4OI7A 1R5VA 1FVDB 2CLZB 2YPLE 3EOYG 4WFFE 4K94C 5IHZB 1RJCA 3SCMA 4O51B 5KVFL 3EYUL 1FNAA 3VXOA 1MWAB 1XF4A 5KS9F 4KRPD 3S96A 4IRJB 1T89C 1MAKA 2E7BA 3MJ8A 5EOCL 5B3JE 3FFCA 1VFAA 4OZHE 2P7TA 2GJZA 3KS0J 4IMKA 1A3LH 1UM6L 5I1IL 3V5HA 1QLFB 3NA4A 5GGRB 4BH7B 4ZG1A 2AXJA 5T33H 4XCCL 1L7IL 5TE4L 3VXQB 4KQ4L 2IPTL 5L0QC 5DC9B 1K5NA 1C12B 1DDHB 1Q72L 1HHHB 5JHLH 1YPZE 1N2RB 1P4LA 4M48H 1XR8A 3DV6A 4PJ8A 2R2EB 3QIWA 5EU6E 1BOGA 4YGAB 5ICZA 4JHWH 1LO0H 2B0SL 4N9OB 3OR7A 4Y19B 4LCYA 2GY7B 1QFWI 3GSNB 2A6JA 3TT1H 1S7UB 1IEHA 1KCUL 2X4SA 2X70A 1U3HC 2DM7A 3OHXB 3K2MC 5ITFA 3IKCB 5F8RC 2AV7A 1RZJC 3K46A 3VE0A 2BVQB 1IC5H 1PAMA 3F65A 2BSSA 3W5NA 3HMXA 2W9LA 3SDCC 4UINL 1KBGH 1AQKL 3MLTB 4OGZA 1NGWA 4H25A 2NY6C 2JB6A 2RFXA 3NPSC 3K1KC 5IKCA 4F2MB 1G7QB 1IGMH 2QBWA 4O2FB 5IMKA 4LGSB 3SO3C 1W2KT 4KKBC 3RWDA 4ELME 4WI2A 1UWXK 1JTTA 4IOIA 5TDPA 5HHVL 4LLMB 2E9JA 1IZJA 1VACB 4GOSA 3MBXL 4XNXL 4Q74A 3FRUB 2XTJC 2NY2D 5KSBE 1LK3L 2Q7NA 4AM0B 1LE9B 3MZTA 3MGAA 4LSUH 3BISA 5EA0H 5JLZA 3H0TA 1NBQA 3DV4B 4X5WA 3PGDA 3TZVA 3PP4H 4QTIH 3MV9D 4LEXH 3VI4E 5JDJA 4DFIA 1QPPA 2VZUA 3KHQA 2JJTA 2XI9A 4PJDE 5GHWH 1A47A 2H32B 5DJ6A 3QJHB 1MI5A 3X12A 2QL1A 3IJSA 4QKXB 4HMCA 4GRWF 4R9HA 2VXUL 5CJ5A 4YC2C 1RI8A 3VGBA 3DIFB 1NQBA 1CFQA 2C7UA 3DX8B 3ULUF 1D6EB 5CJQL 4Y88A 1INEL 3VH8A 3ABZA 2A6IB 2DJ4A 4FXKA 1I8MA 5E03A 3OTTA 5IJVB 3RVUD 4XBGA 3CZFB 2WNGA 4LQ1A 2VLKB 3ZTJH 4MNQD 5EOTA 4ZQKA 5DRWB 3TNNA 3W11C 4HIIB 1HHJA 3IDGA 4ZOAA 1MWAH 4CMHC 4ZXBB 1TPXC 2Z8SA 1S7XB 5GZOC 3WUWG 2VQUA 2VSCA 1E4XH 4AT6B 3ZT6A 3SGJC 2L4OA 4LSPH 5DD1L 1FQ9C 3PDOA 2R2BA 5E2VL 4ZUTA 3PDGA 4PG2A 3LPFA 4L8SB 4NKDB 3F5WB 3QXUA 1OL0A 4PLJD 3VXRD 2WQRA 2EDXA 5DRNB 5E2JA 4FRWA 1TVHB 4CN4A 1C7TA 1N7MH 4KHXH 4RGNB 4ZFFB 4EQ2A 1LGVA 1QSEA 3FRPA 1PX3A 2DQCL 4P3DB 4EI5A 1A1OB 4N5UA 5ESAA 4RZCB 4RISL 2FBJL 5E9DE 3AAZB 1YC7A 2VXQH 4UBDD 4NKMB 4YDVA 4OGXL 2XKSA 4Y4HC 2YPLA 3LKQB 4DTGL 4KVNH 5D1XB 3OXRA 4GMTL 1U9KA 3ARBA 3KLHD 1RZ8B 3GSNH 2F74A 1XGUB 1FL3B 1OWWA 3OSKA 1PLGL 3S88H 3RJQB 3BP7B 4KKAC 3QXWA 4OZHA 1DBMH 1ITCA 1LD9A 4MB4A 4KFZC 4Z8FH 3TV3L 1DQLH 4L3CA 3Q0HA 2PKDA 3GSWA 2GAZB 3BE1H 3LDBC 3IETA 4ZFOA 4KV5F 3ZT5A 4JN1L 3GHBH 4JFDE 2DL2A 4XP1H 4JAMB 3MUHL 4Z7UB 3W0WB 5I6XC 2HA1A 1W0VA 2IQ9L 3I6KB 4JHAH 5BV7L 1WWAX 1WCBB 3WS3B 4WFEE 4YXKH 1DZBA 5DJ0A 2G75B 3ZE2F 1KLGB 4UDTA 4UT6H 1U8MA 2E27L 5EU6A 3LRSA 3U7WH 5EOQH 1MFBH 2G5BA 4DVRL 2KPNA 4X9GA 5HGBB 5I8OH 2ZCLH 5DFTA 5DSCB 1CDJA 3OKEA 3VXSE 3PQYB 4Q6IC 3G6AA 3NPZB 4R2GB 3QG6A 1UH4A 3MREA 3VFGL 5F6IC 2GITB 1CDGA 4TUJB 4W6WB 2H32H 4QXUL 1KJ2B 5JA8B 3ESVF 2ZSVA 5B38G 4OJFH 2XXMB 5CEZD 2HT4D 3BKCL 4P9HL 3QIBA 2HLAB 4XVUC 3VW3L 5AYUH 2HFTA 1U8QB 3GUTA 4ODTL 2YUVA 4WTZA 1HHKB 1A21A 1BBJB 4JGUA 1DQMH 1VPOH 2EDHA 4ELMA 4YHLL 1FNHA 3IJYA 4DGVL 3CMOL 1I85A 2YC1B 4DCQA 3N1FC 4H1LG 1KCLA 1B0RA 3ULSA 1QSFB 1CF8L 1RZFH 2VR9A 5KSBA 1NGYA 4YO0A 3MRIA 5HPMA 2G9HA 2KQNA 4D8PB 1HZHL 2ENYA 1AIFB 3KG5A 2ZCKH 1N6QH 3GKZA 3BEWA 4BQCA 3BH9A 3NCEB 3BRDA 5HHXL 4H20L 4OZIB 3QEUB 1MVUA 5KN5A 2R2CA 5I1LB 5MEQA 4JZJC 3TBTB 4Y8DC 1TJGH 3H2WA 3UMTA 4R8WH 3U7YL 4PJDA 1KJMB 4TN9A 1HEZA 2JCCF 2DQGH 4H1LB 3N50A 2R69H 1CXFA 2IADB 3NAAH 4Y5XA 2YKLL 5IF0B 1EGJL 4I2XB 1MOEA 2VDMH 3C6SA 3JWDL 2VR4A 3S34L 2X4UB 1NLBH 3I3DA 4X4YB 1QBLL 2QSCH 1NC4B 1J1PL 4IRZL 2JB5H 5JW4N 3GHEL 5CGYC 1YN7A 4ETYA 1KYOJ 3A6CH 1YEEH 1MCDA 4GMSL 1M7XA 1SBBA 2W0PA 1YUHB 1CXLA 1A9EB 5JHDD 4U6TA 3PG2A 2AKRA 1PKQB 2BC4B 2I25N 1U8LA 5CJ8A 3D69A 1OAQL 2OLDA 1PBYA 1T1ZA 3KXFA 3MMEA 3NN8B 4KUCF 4PJFB 2CQVA 1JN6B 1HHIA 3TYFB 3MV7B 1U3HD 4LLUB 5DO2D 3P4MA 2WANA 3PWNB 1YECH 1I1FA 3FCTB 2FR4B 1UB5A 3MA9L 1DN0A 3MSPA 1KELH 1QEWB 4HKBA 4UTBH 4GRMA 4GKZA 4XHJC 2GCYB 3ARFA 1DQTA 3SDCD 4M4RA 4CBPA 4HT1H 1L6XA 5M94B 1D5BA 3IJHB 4HPYL 2VDRL 3Q6FA 4PP2B 1P1ZA 3VWJC 3FMGH 4R3SB 2VLRB 1CFSB 3JV4B 3FT2A 5GRUH 4DQOH 2I5YH 2W9DH 1R5VB 2V5SA 4LHJB 2NY3C 3MRHA 4GSDL 2B8OT 3V0WL 3RGVA 3UYOD 4CW1A 3BP5A 3W9EA 4TNVK 3SCMB 2VERN 4JCMA 3VXOB 1XF4B 3HA0A 1JHTA 2YK1H 2DB8A 3CX5K 3S96B 3O2WL 1NUGA 1RIVL 3MJ8B 3FFCB 1VFAB 4Z0BH 2P7TB 1CD9B 4N8CH 1RUKH 1F4AA 1B2WL 3V5HB 2QTEA 2ZSWA 2GYSA 1KJ2H 2NZIA 1DUYA 1R24B 5FM4A 5IQ9A 5FHAL 1K5NB 4JZOA 4H0IA 4KTDL 2IBBA 2YN5A 4BUGA 4MJ6B 1P4LB 1NCAL 2PO6C 1XR8B 4JFDA 3DV6B 1ONQA 4PJ8B 5JMRA 1BQSA 3QPXH 4ZFGH 3QIWB 1ITBB 2W65B 4WV1C 1BOGB 5ICZB 4W81A 1K6QH 4O58L 2CMRL 4ODSL 3DPBA 1T03H 4U1IA 4GJTB 5ELIA 2A6JB 4O9HL 1XGQA 5EWIL 5GGTL 1BIHA 3OB8A 1EZVY 3IRZA 3RA7H 2X4SB 1MRFL 2X70B 5ITFB 4AZ8A 3VXSA 3VA2C 2AV7B 2H26A 4WI8A 5GZOD 3VE0B 4MX7A 3RWIA 3I75A 3EYSL 3TNMA 4HLZG 3TFKC 3TO4D 2FRGP 1NGWB 4H25B 4H1LH 2EDYA 2JB6B 2RFXB 4MQXC 1FIGL 3MXWL 3EO9H 2J88H 1IQWL 5IKCB 1AP2A 5IMKB 2FLRT 5GGQH 3RWDB 1FJ1A 43C9A 1F02I 4ZD3L 2EDJA 3BI9X 1KIQB 5HVGB 2OJZH 1A22B 2CIIA 5FOBA 1HINL 3MRKA 4QEGA 4PB9L 1MCNA 4RCAA 1CLOL 5JLZB 1A64A 2XOTA 4V2BA 3H0TB 3VH8G 3CD4A 4X5WB 3PGDB 4W4OC 3TZVB 3AVEA 1IAOA 4LCWE 4M7ZC 1C16A 2GJ6E 1G7JA 4UU9A 1RJZA 1IILE 1NC2D 2C3VA 3GIZH 1GYAA 5DJ6B 1MI5B 3ORJA 3X12B 1EEUA 4CU7A 5GRJL 3FKUS 5JR1L 3MV9E 1CFQB 2C7UB 5EU7C 3QDGE 4KDWA 1TTFA 3VH8B 4J3VA 4E41D 3OZ9L 4QRTA 5IMLA 4ZNEE 2DKMA 4HC1A 2G2RA 4FXKB 1KJ3L 1I8MB 1CBVL 3P4NA 1IGCH 4JG0L 4XBGB 5EORH 2W91A 4X4XA 3TBSA 2APWA 3P73A 3FRPG 5EOTB 5F3BA 4ZQKB 1IGYA 3TNNB 1HHJB 3IDGB 1UJ3A 1U8HA 5FKPA 2R0WH 3DLQR 4PB0L 4M8QA 2W92A 1YA5A 5E6YA 4XNZC 5HYSA 3PDOB 2R2BB 3VG9B 3LRHA 4NN5B 2E8ZA 3NTCL 4YE4L 4HQQH 1K3IA 5T1LD 4XPTH 5HHNA 4U1NA 2R0ZH 2D03L 4Z78B 4D3CH 4CJ0A 4LU5L 1N64L 3HC4L 4JRYE 1QSEB 1BFOA 4EI5B 4HZAA 2YZ8A 3BPNB 5ESAB 1ZEAL 4GQ9L 4A6YA 4XNYH 5GS0H 5T1KB 3IDJA 2AGJL 4NOBA 5DJ2A 4DKDC 4YDVB 1I3VA 4U1KA 4X9FA 3NCJH 2YPLB 5F9WB 2XFXA 4HUWA 5K9QI 3OXRB 4C54A 3BSZH 1Q9WA 3P0VL 1CFVL 1NEUA 3OBAA 4I3GA 3SQOH 1VFBA 4HGMA 5CD5C 1FGVH 2Z92A 1I3RA 3L3IA 3SDAD 4PJEE 4XNUL 4P3CL 3HI6L 4XWOD 4Y4FA 3T3PE 2NY1D 2DTSA 4OZHB 1LD9B 5I1KH 3VXMD 4ENED 4XP4H 1QFWM 3HMXH 4LVOB 4L3CB 5D7IA 1S78C 3VGEA 3VFRA 3TESA 4GUPA 2YBRA 2ZUVA 5L6YH 3GSWB 3KPRE 3IETB 4G6KL 1E4XI 4ZFOB 1JZ5A 3J8F7 4EBQH 2FSEA 4F58H 5IFHL 1W0VB 2C3WA 3SGEI 1JI2A 4LFHD 1I3UA 3O0RL 3P4LA 4Q58C 5F9AC 5IV2A 2Y1VA 3ULUL 3RWEA 3MLRH 5DJ0B 4UDTB 1U8MB 3ZKNC 5EU6B 3LRSB 4OZ4A 2G5RA 1QSVA 4JGMA 2G5BB 1C1EH 1MCWW 1R3IH 5CGYD 3BGFB 3N85L 4X6BA 2VLMD 3V7AE 3G6AB 3QG6B 2CRIA 2DBLL 3MREB 1SYVA 2K3TA 3D1MC 5C8JA 1BGXH 5EBLA 4OI8A 5GGUA 1IARB 2VLJD 5F6HI 1P7QD 4OF6A 1F4WH 3QIBB 4M1DH 5I15L 3B83A 4UILH 1YNTA 4PGCA 1Y6KR 3C6LA 4XMLH 4ELMB 5J9PA 4PTUA 3IJYB 2FGWH 4DCQB 4Q97A 4K23H 3LS4H 1B0RB 5CEZE 1YYMH 3KS0H 3ULSB 4UT9H 5KSBB 5I1HL 4OQTL 4P5MA 3MRIB 5C0FB 4CMMA 2G9HB 5HPMB 2PYEE 2NY3D 2ZCHL 3I85A 3BEWB 4K9EH 1WICA 2NY4C 1MVUB 5KN5B 1AGDB 4Q9RH 4MXVE 4LCWA 5KZCD 4Z7VF 5I19H 2GJ6A 4PBWD 1P9MA 1PKOA 4YDLB 1OAYH 4PJDB 2I60L 4JFHE 1GGYA 3QA3A 1HEZB 4M6OL 4ZOBA 3IVKA 1WAAF 3FB8A 1F8TH 4Y5XB 1TETH 1MFEL 4M5YH 1FHGA 5B21A 4OD2A 3C6SB 4OB5L 1I1RA 5CJBA 1V3JA 3MOQA 4RQQA 4Y16A 3QDGA 4OCRL 3V5KA 4J4PC 1MLBA 2PO6D 3RZCA 1YN7B 4ZNEA 1AXTH 3U83A 2P1YA 3ARXA 4JHZA 3BPOC 4KK8C 1VESA 2VH5H 2UY7A 3JXAA 2LAGB 4KDTA 2IBZY 5C9JA 1QRND 2AKRB 1S9XA 2YN3A 3CVIL 1U8LB 1NBVL 3MMEB 1T1ZB 3MOAL 4ZDHA 5FV1L 2FJHA 1ZMYA 1HHIB 3DI2B 1OW0A 2GUOA 5CUSL 3P4MB 4HBCH 5JHDE 1OF2A 4NM8H 1I1FB 4JKWA 1UB5B 4X6CF 5C7XH 1DN0B 5T3XL 4HKBB 1XGPA 4GRMB 3BN9C 4GKZB 4TSAL 1A9BA 1E4KC 4QRPD 4J3XA 3U1SH 1D5BB 3Q6FB 1P1ZB 4JRYA 4LF3A 4MQXD 1I9JH 4M1CD 2F19L 3FT2B 3QRGH 1NL0H 5E9DB 2VAJA 3MRHB 4M1GL 1CN4A 2H2SD 3RGVB 1VFUA 3BP5B 4HFUL 3W9EB 1QFWL 2DI7A 4LSTH 3G08A 4Z95H 1PGRB 4G7YH 1JHTB 2V9TA 4TSBL 3MJ9H 3V6ZA 2A77L 2X89D 4PJEA 1LO3H 1CE1H 1DFBL 1U8OA 2ZSWB 3TCXA 1T7VA 1DUYB 4LDLB 2XTJE 3D0VA 5IQ9B 2AABH 5J12B 3IU4H 3TH4T 3F6IA 4JZOB 2AXFA 5BXFA 1C08A 2CJUL 3KPRA 1RHHA 4RMUA 3U4AA 2VXTH 1JPST 3NIDE 4XNQB 4XP6L 1U91A 4JFDB 4HIJA 1ONQB 5KOMC 4ZO9A 4BFGA 3O3BA 4PJ9A 3TP4A 1BBDL 1QYGL 1TNNA 4NN7B 4PRNA 4FQCH 2FCBA 1LP9E 1H3TA 1UKTA 3FQWA 4U1IB 3AREC 4Z5RA 1XGQB 1V7NL 2P47B 5TE7H 4BSWB 5JPNA 5I1JL 2VL5A 3VXSB 3SO5A 1I8LC 3V52H 4LVHC 2H26B 1OCWH 4G8GA 1FVEA 1Q94A 4JO1L 4MX7B 4ZODA 2WINA 3RWIB 3I75B 4NZUH 3TNMB 2XRAL 4GBXC 3QCVH 1AH1A 3JWOC 3KNBA 4JY4A 5C0AA 1AP2B 1FORH 3WIHL 1JPTH 3ZHLA 4K3EL 4RAVA 1FJ1B 43C9B 4XMPH 4IS6A 1F58H 5BQ7A 4DUXA 1HQRA 4NP4H 2FB4H 4LPXA 4BQBA 5FOBB 3MRKB 3I9GH 4WUUA 4G5ZL 5MP6H 4FMFA 4OD1L 3BPLC 2OZ4A 3EYOA 5FK9A 4XAWH 1HXMA 2PYEA 5T5NG 1A6UL 4OLWH 4N1HB 1IAOB 1C16B 1G7JB 4UU9B 3C5ZD 2DM4A 1RJZB 4FZEL 5F72S 3P0YL 2C3VB 5CD5D 4LCUA 3TYGL 1LE5A 1TTGA 5DJXA 1CI5A 5JPMA 5GJTH 2BCKA 5I1DA 5IHUH 1CDIA 4FTVD 5HYSG 1H9VA 2PW1B 5EU4A 4DGYH 5J0BA 4ESKA 4OGYH 5IBTH 4QRTB 4U0RB 5IMLB 2G2RB 1T89A 4MB3A 3P4NB 1S8DA 2VR5A 3EFDL 4YFLI 5HVHB 1EJOL 3TBSB 1C7SA 4NCC1 3P73B 3SKNA 1ZVSA 5F3BB 1WEJH 3ARVA 1UJ3B 1U8HB 5FKPB 4E41E 3GKWL 2E7LC 2MOVA 1JF1A 3TT3L 5E95B 5FO8A 5HYSB 1SVZA 2Y06H 4TTGA 1AC0A 3NCYS 1NCDH 3FHAA 3I2CH 1NFKA 1EUUA 5DUMH 3P11L 1FFNA 1A7PH 5HHNB 3RWGA 4U1NB 5JHDA 2KZWA 4NT6A 2E9IA 2EH7L 1AE6H 4QHLA 3QWOA 3SGDH 5ISZD 1BFOB 1V7MH 4A6YB 1CXIA 4L4TA 3A6BH 2X4TA 3QP3A 1EH9A 2BJMH 3ZE0E 3IDJB 1R3KA 5DJ2B 1U3HA 3RWHA 3SDYH 1SEBA 3WE6B 4U1KB 5EIVA 1BM3H 3KDMA 4HUWB 2B4CC 2HTKC 1Q9WB 4NUJA 3SDCA 4L8BA 3OAUH 3NOIA 1VFBB 2Z92B 1I3RB 3HE7D 3L3IB 4X0KA 1RD6A 3PGFL 4P2QD 1M05A 7CGTA 1ETZA 1G7LB 3C2AH 1F6AA 3DXAD 4KY1H 3U0PA 5CEYA 1EMTH 4PGBA 5M7QA 2SEBB 5D7IB 3VFRB 4GUPB 4UQ2A 3P9MA 2CK0L 4XP9H 1JPSH 1FSKB 3L1OH 3WEXA 3QCTH 4KRPB 2DIBA 5KW9H 2FSEB 2VJXA 4JM2F 1MRDL 5KSAC 3JSSA 3OX8A 3VXME 3PF2A 5HJ3A 5IV2B 1A7NL 3RWEB 1CLYL 4KQ3L 3TVMC 4ZS6C 4X4ME 3IDXL 5T1DH 2HMIC 1OAZL 2DMKA 1QA9A 1LP9A 2ERJB 4X8XA 4X6BB 1KF9B 3O8XD 4KK8D 4YDIL 4XPGL 1XF1A 1ED3A 4MMZC 2O93L 1SYVB 3ZYOA 2Y07H 5C8JB 5FYJE 3D3VE 5EBLB 5GGUB 3UXFA 3K74B 3CXHJ 5JTWA 4G59A 3KPLA 1Z9OA 4KJYA 4JE4B 2VLME 4XVSL 1YNTB 4PGCB 1Q9OA 3N1PC 5F9DC 3BMWA 3VFUA 3C6LB 4AEIL 3CK0H 5IW1A 4K7PX 5J9PB 2VLJE 3QDAA 5I17A 3SGJA 4FFZH 2P42B 3F62A 1GC1L 1H3WM 4YNYA 4P5MB 5I74B 1Q0XL 3MRMA 4CMMB 3L5HA 5CJOH 2VDLL 4PLKD 1JZ3A 5LCVL 1CR9H 1XH3B 3QWRD 1N4XL 3LB6D 2YRLA 1JF6A 4LCWB 2GJ6B 4WHTA 2NY2B 3QA3B 2B1HH 4YWGL 1ZT7A 3IVKB 3FB8B 5E1AA 1LEIA 4OM1H 5DWUH 4GG6E 3RX5A 3S37X 4OD2B 4Y4HA 2P8PA 3MV9B 5BRZE 5I0DA 1FE8L 1FGNL 2LVCA 4RQQB 3SEPA 3MLZH 3QDGB 4A6YH 1NC2A 5FO9A 3RZCB 1MLBB 4JDTH 4HXBH 4MA1C 1N5YL 3MV8D 3TJEL 5D1QC 5EIIA 4RGMB 1NCWL 4X6EA 4YXHL 1LDSA 2A9MH 1BFVL 1BQLH 4NKQB 5C9JB 1HN1A 4OZGF 4MA7H 3SKOA 4YUEL 1KENH 4K07A 5MEPA 1S9XB 4P2OD 4JO3L 4E41A 4ZDHB 1YMHA 2FJHB 4IHOA 4JKMA 2AJ3B 2VWEC 4M9PA 1XFPA 2GUOB 5EBGA 1H8SA 2NXYB 3MLSH 2GEEA 3I50H 1OF2B 1NGXB 3IDYB 4POZD 1N26A 4WI6A 2BERA 5EZJA 2HT3D 1XGPB 1T2QH 1A9BB 3W2DH 1QBAA 4RMSA 3BWUC 4JQIH 2DQHL 3O4OC 1BLNB 4XGZA 5HDLA 5JIPA 4JRYB 4LF3B 1WVZA 1X7QA 4FQXD 4Q6IA 4HC1L 1JHLL 5T1LA 4HJJH 3ROOA 1NFDF 2ID5A 4JRXA 1T5XA 2DI8A 2EXWC 1UA6H 2BP3A 4NPYA 4QRPE 4OGAD 3G08B 2IAND 2M1KA 4GKNB 1JGUH 4LSRH 4F7MA 3LV3A 1T1YA 2XA8H 1NAML 3V6ZB 4CDHA 5MEOA 1DEEA 5DYOA 1KB5L 1XF3A 4XBEH 4PJEB 1FAKT 4YBQC 1OTTC 2JK5A 5E56A 4XX1E 3O6ML 3O6LH 3DOSA 3WFBL 2R0KL 5DEGA 3D0VB 1G0XA 5TGBA 3PIQA 2Y23A 2AXFB 5BXFB 1C08B 5F93C 1G0YR 3KPRB 1RHHB 2XT1B 1U91B 4HIJB 1A3LL 5FYLE 2YOCA 2FD6L 1A7BA 2CDFA 3VXMA 5JQ6L 3O3BB 5IVXE 3MACL 4KPHL 4OM0H 4PRNB 4E42A 3H3PL 4I3SL 4JZJA 1RVFH 3FQWB 4MD4B 4N1EA 2GSGA 2D2OA 4X7EC 4X4MA 2BNRD 2NQCA 4Z5RB 4M6ML 5JPNB 3WFCH 2NMSA 1MNUL 3QT2A 4YPJA 1U8PA 2CK2A 2VL5B 5DLMH 7FABH 2FO1A 4H8WL 5EU7E 4AK1A 1FNLA 3WO4C 4MWFA 4UIKH 5F70A 3NABL 4G8GB 1FVEB 1Q94B 2WINB 1PEWA 2EDRA 2LAAA 3D3VA 1HQ4A 3HZMB 5D71L 2DD8H 2GTZA 2YRPA 3KNBB 4JY4B 4OF5A 1RUAH 3STLA 3GBML 3UO1L 2D7NA 5D2LF 3SKJH 1MJUL 4RAVB 3HNTL 2X1XR 1NAKH 3CXDH 4NM4L 3EKCA 2X1WL 5DS8A 1IC5L 5BQ7B 4X5XA 3LIZL 2BVOA 3LS5H 4JQVA 1HQRB 3WHXB 2VLJA 5CGTA 1LO2H 4LIQE 4WUUB 4Z7OF 5C0RL 4ONHA 3G04A 2EDKA 2ESVA 3U6RB 3EOTH 1MPAH 3EYOB 2DS4A 4L3ED 5FK9B 3KJ6L 1HXMB 3JBG7 2PYEB 4R97B 5TDNA 2O5XL 2HTKD 4I9WD 3ULVD 3MGOA 1E6OL 4IDJL 4DK6A 4LCUB 4J6RL 3VWJA 1LE5B 5IHBA 3TWCL 5DJXB 4Y8AA 5JPMB 3BT2H 1MCIA 2BCKB 3LQAL 4KJWD 5I1DB 5E8NA 1P4IL 4D0DB 2C3XA 2VDQL 3D39E 3CU7A 4KDVA 4YHOH 3WDJA 4YLQT 4JB9L 2DWDA 4GG6A 5A3IC 3RU8H 4WUKL 5EU4B 5BRZA 3T0DA 5I1GH 2V17H 3ZE1E 2KZ1B 3G9AB 3X3FH 4X80L 3MLYL 5KVGL 1S8DB 3UTSD 1QTYT 3QG7L 1NDMB 2HKFH 2DYPD 4FTVE 1RY7B 1ZVSB 1MCEA 3EJYC 3SKNB 1G9ML 4XNMA 2Y9RT 2X6MA 5DTFA 1R0AL 5L0QB 3U4BL 1MFDH 2HMID 3BYTA 1JF1B 3SBWC 5FO8B 1F00I 2BRRL 3IDUA 2NYYC 4PJBE 5E94A 5LQBH 2PO6A 1XMWA 3V6OC 1J86A 15C8L 4IIQC 3NZ8A 2DMBA 3A0OA 2Q87A 3FOLB 1FFNB 3BW9A 3RWGB 5JHDB 4NT6B 4WV1A 1E4WL 4QHLB 3QWOB 1E4XL 4IDLA 4L4VD 3MRJA 3PDDA 4D2NA 4LCIH 1QFHA 2UZYB 4AY0A 4TUKL 2FATH 4CDGC 4KKLC 1U3HB 4JO4L 3RWHB 3CVHL 1RZGA 1SEBB 1AGEA 4HZLA 2HH0L 1J9CT 2XQBH 1DQDH 3ALPA 4G3YL 3OKLA 4M7KL 3KDMB 4MQTB 3SPVA 1KXTB 3UX9B 1MREL 2RBLA 5MERA 4NUJB 3SDCB 3TFKA 3BWAA 4L8BB 4QRPA 1FVCA 2NZ9C 4BZYA 2NCMA 2B2XL 2M26A 4X0KB 3NPSB 3SO3B 1M05B 2EDBA 1ETZB 4GLRH 1F6AB 4JY5L 3U0PB 5DMIH 4LSVL 1BF8A 5CEYB 4F7CA 1YY8A 4PGBB 5DUPH 5MI0B 3P9MB 1MIEL 3FOMA 4KGLA 1YC8A 2AJYH 2XTJB 3WEXB 3CDFA 3WFZA 1U6AL 1CS6A 3OX8B 1K4DA 3IFLH 4PRID 3DXAE 2CR6A 1TZHA 3FO2A 5HJ3B 1EBPA 3FN0L 4PJ7A 4W4OA 1LDPH 1NUNB 1U92A 1YQVL 4XPFH 3N0PB 5IVXA 2QADD 3RZWA 5CEZH 4PV8A 1QA9B 1LP9B 2OZ4H 4R0LC 5FIEA 1DLFL 5F7EL 1DVFC 2OMBA 1IGIH 4YC2B 4ONFL 4XMKL 3QUXA 3B4NA 1NKRA 4ELKA 3TJHD 5JZ7D 1KXVC 1TIUA 1JMZA 3DHMA 3MA7B 3KPLB 3VFMA 4KJYB 5I8OL 4K8RH 2B5IC 3U9PH 3LZFL 4F9PC 1Q9OB 4KTEH 3VFUB 3Q1SH 4K94H 5IW1B 1C5CL 4JG1L 4CMHB 3CJJA 1ZA6A 1MAJA 4QHMA 2D9QB 4PY8J 1HH6A 1TPXB 1A5FL 4R96A 5I17B 5BV7C 5LWYH 5CZVH 4YX2L 3C8DA 3IRPX 5BMFH 4KMTH 1RUPL 1YPZF 4AIZA 4YNYB 4J23A 3MRMB 5B4MD 5C0JA 4FFEX 1SMAA 1CVSC 5C08D 1YNLL 4FFYL 4PJCF 1FLRL 1SMOA 4MB5A 5E2UH 4H26A 1J0JA 5D7JC 2EXWD 4QRUA 3H3KA 3C9NA 4WHTB 2RR3A 3HZKA 3PWLA 4X7TA 3VRIA 3IDMA 4O5LH 2J2ZA 5E1AB 4DZBA 1LEIB 1CE6B 2X1QA 2YD2A 4P9HC 3BP6B 4Y4HB 1FRGH 5JOPD 2C3GA 2ZUTA 3D39A 4MA8L 1B88A 6FABL 2V7HA 4H88H 1C5BH 3Q3GA 1NC2B 1ZLSH 1MFNA 1M71A 3O4LD 3GRWL 1JHKH 5EIIB 4X6EB 3UZEA 1PEZA 1RZJH 2IG2L 5C1MB 1EFQA 5C2BH 2BRQA 2WY3A 4LQFL 1EHAA 3SKOB 3GMLA 5MEPB 1NLBL 3FHQA 4E41B 1FZKA 3MV8E 1YMHB 4IHOB 5I6XB 2Y6SC 3E8UH 3V4PH 4PJBA 5BCAA 2EKJA 3OGCB 3H9ZA 4LAQL 2DQIH 4FFWD 3W81A 3D9AL 4N90E 5EZJB 1IEBA 3NH7L 4LPUA 4LLDA 4QGYA 5FO7A 4MSWA 4AMKL 2XNAA 3JWDC 5J6GA 1A4JA 4PJ7F 2WWMC 1AR1C 1X7QB 3TA3C 2PR4L 3BYYA 3RY4A 4LNRA 4Q6IB 3KYOA 1K8IA 3BHBA 1T20A 1INDL 5JDSB 5T1LB 3ROOB 5F6IB 4NKIL 2YUWA 1T5XB 5FHBH 4NPYB 4DKEL 4YAQB 4F7MB 3CNKA 3CZJA 3LV3B 5TE6H 1T1YB 5HD8C 4S1SL 1SBSL 1DEEB 4G6FD 2YWYA 1FNSL 5DYOB 1XF3B 1AD9A 3IS1X 2HN7A 2VZ1A 5DEGB 3GMNA 1NMCC 1J1OL 2IANE 2R29H 4JPWL 5TGBB 3PIQB 1U3YA 3OG4B 3GSRA 4F9LC 4P4KC 4BUHA 3TO2A 2CDFB 3DXAA 3SE4C 25C8H 3VXMB 2XKUA 2FO4A 5A3ID 3AM8C 5FUZL 2AP2A 4E42B 4MJID 4JZJB 2CD0A 2GSGB 1X5HA 3VMNA 4M7JL 2IGFL 3R8BB 4KHTH 5E99H 5GRZA 4OLZL 4NQTA 3UJIL 2XQYG 1CDUA 1CL7H 1TZGH 2NY7H 3DSFL 3UTTD 5E8OA 5IUSA 4L29A 5SWSE 4MWFB 2UV3A 4S1RL 4Y5YC 2H9GA 3PV6A 1IKNC 4M5ZL 3D3VB 2FEEI 2MCPL 4N5ED 1E4JA 2BNRE 2GTZB 2NYYD 3DVIA 3UJTL 2OK0H 5T3ZE 4GAJH 4J4PA 5H2BA 3STLB 5D7LA 4U1JA 1FV1A 1J12A 5DS8B 4P46A 1VGEH 2E7LE 4X5XB 1I3GH 2BVOB 1D3CA 3OAZK 1GGIH 2VLJB 3LKSA 3D25A 3BD3A 3HCVA 4P2RD 1Y6MR 2I9LA 2BFVL 4ONHB 3G04B 3TBYA 2ESVB 3AXLA 2AK1L 5H94A 1UCBL 3IAGC 1X9QA 2EICA 5TDNB 4N0CD 4U33A 5GJSL 3SE3C 2Q3ZA 1MCLA 4UNVA 2OBGA 3P9WB 1E4KA 2DQJH 3MGOB 2NZ9D 3CCHB 3ELAT 1LNUB 5IOPA 4XCFL 3VWJB 4OD3H 4WEBH 3SOBH 4L3EE 4NSKA 3NIGE 2P8MA 5CKAA 3NGBC 4GW1B 5E8NB 1AKJD 1ZA3A 2NY3B 5HHOA 4MVBD 4RRPA 2DWDB 4I9WE 4GG6B 5DQ9B 3H9SE 3QPQC 3MUJA 3QWRA 4NRYA 2Z35A 4U4BA 5FYKU 5C0GA 5BRZB 2A1WL 4OFVA 2CUIA 2VC2H 5DT1H 1QD0A 1YEIL 4YHPA 2ZG3A 1MJ8L 3BJLA 3E2HC 3FQTA 3V8CA 3HNVH 3FTGA 4C4KO 1KJVA 3HB3D 5DTFB 5J1AA 1RJLA 2D7TL 2P5EA 3VFTA 3UTSE 4TTDC 5E94B 2PO6B 3MV8A 1DVFD 3NZ8B 2R1WA 3HMWL 1KCSL 1S7TA 4NJAL 3BW9B 1A8JH 4Z7WE 1YYLH 4NGHH 4WV1B 3QYCA 3SE8H 1YNKH 2ED7A 3MRJB 2EEAA 4MCZA 4HV8A 5CBAA 3AREA 4F8TA 1NPUA 3LCYA 1CGTA 1RZGB 4XPTL 1AGEB 4HZLB 3UROR 1I8LA 5AD0A 3LEVL 3QIUD 1J11A 1I7TA 4U05A 3SPVB 3OKLB 4XC1H 2ZPKH 5MERB 1V8HA 1PX4A 3BWAB 1CK0L 4QRPB 1FVCB 1H5BC 5FECA 4GBXA 2BOCA 3G6JF 5EC2A 1RIHH 1VFMA 5K59E 5HI5C 4HIEA 4IJ3C 5GRYA 1I75A 3MLXH 2BVUA 4F7CB 5D7JD 1XZ0A 1G6VK 3BIAX 4PJGE 4IRJD 5GSRA 3RVTC 3FOMB 4P0DA 4FHBD 2IANA 2D31A 3FO0H 2DLIA 2YMXL 4ZUVA 1GJIA 2E3VA 3NFSH 2BNUA 1TZHB 1A6WH 1MHHA 4EEEA 5DD6B 1U92B 1DBJH 4M7ZB 5EO9A 2HTLC 1QBMH 3WNNA 5IVXB 3FB6A 4PV8B 2Z8RA 4CUCA 5LBSL 3VXPA 1PSKH 5LGHH 3HI5L 1IC4L 2XZAL 2YD8A 1DBKL 2FDBP 1PG7L 2FX8L 3OG6B 3PGCB 1W72A 4M43H 2F5BH 4ELKB 5SWSA 1T7XA 5TFSL 5BS0D 2YD3A 5ILTH 4BZ2L 3VFMB 4I3RH 1UZ8A 2I07A 2BNRA 1OAKL 4EDXA 4TPRH 5C71A 3U9UA 1HNGA 3AS1A 2EE9A 4GLRI 5TF0A 4NZTL 3T65A 3R8QA 5CS7A 1ZA6B 4JFQA 4QHMB 1UACH 4R96B 1HH6B 1MCOL 5GGVH 1G7MA 3KYKH 1BVKB 2L7UA 2E7LA 1X5AA 1SY6A 3O2DL 5CCKH 4XNZB 3ULUC 4M1DL 3AMLA 2VWEE 4L5FH 4AIZB 4YDKL 5J6HA 3CX2A 4XWGH 5IB3A 3OKOA 4MQ7A 4FA8A 3P30H 5DD0L 2AJXH 4H26B 3DTXA 5EB9A 4QRUB 3S3PA 4K23L 2BY0A 1YYML 3L5XH 3C9NB 3HZKB 3DRTA 2R8SH 4X7TB 4JKLA 1KEMH 3VRIB 5JORA 1BJ1J 3LQMA 3IDMB 3MC0A 4TVSa 1JVKA 4M6NL 2W59A 4DZBB 2DJSA 2Q8BH 1JNLH 5D6CA 1B4JL 1DQQA 1WQVT 4FG6C 4P57A 4OFYD 3RIFK 2WBJC 1BQUA 3D39B 1NSNL 2V2XA 1EAPA 4RFNC 2V7HB 4UQ3A 3H9SA 5TF1L 3Q3GB 3B3IA 1I1YA 1YY9D 4G8IA 4XI5D 5ECJE 1M71B 2CKNA 1KFAL 3D87B 1JV5A 3V8OA 4PJXF 5F9JA 4M3KB 1UG9A 3GMLB 4F57L 1URLA 5FGSA 3VXUD 4B0MM 2Z8WC 4O4YH 5GZND 5I73C 1FZKB 2VAAA 2FJGA 2Q7YA 3S36L 3GSQA 3IT8D 4RBPK 5KSAA 1P6FA 2J6EA 1MCSA 3QI9C 4IOFC 1WBZA 4JO2L 3VFVB 3UTSA 4PJBB 1BP3B 3DYMA 1YZZA 2F9BT 1XCQA 3EYQC 1IEBB 1F4XL 3TVMA 4Z7WA 4NUGL 4LLDB 1RPQA 3F8UB 5FO7B 4MSWB 2XNAB 4YQXH 1RZ7L 2HFGH 4HKZA 5DFVC 5J6GB 1A4JB 3WKML 4YHYC 4Z7QE 4LNRB 3RAJL 5FYLH 3KYOB 2VUOA 1K8IB 3IDNA 2QHLA 3BHBB 4U1GC 1G6RA 2EH8H 5JXEA 1T20B 4RGND 3C8HA 5GISH 3ZLQC 5IFAH 4BZ1L 3JTCA 3LMJH 4N0UA 2ICCA 4U2ZA 1GOGA 2R4SL 4LL9A 4PJHE 5I1EH 3QRGL 1EBAA 5E2TL 2DAVA 1JGDA 4QTHA 3MLUH 1MVFA 1AD9B 3QJFA 2HN7B 4PJAE 2YRZA 1IGTA 3GMNB 3ZL4H 4LSDA 1UWGL 5KOVC 4PJGA 3ZTNL 3WFDL 3WHE0 3GSRB 1DUZB 1CICC 2MKWA 2NX5E 3A6OA 3RL2A 3WMSA 1FDLL 4HWBL 3VFPB 4UV7H 5DGQA 3UJJL 3TO2B 2YPKA 5CP3H 3DXAB 4PYHA 3T77A 5CD3A 3LPWA 1XR9A 2FO4B 1YEJL 2X5PA 2NY4B 4TSCH 4XAKE 2AAVA 1GPOH 4CVZA 4NBZB 2OI9C 4HS8H 3W0WD 4LIQH 4UTAL 4RGOL 1KGCD 5I1AA 1UEMA 4I0PC 3EYFA 5F89B 4NO0A 3MBEC 1WFUA 5E8OB 4L29B 1CFNA 2OTUA 4MJIE 5EOCJ 3GJFB 2H9GB 3PV6B 1IAMA 1OD7A 2L0DA 3NIFE 2G60L 3PQYD 3RNKA 2YSSA 4TTDD 5H2BB 1NFIA 3MYJA 5D1QA 3BPOB 4U1JB 1FV1B 2Z91A 4HH8A 3PWPD 2VXVH 5FEBA 3B5TA 1A2YA 5DQDL 5E7FA 1XIWC 1IT9L 3QCVL 3LKSB 3QO0A 3HCVB 3V6OE 2I9LB 4RRPG 1A6TA 1F6LL 2AQ3A 3KAAA 4G6JL 2YZ1A 4FQJH 3TBYB 5BO1H 4F7TB 3AXLB 5FXCH 5H94B 4WW1A 1RU9H 3M1BA 2Z4QA 1G1CA 1QSFD 4JPKH 2IFGA 4L4JA 4EDWL 5ACMA 2UY6A 2ITCB 5MP6L 5IOPB 3DI3B 1T1WA 2J5LC 5HI5D 1EEZA 4NSKB 3B9KA 5D8JH 3WIIH 5HHOB 3OXSA 4GH7B 4PJIF 3QDJA 1JGEA 4M6AA 1FPTH 1HKFA 1VEOA 4NRYB 5C0GB 4QY8A 1W8OA 5F3HA 3V0VA 5IMMB 5ITBH 5I2IA 2DM2A 5GJTL 4YHPB 4G6AC 3MLPA 1WZKA 1B9ZA 3FQTB 2Y36H 4YR6A 4BK5A 3UC0L 3FTGB 2EYTA 2WZPD 1ZK9A 2HTLD 5AUMB 1KJVB 2HKHL 1QRKA 4HEME 4DGYL 9CGTA 5J1AB 1AO7D 1OD9A 1RJLB 3DVGA 1I1AA 5EZIL 4M03A 3DUUA 3VFTB 4CGTA 3QUZC 2HLFD 5D2NC 3PJSA 1JRHH 3MV8B 1J5OH 1MIMH 4IEFB 2R1WB 1JGLH 1JYNA 3VD4A 1S7TB 1AGBA 12E8H 1FCGA 3GMMB 5L7XH 1RK0B 3GMQA 1QFOA 4LASH 1ZHLA 2Z0BA 1F4YH 4ZUUA 4EXKA 4HV8B 5CBAB 3AREB 3HAEA 4P4RA 3HC3H 1UCTA 4UNUA 5BZWA 1J1XH 2VXSH 5AD0B 4KUZH 4LVHB 3PXJA 4ZSOE 1I7TB 5D5MF 1DANT 4QXWA 3F7QA 1OHQA 5DZLA 5FECB 4GBXB 2Q8AL 2BOCB 5DRZA 4BSJA 1NUFA 5EC2B 3TBVA 1SM3L 3VWKC 3RUGF 4DFHA 4HIEB 4YIQA 2A38A 2VDPH 1GGCL 3SCMD 3GJFH 1XZ0B 1XGYL 4L8DB 2UUDH 4O02H 4PJAA 3C5SA 1CD1A 2P24A 4RX4A 5A2LH 3GJEA 3FFCD 3OAUL 2IANB 3EDEA 4ZUVB 3BPLB 3HRPA 2BNUB 2NX5A 2CUMA 3ILQC 1P53A 3P4OA 4FG6D 1MHHB 3UDWC 2WBJD 4MD5A 3VFSA 2A6DA 4GAGL 4QRSA 1NCTA 5TPWL 2WAHA 1KIRA 5F71A 4ZTPH 3TC9A 3VXPB 2MPAL 4PJ8D 4S1QL 5FUCC 3QIWD 3MNWA 1ZHBA 4LHQB 4LNVA 2HWZH 1W72B 4ALAH 3SJVE 3C08L 4LLVA 4PLOB 1JZ6A 1EV2E 3OV6A 1RURL 3REWA 3ISWA 5SWSB 2I24N 3R0MA 4X7SH 1UZ8B 2I07B 4N0YH 1IGFH 1MEXH 2DJUA 2BNRB 3QI9D 4GXVL 1DBAH 1PZ5A 3PNWA 4EDXB 4KZEL 3U9UB 4UB0H 3X13A 1CGVA 3EYQD 4EZMA 3T65B 3CSBA 4JFQB 4EQ3A 5BS0E 2YXFA 1G7MB 1OM3H 3F7VA 4JQXC 4R7DA 4LSQL 5DFVD 4HDIA 3ZKXC 4C83A 5IB3B 3V6OA 3OKOB 3QUMB 4MQ7B 2J3SA 4NQUA 4X7DC 4IIQA 1DSFH 3BESR 4NJ9L 1U2HA 1OT2A 1X5YA 3DTXB 3UEZA 4AG4H 4JHBA 4MJ5A 3WD5L 4WW2F 1RQ5A 2QHRH 3DRTB 4I5BB 5EBMA 5JORB 5GRWA 4KRMB 5TQ0L 3ARYA 5EUOE 1A0QH 4POUB 3TZVD 1BD2D 1ZV5A 3NA9H 2B20A 1A6PA 4FQIH 1DQQB 4P57B 4OLVL 4PP1D 4UOW0 1YEFL 2MHAA 2FHBA 2QQKL 1LO5A 2V2XB 1EAPB 1OB1A 4UQ3B 2HP4A 3H9SB 3B3IB 5IBUG 2BDNH 1I1YB 2B1HL 5T3XD 1UM5L 4S1DD 1CICD 4G8IB 1MJ7H 3UYPA 1KTRL 4KZDL 4KAQH 1HKLL 1JV5B 5DWUL 4OT1L 1GC1C 5F9JB 4RFOH 1AGCA 1MQKH 4XCEA 1KIUA 4Y0GA 1P4BH 2FBOJ 3K2UL 3JWOH 5AG8A 1A4KA 2O5YH 4QHUA 4JDTL 2VAAB 2FJGB 4IBLT 2Q7YB 4I0PD 2V2WA 3GSQB 2E6JA 5FYKL 5KSAB 2FX7L 3OGOE 1WBZB 4JPVL 5DVNA 3RVXC 3UTSB 4EXPX 5JW3L 2X41A 5IBUB 3GI9L 3QXDA 3SGKC 1X44A 1XCQB 3HR5A 3TVMB 3VXUE 4Z7WB 4J2XA 1ZLWK 2FX9H 5SX5H 2ZNWA 4HKZB 1DL7L 2EC9T 4R0LA 1F13A 2ZUYA 3I50L 1DVFA 3G5ZA 4PV9A 1G6RB 5IIEA 2KH2B 4OLYL 3NFNA 5ADOL 1QSED 4ODXA 4EI5D 4WIQA 4ZSOA 5IB1B 1A7OL 2HFEA 2JE8A 4N0UB 5CJXC 5HDBF 1KEGL 3BOVA 4JJ5A 4F9PA 2APFA 1FO0H 2F54A 1LEGA 1JGDB 4QTHB 1JZ8A 2X4RA 4HJJL 4I4WB 1NCBH 2BVEA 5C6TH 3VG0L 3ARBD 5M95B 1U2CA 1MCFA 5DJAA 2GT9A 5B8CA 1LO4H 1UT9A 5F97E 4PJGB 1PG7W 4LVEA 4RMRA 5GPRA 4KUCD 1J0YA 3RL2B 3AS3A 1TJHH 4ETQB 2ADFH 5EZOL 3SHSA 3GZKA 2YPKB 5EO1A 3KPTA 3T77B 5CD3B 5D7JA 1XR9B 3MLVH 1UVQA 1MAMH 1SY6H 1CZ8H 4CVZB 1P7KA 1GRWA 1H0DA 4EN3C 3C60C 3QUMH 4YHKL 5I1AB 5E6IC 4BQ9A 5L88H 2A74A 3EYFB 3T2PA 4XVJH 1FL5A 4NO0B 5EU6D 1CFNB 4EUPA 2BXZA 5DMYA 2OTUB 4HS3A 4KJQC 3SJVA 4CN1A 1KGCE 3L5JA 3D5OF 3RNKB 3HUJE 2YSSB 3QUZD 2WUCH 3ARTA 1Z3GL 4MA1B 4U7SA 2A9NH 2DIJA 3MYJB 5D1QB 5E8PA 2J7LA 4YFEA 1FNFA 2AQ1A 4NQCE 2DLHA 2Z91B 1CYGA 1T3FA 3ZMRA 2B4CH 3KVQA 2X9YA 3DETC 1A2YB 4LRNH 1AFVH 3QIBD 3MYZA 3U4EA 5KS9E 1S7VA 5BS0A 1OGAD 4BFBD 3QO0B 1EHLL 2IAMC 1A6TB 4WTWA 4R26H 4ZS7L 1WFTA 3PWPE 1YEHH 2FEDD 1F97A 3M1BB 2Z4QB 2IFFH 2I26N 4Q6YA 3A67H 3I02A 5D7SH 1FG2A 3S35H 1EGJA 2AJVH 1G84A 4H8WC 4MS8C 3O4OB 2J6EH 1RUML 1T1WB 3VWKD 2R2HA 3E6FA 3L3DA 4MDJA 1EEZB 5IQ7H 2MSPA 3TA3A 2DM3A 3QFJD 4ACPA 2XZCL 1MF2H 1Q9KA 5EUOA 5LJYH 1P69B 3D18A 1FAIL 3QUKA 3OXSB 2EO1A 1CGSL 1QSFE 4NFBA 3QCUL 1JGEB 3O2VL 4HF5H 1ADQL 2XA3A 4QY8B 5LVEA 3V0VB 5IP4A 2H1PL 3BQUC 4E5XA 5I2IB 3WJLC 3ARQA 2ARWA 3INUL 2RQ8A 1G6RH 2JJWA 5I9QB 4LARH 4OZIE 1MQ8A 3ILQD 5D96C 1L4IA 1HILA 32C2B 4UT7H 4LPCA 4YR6B 1G7HA 3L7EA 2EYTB 4OFYA 2JELH 3HAEG 3WNMA 2EDQA 3WL9A 5ETUA 1S9WA 2V17L 3DVGB 3WFEH 3WDIA 5HYJD 3TF7C 3DUUB 3DGGA 1Q1JL 3PJSB 1O7SA 1K3ZA 3LN4A 4F9LA 4P4KA 2HKFL 3KR3H 3MXVH 1UYWL 3SE4A 5A40E 1AGBB 4W6XB 3LQAC 3AM8A 3GMQB 1AO7E 3KXFD 4R7NA 1ZHLB 3BKJL 5GS1C 3VXUA 3DVNA 2OP4H 2DQUH 1BAFL 1CLZH 4WI7A 3HAEB 4P4RB 1T6WA 4DVBA 5BZWB 2A0LC 3U30C 4XPBL 2KUTA 1NCCL 1RIUL 2VDOL 1AJ7H 4RNRA 3ARFD 1KOAA 3NZHH 4PJFE 3WO4B 1Z5LA 1BJ1H 3HFML 5A16A 4Y5YA 4HJGB 1IKNA 4YFDB 4HS6A 3MODL 1DCLA 1G9MC 4PS4L 5ACLA 3TBVB 1A02N 4R4FL 4URTB 5FCUL 5ADPL 5AZEH 4GRWE 4YIQB 4JANA 2XQBL 5ENWB 1CFTA 4XCYA 1FBIL 2HVKA 4PJAB 3C5SB 1CD1B 4OCXL 3WUZA 2P24B 3GJEB 3MRDB 2Y25A 3WUWA 1TJIL 4RMQA 5BVPL 4ODHL 5MENE 2X10A 2GKIA 3VFWA 4Z6AT 2R56L 4G6FB 4XH2B 2XWTA 2YEZA 2NX5B 4P5KA 3P4OB 5JXAH 4J3TA 4PY8I 5GGTA 4MD5B 4Y16C 3VFSB 1IAIM 2A6DB 3SE3A 4QRSB 1UWXH 4XRCA 1KIRB 2ED9A 3N9GL 5J56B 1KPVA 4JFDD 2YA0A 4XZUA 2F53A 1EXUA 4U0QB 3BZ4A 1WK0A 5HVWA 1OLZA 4TOYH 1ZHBB 5E08H 1L7TL 4MHHG 5JW5A 5F8QC 1LDPL 4X8JA 4YPGA 1WCQA 3GO1L 4LLVB 5DHXB 1IZKA 1KCVL 2FIKA 3T2OA 3REWB 3B9AA 1OSPH 4G9DB 4OTXH 3RX8A 4UI2A 3HUJA 1H3PL 4NWTL 4N8VA 1PZ5B 3PNWB 3E2HA 3EHBD 1Y6NR 1W8NA 3X13B 1S5HA 4NQCA 1BVZA 2F5AH 5KJRL 2P44B 4TRPH 1RFDL 1GIGH 4ZAKC 3K7UA 3BX7C 3I6GB 4A2MA 3CLFL 3F7VB 5D1ZC 4R7DB 3U9PL 4HDIB 3V6FB 3WXWH 5KS9A 3BEVA 1MFCH 4C83B 1CTNA 4KVCH 2V5TA 1B6UA 3Q1SL 2AJUH 3BZEA 2EIZA 4IIQB 1L8JA 1AQDA 4OLXL 4HCRL 4K3JL 3PWPA 3CC5A 3TLRA 3V4VH 3V7MA 1GHFL 3V4UH 2RIKA 5BOPA 4NZRH 3OKYA 3V2AR 5EDXA 3QEQD 4UOJA 5BMFL 1BJMA 4MZ3A 5EBMB 4QXGH 3SDXF 4KV5E 4OQ1A 1ZHKA 2DOCA 2J8UF 1EO8H 5ACZA 1QPXA 3ARGC 2MHAB 3QUYC 4HKJA 3ZE2E 2CIKA 1E28A 1LO5B 1OB1B 1UXWA 3HAEH 5KVFH 3MX0A 1H5BA 3EJZC 5I0ZA 1BD2E 1CGUA 1WWCA 1WISA 5EOCH 2PUQT 1VCAA 4PJ9C 5C09D 2NY5L 3TPKA 1AGCB 1UM6H 5I1IH 3FQNA 3LQZA 5ESQA 2FHFA 2X42A 4AH2A 4XCEB 5E8DL 4EN3D 1N3NB 1U93A 5C6WH 4XCCH 5TE4H 5T3XE 4KQ4H 1A4KB 2IPTH 2Y72A 4QHUB 1QLEL 3BXNA 2V2WB 5DF0A 3TM6A 1HSBA 1LILA 5IMOA 1H3XA 1Q72H 2XY1A 5HHQB 3MROB 2E6PA 5C2BL 2XWBA 1WWBX 1MCCA 3VDAA 2CO6B 3QXDB 3EO1A 4J12A 1NCNA 4KJQD 3HR5B 1N8ZA 4ZXBC 2ICWJ 3BUTA 1XGTA 5FKAA 1AO7A 4DAGL 4RIRA 2B0SH 2AEQL 4R0LB 1B0GA 3LH2L 5JW4M 1DVFB 3G5ZB 4JM2C 1QACA 1WT5C 4PV9B 1KCUH 3UYRL 5HHMD 3NFNB 3DETD 3JTTB 4XC3L 4ODXB 2LTQC 2VOTA 4ZSOB 1RZKL 5IT2L 4LSSL 3I3EA 4LEOA 5DMGC 1ACZA 1S9KC 3FZUC 2OR7A 2E7MA 4KXZH 3ZKQD 4DUWA 4JJ5B 4UINH 2B5IB 1AQKH 1UH2A 2DQEH 2JCCE 2F54B 5F88A 5A2KH 1LEGB 3ARZA 5E2WL 1KN2L 2X4RB 1PZUB 4DUVA 1TQBC 3GB7A 5DJAB 2QQNL 5FHBL 2GT9B 1R5WA 1WITA 5HHVH 1IAIL 5D1XC 3KPSE 5BV7B 4MS8D 3MBXH 4XNXH 5EPMA 4RA0C 3THML 1AD0A 4Y4FD 2O61A 4EUPG 1LK3H 3CSYA 5F7HA 5MENA 4WCYL 3OR6A 5EO1B 1QLRA 2QQLL 5D7JB 4WFGE 1UVQB 3BD5A 3VD9A 4GAYA 2R29L 1ZLUK 1QHPA 4OBSA 3VRLE 1P7KB 5IBLC 1JTPA 3WKNA 1H0DB 4HWEL 3RTQC 1VKXA 1L9MA 2P4AB 2QKIA 2A74B 3QXVA 1JFQL 4NQSA 5L8JB 1AXSA 1FL5B 3CPLA 2VXUH 4MNHA 4PUBL 4ZO7A 4O2CA 3BUYA 4EUPB 3GSXA 1V5JA 2WBJA 5J13C 3OJDA 4HS3B 4Z9KB 5HI4D 3BIBX 3SJVB 3DO3A 4KK5C 4HX1A 5CJQH 2C26A 1INEH 4HLJA 3MRRB 4M9OA 5A2FA 2D7MA 5E8PB 1NDGB 4R2GC 4OQTA 1KTKE 1OAUL 5EH1A 4I77L 4AL8L 1CTOA 2ATKA 4ISVA 3U4EB 1S7VB 2VKWA 5BS0B 1T7YA 3FAXA 5D72L 5D2NE 3C6LD 2ARJA 3KPPA 5DD1H 1DE4B 3QI9A 5E2VH 4HPOL 1TQCC 4UV4L 1ZLVK 3HPLA 5J57B 5IGXL 2ICWA 4QHNB 3B2UC 3I02B 3AU1A 4B41A 1OGAE 4FQLL 4K55A 5ABDE 5C2UB 3L3GA 3BAEL 4FQQA 2R2HB 3E6FB 2DQCH 3L3DB 4MDJB 3TA3B 4X6DF 2C5DC 4RISH 2FBJH 4PTTA 5EUOB 1Q9KB 3QO1A 5IK3A 3D18B 4W70A 3MOBL 3QUKB 4OFDA 3IU3B 4HXAL 4QNPF 4LCWD 2GJ6D 2W9EL 3H9HA 4OGXH 4DTGH 1A7RL 5F7FA 5T1MA 4GMTH 4E5XB 3WBDA 2FECI 2ZKHL 2N7AA 5C9KA 4YBLC 5KSVA 4NNYA 3QFJE 2D7QA 4XPHL 1PLGH 1IM3A 3QHZL 1JPGA 1HHGA 1BD2A 1HILB 1WIPA 3DMMC 4L3AA 5I66A 1H15A 4YEFA 3L7FA 4Y16D 3L7EB 3QDGD 4JKKA 1JNNL 4JM4L 1NMCB 3G9VA 5E5UB 1SQ2N 3T0EC 3TV3H 5ETUB 1S9WB 3RZCD 3OKNB 1S5IL 2HT2C 2OSLA 4ORGA 1S7QA 3DGGB 1CICA 4QWWD 1NMAL 4FNLL 3LN4B 2CDGA 4P4KB 5CHNA 3F6LA 1OP9A 2IQ9H 4M62L 1PY9A 2F15A 5BV7H 4R7NB 2P49B 5F7KC 3RNQA 1ZTXL 2OI9A 5HYJE 2E27H 3VXUB 2OTWA 5FUCE 5E5MA 3VFOA 4FQ2L 2NXYD 2H3NA 2K7PA 4DVRH 4I0PA 2BVPB 4DVBB 1HWHB 3MBEA 4RNRB 3RVWD 3KXFE 1RSFA 1Z5LB 5A16B 3VFGH 4Y5YB 4JRYD 2UZXB 5D1ZD 4HIXL 3ARDC 4WWKC 5BVJA 4QXUH 1JBJA 3T3MF 4DW2L 4XTRC 2FGZA 3L3HA 4P9HH 3ARUA 3BKMH 4ZOCA 2JCCA 4EUPH 4JANB 2BNQE 5DRXA 1CFTB 4ODTH 1PFCA 4GS7C 4XCYB 2HVKB 4H0GA 4YHLH 5EO0A 1XIWA 1NANH 4ZPTA 4ERSL 5L2JA 4DGVH 3CMOH 2C4FU 3KPSA 4DEPC 3WUWB 1RIHL 1A3RL 2UZIH 4NQVA 1CF8H 3EW3B 1EEYA 2XWTB 3FFDA 4P5KB 1RMFL 3ZHDA 1HZHH 4OSUH 3ZDXF 3IKKA 3O6FC 4YHZL 3KPRD 4P2CG 4N8VG 4XRCB 5HHXH 4H20H 3HZVB 3EJZD 1KPVB 5IVZA 5IWLC 4XZUB 5JUEL 1EXUB 4I8DA 4JVUA 5ICXA 3U7YH 4FABL 3BZ4B 4KRLB 1U58A 4PJ9D 3NGBB 5JW5B 2CXGA 2VRAA 1DR9A 3FQRB 4KJPC 4NC1C 4X8JB 2YKLH 5DFWH 1QR4A 3WIHA 1QBML 1JP5A 2FIKB 3JWDH 1GCFA 3MCLL 4ODWA 1PSKL 5IESL 2VZ3A 4CJ1A 1YMMD 2BMKA 3S34H 1QBLH 3QHTC 2BHUA 3HUJB 5IB4A 1J1PH 4IRZH 4N8VB 3GHEH 3CFBA 2EDEA 3E2HB 2OMNA 4G8GD 4ORZC 1S5HB 4NQCB 1KSRA 5L9DL 3NMEA 4ZTOL 2DQFA 5C92A 5ILTL 5C0AD 3FB5A 1MHCA 4P59L 3GMPA 3E1F1 5E7BA 1D6VL 2H45A 1JK8B 1D7FA 5KS9B 3QUZA 5L2KD 1OAQH 3BEVB 3NVQA 5D2NA 5KVDL 4U6VL 4KMLB 4JM2D 3BZEB 2EIZB 4KK9C 1AQDB 4RDQF 4I0KA 4Z7NE 3PWPB 1X4ZA 3CC5B 4WUUD 3MA9H 3FZUD 1HIML 3RVVD 3S6CA 2J4WL 1OGAA 1QBBA 3SY0B 4XWGL 4HPYH 2VDRH 2PYED 4HGWA 1ZHKB 4YHNA 4C56D 3E3QC 5ACZB 1KXQE 4B53A 3F12A 2EDWA 4OIBA 5C07D 4L8CA 4GSDH 3WLBB 4HKJB 2CIKB 1E28B 3V0WH 3QEQE 1UXWB 3VFNA 4NFDA 4JFHD 3HNSL 1KACB 2N4IA 1OPGL 5DGRA 1H5BB 1JZ7A 4K8RD 2C3HA 1UXSA 1ES0A 2F8VA 5B38B 3O2WH 3VWKA 1IJ9A 1RIVH 1IFHL 1J8KA 3QFJA 4IJ3B 3LN5A 4NHUE 1PYWA 3OKMA 1V3LA 5IJKC 3RGHA 3FQNB 5ESQB 3T2NL 5BOZG 4AH2B 3QEHB 3RRQA 4JFZL 5HGHA 4OLUL 5LXGL 5IVNA 2HFFA 5FHAH 4G9FE 1CG9A 4Y1AA 3BXNB 4KTDH 1HSBB 3BZFA 5IMOB 4PJ5D 5I8EA 5C09E 2XWBB 1NCAH 2EYRA 1FNEA 5I76A 3UDWA 4JVWA 4LLAA 4KK5D 3HG1E 1N8ZB 4QGTA 1BPVA 1XGTB 5FKAB 1AO7B 4RIRB 3JVGC 5HYJA 3P40A 2HYMA 2UVFA 4AIOA 1B0GB 4O58H 2CMRH 2JTDA 4ODSH 5IR1A 2GI7A 4U7KA 3VDBA 4O9HH 5EWIH 5GGTH 2NW2A 2FNBA 1MRFH 2ILLA 4R90L 4JQVC 1HWGB 3GBNL 3ULVF 4LEOB 3BMVA 4YDJA 4L4TD 5E00A 5KANI 2HFGL 4Z7VE 4WEUD 2QQQA 3EYSH 4Z0XA 1I9IL 1I7RA 1YN6A 3SKMA 5F88B 1WAAE 2PCPA 1FIGH 3MXWH 4JFOA 1IQWH 4JLRA 5HHME 4GRWB 1C5DA 1KT2A 2A73A 4WO4C 3EDJA 5GISL 3IF1A 4NO2A 2BNQA 1R5WB 4ZD3H 2NY6D 2ICEA 4JQXA 4WFHE 2DIAA 4D9LL 5EPMB 2WLYA 1Z9MA 1AD0B 1F11A 2VZTA 4KKBD 2O61B 3IFNL 2FZ3A 2ORBL 3ZDZF 1HINH 3V95A 4X99A 3CSYB 5MENB 2XQYK 4PB9H 1RUQH 1IKFL 1CLOH 1QLRB 2ADJA 1WZMA 2XTJD 1FNGA 4GAYB 4MGXA 1MH5A 2XV6B 4KROC 4XPAL 3X3GL 1KB9K 1WJ3A 2GJZB 3CAFA 1VKXB 3B2VL 2QKIB 4XP5L 3T0BA 1UB6A 1UWEL 2AEPL 5D7IE 3DMMD 5FOJA 1AXSB 3TIDA 3CPLB 4MNHB 4O2CB 3BUYB 3GSXB 1OARL 4X6CE 2WBJB 4JFXA 1HH9A 4CAGA 5JR1H 5IG7A 3ZYJA 4KGJA 4HX1B 2HT2D 4RFNB 4AQ1B 4Y89A 4FFVC 5F9OL 4EVNA 3OZ9H 1KJ3H 4M93C 1CBVH 3OKKA 2Q1EA 4JG0H 1JYWA 5FDWA 2W60A 5DZOA 1R3LA 2EE3A 2ZJSL 4LDEB 3OR7B 4NQEE 4LCYB 3M8OL 4PYGA 2ATKB 4ISVB 4LHUA 1U3JA 4K7PY 4JEGB 4PB0H 5AEAA 8FABA 5I73B 1VA9A 2CGRL 1KTDA 2ARJB 3KPPB 2VN4A 2MQ3A 2R4RL 5I1CH 1T0PB 3QI9B 3PE9A 3W11D 1OP5H 3HPLB 4P3WA 4YE4H 1TXKA 3HLAA 2DQDL 3SGKA 2BSSB 2ICWB 4KRNA 3U2SA 4JR9L 3CGTA 1U8JA 2D03H 1EPFA 3AU1B 1WTGT 4YH6A 2PF6A 4LU5H 3HC4H 1IC7L 4NZDA 4P23C 3L3GB 1OSZA 3TCLA 4YHYB 5SWZA 3M17A 2NNAA 1FP5A 4IOIB 5TDPB 1ZEAH 4GQ9H 4PTTB 3QO1B 4U1GB 5IK3B 1J8HD 2X4PA 2AGJH 1OVZA 1NUDA 3H9HB 4JPKL 3EOAA 4WJ5A 3K8MA 2RHEA 2AI0L 5T1MB 1ZGLA 3GNMH 3MLWL 5CJXA 5LGJA 3QEQA 3P0VH 1CFVH 5KSVB 2HRPL 4NNYB 4N9GA 5D8JL 1FH5L 5JW4R 1K8DA 1X5LA 1HHGB 3R1GL 4Y4HD 1NGPL 1BD2B 2IALA 3S3JA 4XNUH 5I66B 1H15B 3HI6H 3L7FB 5J1TC 4NHUA 3E6HA 5ALBL 3QHFL 4XVTL 4X9IA 4MAUL 5ALCL 4C4KT 2C4FT 3IJSB 4L1HA 2OSLB 4ORGB 4YK4B 4KKAD 1L9NA 1VEPA 1S7QB 1CICB 2XZZA 3KLAA 4G9FA 4G6KH 3FO9A 2CDGB 4GRWH 3QUXC 5CHNB 5IFHH 3H7BA 5C09A 2KBGA 1S3KL 3O0RH 3DX9A 3RNQB 2OI9B 1NMBH 3HG1A 2OTWB 4EN3A 3C60A 2FIRT 1X5KA 2H3NB 3LPGA 3ALXA 1WSST 5E6IA 4I0PB 5H37G 1J0IA 3CMGA 3N85H 1G9NL 2UWEA 1NAMA 3MBEB 2XG5A 2DBLH 1HSAA 1KB5A 3M45A 4LLYA 1T66C 1BIIA 2EE2A 4ZUTB 5BVJB 1FN4A 1RULL 4Z7VA 1IC1A 3RX7A 3L3HB 4WRLA 4HIHA 4KK9D 5I15H 5DR5L 2JCCB 5IFJA 4JRXD 5HI3C 3QBTB 1MELA 1WAAA 2AJSL 1KG0A 5DRXB 5EC1A 5HHMA 1SJXA 3JWNC 5F7LB 3C2SA 5I16A 5EO0B 1XIWB 4XVUD 5F1KC 1G7IA 4ZPTB 5L2JB 4G6ML 3KPSB 3BDYL 4H5SA 1D5IH 2IAMA 2D0GA 2XN9E 1BX2A 5I1HH 2YS4A 4OQTH 3RY6C 2VDPL 1A6VL 1KPUA 3FFDB 3I84A 3ARBB 2ZCHH 2F74B 4OV5A 3QQNA 2DDQL 4D94A 4FP8L