4Z78A

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 277
sequence length 277
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z78A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4z78A01
2DQIH 5DC9B 4K3EH 5SWZA 5FUCE 5I1GL 4YBQC 3UTQA 4DUWA 5HI3C 3U0WH 1I1CA 4LSDA 2X6MA 4Z5RA 1NC2D 5D7LB 4NZRL 5F70A 5GRVK 5DD1H 1A6WL 5CHNA 3U1SL 3K8LA 2AV1B 1Q9WB 4PYGA 1C08A 1PFCA 3FFDA 4GLRI 1TJIL 2OP4L 5D2NA 4LLWB 2UYLA 4EOWH 1V7ML 3GMQB 3VFMB 1KT2B 4HKXB 3RWFB 4CW1A 4MD4B 1TDQA 4GS7B 4UQ3A 2Z92A 4HUXA 5GZOD 1QYGL 2HG5B 4CKVX 3QRGL 4ZAKC 4WV1C 3HUJB 2FX9L 2LVCA 5EO1B 5IGXL 5EB9A 1J8KA 1JV5B 4ZUUA 5GGSA 1YMHA 1AQKL 4XNUL 5I15L 1RUPL 3S6CA 2DQJH 4GKSB 4KY1H 3FT3B 3KYMB 3GKWH 1BIHA 2P48B 3U2SA 3FB6A 2J8OA 2QR0B 1UKTA 3X14B 4DUXA 5IT2L 4QHKJ 1A02N 3DRTA 5GQBA 4DEPB 3QUXD 4WUUE 1T04B 4MDJA 1YEGL 3MUJA 4ZUSA 3F5WA 2GHWB 2EIBA 1HINL 4LVNB 4QXWA 1F00I 4NZUH 4R4BB 3MBED 5IESH 4IEFB 4R7NB 2C7UA 4K3JH 3S34H 1RZ8A 1KNOB 1R0AL 4CVXB 1QFWM 2X41A 4FG6C 4X6BA 1CFNB 2EYRB 3HMWH 4RMUA 3I9GL 4UIKH 1N0LA 1MCKA 2CXGA 3IF1A 1KN2H 3H9SE 4P5TB 3AXLB 5E8DH 5MERB 2BNRB 2X4UB 2QLVB 2HT2D 4LU5L 4KTYA 4UT9L 1DANU 1FYHB 3SKUD 4M1CD 5FO8A 4GBXD 5C1MB 1H8SA 1FH5H 1YNLH 4O4YL 4HIEA 1MFEH 2ZCHL 4PJ9C 3MV7E 2ED9A 3MLUH 3KWWA 3DYOA 1I9JL 2QQKL 4LOUC 3O8XA 4FQ1L 3RBGA 4EDWL 5D5MB 1OLLA 1YMMB 2WLYA 3MV7D 5DJYA 1U8IA 2IAMB 3TC9A 5GRZA 1QFUH 3PABB 1DUYB 1MCHA 1REIA 2WWKT 3E3QC 5IHUL 4X6DB 2RHEA 4Q6YA 4AEEA 4QGTA 1CFQB 4NO2B 3H3PH 5B8CA 2XXMB 4PR5A 4KUZL 5D1XA 4HIIB 3E2HB 1HHJA 3BYTA 3D25B 5F9JB 3U9UB 1C7TA 1XCTA 2YD9A 1NBYB 4PGDB 5DVLA 4EIZC 3BD4A 3UC0H 1U8HA 1KTRL 2XTJC 2ZZUT 4NQEE 3H2WA 1IEHA 4NO0B 1J05A 1CL7L 4M6MH 2YR3A 3EFFA 5FDYA 3IFOA 3U0PA 1ITBB 1H3WM 4NQED 4M43L 5IB2B 4YXKL 4XNMA 3UX9B 3D69A 1K2DA 5FOJA 5IROC 4ODXA 5MEOB 4JDTL 3SE3A 3I50H 3VI4F 2EDLA 3RU8L 1CFTA 4KJQC 1JNJA 4XC1L 2Y06L 2Z31A 1ES0B 1MCOH 3OHXA 1N2RA 4X6CB 5FIEA 1ZEAH 2OR9L 5KSVB 2HRPH 3DX9A 1FL5A 1LE5A 1I1AA 3VH8G 2E7HA 1RPQA 3P4OB 5ALBH 1NAMA 5CJQL 1WAAA 3O3EB 4LSPL 5DVOA 3K7UA 1OM3H 5DD0L 3V0WL 5IVXF 2R1XB 3VFSB 4M03A 5KTEL 1TQBB 4HIJA 1K4CA 4NCC2 2MSPA 3GJFB 2P8MB 5L2KB 1V05A 4Z6AT 4DVRH 3UPAA 1YEKL 2JCCF 5DURB 2BFVH 4HULB 4GO6B 4FP8H 2GJZB 3PHOB 2J8UE 2NXYB 1MVFA 3ROLB 1FFOB 4ZS7L 2ORBL 5KZCB 4BUHA 3RWCA 2DJUA 4UILH 1NAMH 3LIZH 4YFLF 3WS6A 1QR4A 2AXFB 2NY2D 5LKNA 3UYRL 3GBNL 3QCUH 1L4IA 1WZKA 4KQ4L 3UAJC 3ZKND 1FZOB 4P5KA 5I1LB 3E6HB 5BVJB 1RUMH 1L9NA 1HWHB 4NYLB 5KN5A 1E4KC 1A9BA 4Z8FL 4Z77B 1WFTA 1QRNB 2UY7A 4R97B 4BZ2H 3CFDB 4RGNB 4PJIA 5I1KH 2CDEB 2O5ZL 2OJEB 1OHQA 4NGHH 2WY3A 1ZLSH 4AQ1B 3KPPB 2ZUWA 5MI0C 3W9DA 1XCQA 3TT1H 3K2MC 1PKQA 2F58H 4YIQB 3TT3L 2DI9A 3L3GA 3SE4C 2KDGA 1RZKH 5DHVA 1VFAA 2ZKHH 1LEIA 2WIMA 4MCYB 1ZLUK 1JF1B 2M1KA 1MJJA 1ZMYA 4RFOH 2YXFA 5F7YC 4K94H 5B22A 1OAKH 3FQRB 1BECA 5MEQB 1SM3H 3JWNC 4PJHA 4JG0H 5E0QA 4JRXB 5C2BH 1NAKL 2VLRE 2WINA 4GAJH 3MXWL 4DWHA 2F5BH 4X6FA 3SGDH 5IFHL 1GIGL 1KENL 4QHNA 2VLRD 3R8BB 3RBSA 1OT1A 3UXFA 1OAQH 4MNGE 1X7QB 1RHHA 4LAQH 3RVTD 5HYJA 2XWTA 1F58L 5DHVH 1U3HA 3TPUA 5T5NG 2DTMH 4U6VL 4JFYB 2X7LB 3GSNL 5A40E 5C0EB 4DKAA 1NDGB 1TCRA 2B1HH 4LSSL 1NCBL 3H8NA 3SGJC 1PG7H 5ADPH 1CU4L 2EC8A 3KDMA 4M7JL 1PEZA 1S5IL 3L1OH 3TA3D 3QIWD 1A5FL 1YEFH 4QXUH 4ZD3H 3WLBA 2R2HB 1FNEA 1RZJH 4OB5L 5D8JL 1Y0LA 4OQ1A 5C86A 4PRNA 3WHXB 3BZDA 4UI2A 1KV3A 3G5VA 4HEPG 1OCWL 2PNDA 2OL3A 5LGJB 2LU7A 3MR9A 1B4JL 1H0DB 4L4TA 2FECI 2UWEB 2BOCA 4ZXBB 5JXAH 3B9AA 3RKPA 3QI9C 1D5IH 4NKOB 1I7UB 5AG8A 2VWEC 2R15A 1Z9SA 2CRZA 2NY4B 3QDJE 4OGXL 3UTZB 3SDCA 2P7TB 4NNPH 4JFPB 3S3JA 4DFIA 5J6HB 3KLAB 2G75A 2JELH 3PL6C 3QDJD 5HHOE 5GIRA 1MLBB 2AABH 1LO3H 4Y7MA 5ANMB 4LARL 2XWJB 3QUZA 5B21A 5HHOD 1JZ7A 1VEPA 2YD5A 1HHGB 1ETZB 1LO0L 3KPMB 1IEAB 4JO2L 1KB5L 5FGBA 4XHJC 3QHFH 2OL3H 4E0RB 2VUOA 3PWLA 2YUWA 1WZMA 4RAVB 1U3JA 2AJYH 1XT5A 3LQZA 1BX2B 1NLBL 1ODAA 4JPIB 3GM8A 1F11B 1CE1L 3TVMD 2WANA 4YR6A 4CN1A 1ZHLB 3OV6A 5TJWK 1UXSA 3BO8B 5KVMC 4KK6C 2P5WE 5I8EA 2CD0A 3ILQD 2A9NL 1DQJB 3WJJA 3GDBA 1Q94B 4HQQH 4AK1A 5EU6B 2QADC 2VISA 1AO7B 3FCTA 2A74B 1QSEA 2EO1A 4YHOL 3ZLQC 3VFOB 1G0DA 2Q1EA 3G5ZA 4MA3A 1UM4L 3CFCH 4DGIL 1LE9A 2R1YA 3O81A 3T65A 4P57A 1AC6A 3MUGA 2Z35A 5ALCH 1AI1H 2BCKA 4WFFE 3QJFA 1FSKC 4S1SH 3V5DB 4XVJL 2RJMA 4AIZA 4NDMB 1FG2B 3O6KL 3MRPA 3IFPB 5I8CA 4WFFD 1W0WA 3LN5B 4X80L 4YWGL 4Q9QH 4LF3B 1SJHB 4RMRA 2IMNA 5BZWB 3UTSA 5EIQA 2VR9A 2GITA 3DBXA 3WIHH 3WN5A 4G8EA 1HEZA 3NZHL 3WFHA 5E95B 1FPTL 1YEIL 3V6OA 3MJ8A 5BS0A 2IPKA 1QEWB 1N8ZB 1FNFA 5IBTL 3K74B 4YO0B 3G6DL 3P4LA 5GGRY 4MA8H 4PV9B 4KKAC 1A7RL 2W38A 2NY6C 4Y2DB 4F7CB 1NEZA 1KFAH 3O2VL 4PLOB 5BRZA 1JK8A 1MELA 2NTFB 4OD2B 4DUVA 3MGTB 1E4WH 3NZ8B 3PF2A 2A38A 2PYEE 3W9EB 2AK1L 4AENB 5GS2D 1IQDA 3DO3A 5F9OH 1LD9A 4JQXC 2PYED 2ZP0T 4JPKH 2UVFA 4HBCH 1IKFH 4MAYB 4TSCL 1N6QL 2BY2A 4FTVE 1H8OA 3DMMA 4HT1L 3SDXF 1VB9A 3QXDA 3QNYA 4D3CH 1DLHB 3WNPA 4HS3B 2FJFA 4YHYB 2J6EL 3AS3A 4L3EA 4FTVD 5T5FH 4ACPA 1B6DA 3RDTA 5F1SA 4DZBB 4JKPL 2OBGA 5HHQB 1RUAH 1P7KB 1ORSA 1RJLA 3LKRA 4Y16B 3BGMA 2AXHA 5DA4A 4LLUB 5JW3H 3PP4H 4B5EA 4BQ6A 2RCSH 5E7FA 1G7MB 3BYYA 1U8MB 1C1EL 3WJLC 5J9PB 4XPFL 3ULUF 4WEBL 4HJ0C 4A6YA 2MJWA 3P0GB 5HJ3B 1E28B 5D70H 4DK3A 1A6AB 5IIEB 2VDMH 2C26A 4JFQB 3W2DH 4M1DL 1AHWA 4CU8A 2R39A 2F15A 5C6PB 5K33A 4RFEA 4S1QL 2VLME 1YMMA 2F19L 4CMMA 1A3QA 3QDAA 1J8HB 1OGAA 2VLMD 1OARL 4MJ6B 4HGWA 4PJXA 3TBWA 1YECH 3CVIL 3U4BH 4ZFGH 3NTCH 4QRUB 5B38A 1R24A 4HUKB 3X13B 3O0RH 3F7QA 5CZVH 3HC0B 1S7UB 4JDVA 1IGJB 1MCBA 1KTLA 1N6UA 1SJVA 3HE6C 5CKGA 3P30L 3C08L 4M3KB 1MCQA 4WI2A 5DRZA 3KPQB 4PTUA 2PTUA 5FM8A 5F6HJ 1JRHH 3NCCB 4GMTH 4NHUB 2VZ1A 2X10A 4RBPK 4HXBH 5EC1A 2AJ3A 4NQXB 1N3NB 3BH9A 4RFNB 1D5BB 1CGUA 4QOKA 3B4NA 3ECBA 4KK8D 1ZTXH 3V6FA 5H2BB 2ZOLB 1FQ9C 2EKSB 1NCAH 4J4PC 4LCWB 2ILLA 2NW2B 1FVEB 5K9QG 1CE6B 3IXTA 4CRPA 2FEDD 4HFWB 4AH2A 1MLCA 4LIQH 2KL6A 4PJ9D 5SWQB 4P2QB 2NY7L 4BFIA 2DB8A 4NNXA 3ZTNL 1I75A 4LOUD 3D3VA 2VXUH 1QSVA 3TH4T 2ED7A 3E3QE 1RZIA 4N1CA 2VH5L 3MOBL 4YHIB 2WBJC 3OGOE 1EV2E 2BRRH 4TNVF 5E08H 4TUOB 4LLYB 3VFVB 4X4ZA 5FK9B 4KHTL 2F53A 4YHKL 1MWAB 2FO4B 3TNNA 3V6ZB 3OPZL 3P9LB 1VFOA 5EOQH 2C4XA 5DJ8B 1EHNA 1KJMB 4S0TD 1KJ2L 2Y9RT 5CUSL 1ONQB 5TE6L 3Q5YA 3GUTB 3NAAH 5C92A 5EU4B 3HE7D 3GMRB 4WO4A 4LEXH 2RAMA 2VIRA 3SGDI 5E8OB 5KS9A 4P46A 1P5VA 2DM2A 3WIFB 1HSAA 2A6JB 1IGCH 4HKBA 2FX7L 5IQ9A 3FB5A 5B3JF 3BDXA 4NQCB 4MQTB 2VR5A 3MYJB 3RWGB 1FORL 2X9YA 3KNBB 3ARQA 4HV8A 2IBZY 3WNNA 3CFKA 2XN9B 5EZIH 1WWWX 1RK1A 3VFRA 2HH0L 1I3GL 2MHAA 4OZHE 2ADGA 5IK3B 4MS8D 4CADB 3QHZH 3PE9A 4RIRB 4OZFH 1HIMH 5IVXB 4DAGL 4PRAA 1U8OB 4MHHI 2GSGB 3O6FC 1FGVL 5HXMA 3T3PE 2FIKB 3HI6L 5FYKH 3L3IB 2IANE 5H94A 3VXRB 3HMXL 2EIZB 3DETD 4EXPX 1YPZE 2ZPKL 3OKYA 5INCB 3U46B 4YX2H 5F7EH 1AD9B 3L5HA 3TYFB 4OLZH 1QO3B 1P6FA 2IAND 5CD5C 1A8JH 4HAFA 1JF6A 1DBMH 1JPFB 5MENA 3GB7B 2I9TA 1XGUA 2VQUA 1G1YA 4PB0H 1A14H 1UQSA 1K5NB 3VGBA 5JXEC 4LCYA 5TDNB 4NRZB 1MEXH 1U92B 4KROC 5CCKH 1NBQA 3RGHA 2BY1A 3EO9L 4PG9A 1HHHA 4OGYH 2JJUA 1KXVC 1V7NH 2YD3A 3ARPA 2HT3D 2KPNA 5FUZL 1UXWA 5ESQB 4EI5B 1DVFB 1K8IA 4XBEH 1F3RB 1BD2E 3RTQD 1XH3B 5DUPL 43CAA 3GRWL 1I7TA 4G80A 1X6NA 1BD2D 4FZ8H 4X99B 1HOCA 4UOW0 1WCBB 4NHCH 1LQVA 2DBLL 3CK0L 4HF5H 5T3ZH 1X5FA 5IB4B 1INEL 4OM0H 3FN0L 3DGGB 1L7IL 5KAQG 1TMCB 4OTXH 3HC3H 3C6LC 4QKXB 5ESVB 3DNKA 1I8IA 4WTZA 1S8DA 4RNRA 1FL3B 4D0CA 4ELME 2VQTA 1OTSC 4QHMB 1E27B 2H41A 3D85D 3OKNB 5E6ID 4NQSB 2YUVA 3BP7B 2DS4A 1EBAA 2RQ8A 3STLA 5T1LA 1G6RA 2VDKH 4R0LC 1RIUH 3V4UL 4P2OB 5JA9A 3IETA 2CK0H 1S7SB 4PJDA 3BN3B 2QQQA 3O6LL 1PY4A 3AREB 3CSGA 1XIWB 1R3IL 4QRPB 3TCLB 1OSZB 2ICCA 2BVOB 4X9FA 2KQMA 4Z18A 3T0VA 3DXAE 1M6OA 5DK2B 1DUZB 4K71B 4PDCE 3UJIH 3DO7A 3DHMA 3EYOA 1XGQB 3DXAD 5CSZB 5GS0D 1N7MH 3DWTA 2QSCH 1GCFA 1DBAL 2OYPA 1KB9K 2X09A 3SGKC 3VWJB 8FABA 2P5EA 2DBJA 5MP6H 4APQD 3MLYL 4F58H 3TWCL 4M7KL 1G6RH 1T7YA 3SE9H 1GYAA 3QEHB 3CMOL 4OIBA 1NL0H 3FFCD 4NPYA 4ONOA 5F9DC 2NXZC 1QVOB 3MRCB 4KTEL 2P45B 2V6HA 1P4IL 2V9QA 1T22A 2NX5B 2A73B 1G7JA 4OQTH 3PGDB 2C3VA 1AE6H 2XNAA 5D2LB 4H1LG 4PBXA 1N0XL 1O5DT 4RMWA 5MEPA 3ARDD 1ZVYA 2CLZB 1JGEA 1NMBH 3SJVA 5JNYA 1LWRA 5GZNC 4Q6IB 3I2CL 4N0YL 4JM2C 3AGVA 4RDQF 3BPCA 4X9HA 1ZAGA 4NN7B 5BZDB 4NO3A 3DX6B 5CMAA 4RQQB 4L9LC 3CZFB 4IOFD 4Y0GA 4ZDHA 1KSRA 4XVTL 3UZVB 4Z7UA 3MA9L 5C08E 1ZHBB 5IR1A 5ELIA 4JHWH 4EJ1C 4BZ1L 1VGKB 3E8UH 5C08D 1KCRH 5HYQB 2EICA 3SY0B 1XR8B 5TPWH 1S7RA 3G9VA 4XMPL 3IS0X 3MUZ1 3LMJL 1QUNA 3VU2A 4KRPD 4M00A 1EH9A 1JPGA 5I9QB 3OGCA 3C5ZB 2EH8L 4P3CH 1FZKA 4MXQC 4JJ5A 2HJLA 3WYRA 4MB3A 3BGFC 1Q8MA 2E6PA 2XT1B 4W4OA 4I2XA 4PJGE 3S5LA 3CJJA 4JLRB 3WBDA 2Y07L 3QPXH 2BMKA 4RRPA 2CGRL 3QWOB 1T03L 1EHLH 4JPWH 4P2YA 1FL6A 2YC1A 4HIHA 3SDDA 4ENED 4X5XA 2XPGB 2R9HC 3U7YH 2I9LA 5LXGL 3IFNL 3UTTE 3TFKD 5GGSY 4MLSA 2P8LA 3Q6GL 1U91B 1JRHI 1GL4B 2YD4A 3MRRB 3UTTD 3S37X 4Z0BH 1FFNB 1ZE3C 4OM1L 3A6OA 4UZGA 3QIUD 5E94B 4UT6H 2BVQB 4UINH 2P1YA 3JV4B 1ZSDB 2NLJA 2C1PA 2ERJC 3FB8B 1R5VA 3KS0J 3H9SA 2FH8A 2WBKA 3N1GC 1PYWA 1OSPH 1NLDL 4XP6H 5AZEH 5SWSB 3NPSB 1LO4L 1FYTA 3RVWC 3ARRA 3VGAB 4AEHL 3VFNA 4HDIA 3NGBB 1A4JB 2CJUL 3GJEB 1RZFH 1NCWL 1AD0A 4G6KL 5EC2B 1F4HA 3V4PH 1N59B 3IDXH 3V5HA 3MX0A 2K7QA 3R1GL 1IAIM 3HFML 3RUGB 2BNQA 4K3GA 4RWYH 4YC2C 1FRGH 4FN0A 4ZUWB 3VFGL 1EEQA 4UB0H 3HZYB 2EDYA 4P2RE 3RIAK 4D9LH 4AIXA 4MB5A 3MMEA 4OCSH 2H26A 4B50A 4P2RD 4IDJH 1I85C 4P4KD 4PJ5E 4AL8H 4LEOB 4HD9A 4JN1H 3VA6A 1YDPA 4G9FE 2V2TB 4LRIC 4PJ5D 4S1RH 2X5PA 3WXWH 3A6BL 2NNAB 5DJ2A 1H5BB 4G9FD 5J3HC 3KXFD 3QDGB 1INQB 1X4XA 5KSAA 4UDUA 4WHYH 4NSKB 4AT6A 1CICC 3U6RA 2FGWH 2VN7A 1QBML 3MLSL 5CJOH 2VLKE 3D5OF 3PWJA 4FQQA 4TTGA 3MRNA 2Y72A 2VLKD 4UT7H 4DN3L 4GKZB 4MLIA 5I16A 1T0MA 3KJ6H 1X4YA 5T3XD 3K4AA 5ACZA 4X5LA 4YXHH 1JGVL 1G7PB 2HJKB 2X1PA 4L4VE 4O2CB 4AG4H 3N85L 4Y4FA 4Z95L 1ZHKB 1EFXA 1CCZA 1BREA 1E6OL 3PIQA 4TOYL 2Q8BH 5JOPE 4L4VD 3BWAB 2IEPA 2AXGA 3IDNA 2HLFD 2ARJB 1S9VB 5JOPD 3QQ3B 4GRLB 4EI6B 1RZ7H 5I19L 2QHRL 5MHSE 2FO1A 3VXME 5L7XL 1XGYL 3MJ7A 4G42B 2DQDH 4OCYL 5HD8D 1SEBB 5MHSD 2DQTH 3VXMD 1FFPB 4EN3D 3V52H 3EOTH 4N0UA 4B7LA 1UYWL 5F7KC 1VFBB 1FNSL 4Q74A 3I3EA 1L6XA 3CUPB 3P0VH 1BZQK 3NIFE 2A6JA 1A3LH 4PV8A 5LBSH 1PLGL 4PJ7E 5AZ2L 1FFQA 1WT5C 5DJXB 2F8VA 3LPFA 2ZOKA 2VMFA 4KV5E 4XXCA 3BP6A 4URTB 2CDFA 3KPSB 5IV2B 3AU1A 3MOQA 3QUYC 4OFKA 1CFBA 3R4DA 2NY0C 1KELH 4RGMC 3SO5A 1R3KA 2EE3A 3GMOB 3DVGB 1II4E 1JZ8A 4KVCL 5DWUL 2V7NA 4JZNB 4HJJH 32C2A 5D7IE 1FIGH 3IFLL 2NY5C 5DS8A 4F3FB 1QLEH 1NGZB 2I07A 1SJEA 3B9KA 4U1IB 1IGYA 4XTRC 3I02A 4TUJB 4Y1AA 3OKMB 2DICA 1N4XL 5C0GA 2NY3B 1I8KA 1T83C 4LKXA 5E4IA 4Q58C 1IFHH 2JCCA 3RWDB 2NCMA 1CQYA 2BNUB 2WUCL 3MLVL 4Y8AA 5E5MA 2ED8A 2XKUA 1AGDA 1I4FB 4ISVA 2PO6A 2BC4B 4P9ML 2GUOB 3BQUC 2Y1VA 1KIQA 1MI5B 1V3JA 3EO1A 3ULVL 4U0RB 3DUSB 3BKCH 3BE1L 4XPHH 5TFSL 4NBZB 5I8KH 3C8KA 1CBVL 4FNLL 2ATKA 5I1HL 2APTA 4PRBB 4Z7OE 1Y18B 5ISZA 5FECB 1CGTA 4O58H 2XXCB 4HC1A 2AK4E 5KVFH 5FYLH 2YEZB 4FQCH 4IRSA 4H26B 4PGBA 4WY7H 2AK4D 4BFGA 3QFJB 5KSBE 1AGFA 1J0ZA 2D7QA 3OXRA 2J2ZA 5FM4A 5FM5O 5A16A 4N0FB 4XXDB 3GZKA 1CDYA 4FQPA 1JGUL 4X9BA 3HAEA 4PJEF 1W72L 4YDVA 1EJOL 1Z5LB 3KYOA 5E1HB 5HDLA 1CG9B 1LVEA 1CFSA 1P4BL 1TJGH 3OKOA 3OZ9L 3KYAA 3BKJL 3S3SA 1MCNA 2FNBA 2BDNH 3FTGB 4KMTL 1C7SA 1YNTA 2BHUA 2MWCA 4LGPB 2HMIC 4XGZB 3HNSH 5IVZB 5LCVH 3FHQA 4Y5VB 3D39A 3CMGA 4UV7L 2WP3T 2FD6L 3QEQA 1IRAY 2LTQB 5FA4A 4PRPE 1BBJA 2YMXH 4HK0A 1XF1A 4UBDC 4WWKD 2Z9TA 1HDMB 4PRPD 4BSJA 1IC4L 4PJFF 4EUPB 2VE6A 5J8OA 2XY1A 5L6YH 3NH7H 5F6IC 4CGTA 1EJ6A 2ICWA 5HPMA 1MFAL 1JPTH 4NC1C 4TPRL 1MJ8L 4CJ0A 4F7EB 4YNYB 3IJYA 5FO9A 3EZ8A 1F6FB 4JRWA 5B4MC 3QQ9D 2NZ9D 2FATH 2AXJA 4P23C 1AFVL 2PXYB 4JREB 4TN9A 3SPVB 5L0QC 4YLQT 5D7JD 5DGRA 1MJUL 4JZJC 3WUWA 4MHHG 3MRLB 3EZJB 3BUYB 4K2UH 1OQXA 2A6IB 2R0KL 1MHCB 4G7VL 5CBEB 4IJ3B 5DUML 3KPOB 4YHNB 3SO3C 3VCLB 4OLYL 1UM6L 3EYUL 3HN3A 5JQ6H 4YDKL 1KIRB 3PWNB 4JPVL 3KPLA 1ACYL 3TO4C 5C71A 4Y8DC 5GS3A 1VKXA 1VHPA 5IFJA 1F4XL 3CFIC 1AXSA 2OX5A 2YUXA 3RGVC 1GH7A 3T1FB 2K3TA 5TDOB 1U93A 3EFDH 2A83B 3ZKXC 3L3JB 3RY6C 4XI5C 4JM2F 3BFOA 1S7XA 3MRQA 1SBSH 4KVNH 5F3BB 5DFWH 2X89A 4JFXB 4WU5A 4DCQA 1QNZL 4GAFB 1JE6A 5HGBA 4OF0A 4I4WB 3FJTA 4KPHL 4YZFE 3I6LE 4DKFL 4JY4B 3VWKB 2E7LA 4OF5A 3H0TB 4BFBD 4MJIB 3KPTA 1AKJB 1MFBH 2DMCA 3FQWA 2YD6A 3P11H 5GISL 5DSCB 5KW9H 3DHJA 5FF6B 3VXSA 4TQEH 3WUZA 5BW7A 4WHCA 5GSVB 2QSTA 1HH6B 2VB5A 2WUBL 3DX8B 3EOAB 1YEEL 4Y5YB 2BK8A 1H3XA 2W60A 5JR1L 5D93B 3QXVA 2DIAA 1RSFA 3LN4B 5J4MA 1PKOA 4JHZA 1I3RB 3VW3H 4E41A 3L5JA 4EIGB 4R8WL 3T0EA 4I0PB 2NW3A 3AY4C 3ALWA 4FXGA 4F7MA 1IAKA 2R29H 4JFEA 3WFZA 4DOHB 3FQTA 1L9MA 2B4CL 3C60C 4PB9H 3DOSA 5D4QA 5CILH 2XQYK 2W9LA 4OZFB 2B0SH 3MA7B 3ARBA 1S7WA 5GZND 3ZKSD 2MQ3A 3IDYC 1SY6L 3OKDA 2L0DA 3QUMB 1QRKA 4HS6B 4WFEE 2DQGH 3N0PB 2ESVA 3D9AH 4O00A 1KLUA 1J1PH 5C0BE 3B5GA 5IB3A 4U6HA 5FUOL 5K59E 2CLRB 1QLFA 1BHGA 5L8JB 3NACL 4ZAKA 4WV1A 1VESA 2FHBA 5EZLA 4IDLA 2GK0A 5GS2H 3IDIB 5SWSA 5TE7H 3SDAC 3OR6B 4M6OL 3CLFL 3JSSA 4PJ8D 4JO4L 3BZFB 4OUUA 1TFHA 4GKOA 5I1JL 4M48H 3IB4A 3QCTL 4WW1A 5HHPB 3LKOB 1CR9H 4HWNA 5HYSB 5EO9B 3JTTB 4M6NL 1F42A 3LZFL 3L7EA 4XX1E 1G6VK 4UTAL 3F7PC 1DBKL 3SKJH 1YEDA 4EVNA 3SDXA 4XAWH 5I8OL 1I7RB 3DV6B 4XAKD 3CU7A 1UVQA 1IL1B 2EC9T 2R9HD 4XRCA 1WJ3A 5JQHC 5EWIL 2GT9A 1CLZH 1P2CB 4BM7A 2B20A 5J12B 3DVNA 3R06A 4ODHL 4YJZL 1TVBA 4FQIH 5C9JB 1QSFE 3NCJH 4HFUL 2CKNA 1T1XB 5FYJU 3L9RB 3CDGB 5AAWA 3IXAA 2KKQA 1T21B 3WFDL 1QSFD 4L1HA 2AJVH 1XF5A 4LVOB 1MCLA 1HILA 3GI9L 3MJGX 3VRJB 4M7ZB 1WFOA 4GW5B 5DC0A 4ZFOA 3MO1B 4M5ZL 1IILE 3O4LE 3DUHA 3INUL 3IRZA 2R56H 3MNWB 4LASL 1IKNC 3DSFH 4ZUTB 4JCLA 3O4LD 5IBLD 1JFQL 2LU4A 5HYFA 4B41A 3QNXA 3HR5A 4LHUA 3S8WA 4FHBD 3OAYK 2DLHA 2R0LH 2HTLC 3F6IA 1FVCB 4FQXD 3MFFA 3MV8A 4FQLL 1JMZA 4ODUA 2CQVA 5CGTA 3SKMA 5IQ7H 1DN2A 2EZ0D 3GSOA 2F74B 4FFVD 4ODTL 1XF2A 2DYPD 5D1ZC 5GRJH 3MCG1 1MRFL 3ZDXE 2OTWA 4IOIA 1BWWA 3FRUA 4N8CL 3BPLC 4OLVL 1RZGA 4X83A 5IKCA 4UUJA 1QG3A 3QYCA 5C07B 35C8L 4Z7WB 1ADQA 3LRGA 1FO0B 4HPYH 3MOAL 5DLML 1QKZH 5CIPH 1P69B 5D7SL 5C0DA 3DGCR 2LAGB 3G6AA 5IROA 3SDYH 1PW3A 4XC3L 1P1ZA 1X3DA 2UZYB 2ATPA 5JW5A 3PUCA 1R3JA 1CDCA 6CGTA 5B38G 5IM7A 5FA3A 4QNPF 5IMMB 4QY8B 5F1KC 3DVGA 3W0WE 3LB6D 4OZHA 5FB8B 2FJGB 1FE8H 4XBGB 3B83A 3W0WD 2VLJA 4F3FA 1ADQH 1N5YL 1ZGLM 4OZIF 1TZIA 4M7LH 1KIPB 1P5UA 4NUGH 2H9GA 2CRIA 5D2NC 5HGHA 3WS3A 4MD5A 3WSQH 1JHKL 3LH2H 2EDXA 2VR4A 1MJ7L 3HI5H 1NC2B 5E2TL 4MQ7A 1VADA 3EGSA 4KK5C 5EZJB 4LSQH 1R5IB 5KG9B 3C2AL 1T7XA 4PREA 4JKMA 4O9HL 2XZQH 1MVUA 3U4EA 2XRAH 3GEWB 3TNMB 3X11A 1DQMH 1D5XA 4ZOAA 4ONHA 6FABH 1ZLWH 3MRKA 3B6SA 1DTUA 3L3KA 4KAQH 2R0ZH 1LDPL 1Q9OA 3QXUA 4GRMA 1EERB 5AWNL 1ZA3B 5E2VL 1AJ7H 1BF2A 3O9WD 4I3SH 2Y4SA 1OAUH 4Y19E 3PWPE 1XF4A 4XNXH 2BSTB 3EHBC 5E8PA 2R0WH 4HIXL 5D1QD 1FV1B 1D9KC 4S0SD 1XR9B 3PWPD 3RL2A 5EORL 5TH2B 3WKML 1A1MA 4OZFG 4NKIH 4RDQG 3RNQA 2W0FB 3BDYL 3O45A 4Q2ZA 5GRXG 4XTRD 5DK0B 3SE4A 3QUXB 1WBYB 1HK6A 2VXTH 4U7MA 5ILTL 4U7KA 3RIFK 2V7HA 4WUUB 1ZOXA 1V3MA 3E1F1 3BHBB 1ZWIA 3MBEB 4H20L 4X6EB 2ICWI 2HVJA 2AV7A 1BQLH 4OCWH 4NFBA 3L5XH 4ZPVB 4PJCE 3VFUA 4V1DE 3SCMD 4DGVH 2F54E 3ILPA 2OI9B 5CINH 1WZ1L 4V1DD 2F54D 4A2MA 3IGAA 5JIKA 1YQVL 1MSPA 1Q1JL 2IMMA 2W9EL 3BPNB 1CLOL 3IDGB 4WNQB 1A7PH 5CLTA 4HWEH 5HYSG 3CD4A 4LP4A 5FXCH 1F97A 1DE4A 1JN6B 3EYQD 4FQJL 2CLVB 4I3RH 1T7VA 3HRZA 5TF1L 4J3UA 2VABB 4GBXB 3CC5B 1VGEL 4JO3H 2H8PA 3H42H 3WEXA 4Y4KC 1NKRA 4ODVH 3CVHA 4MXWH 5CEZL 1YA5A 3SGJA 3NFNA 2FR4B 4EBQL 1ZGLB 4ZQKA 4BKLB 3B8YA 1H8NA 4LGSB 4M5YL 3WFCL 1S5HA 4PRIE 4OI7A 4S1DD 4KJYB 3MV7B 5IOPA 5I66A 3MRIB 2E27H 2BY0A 4N1HB 1CD1B 5DYOA 2YPVH 4PRID 1H3PH 1IC5H 3QEUA 2DLIA 1FZMB 1Z9OA 1A1NB 1C5CL 4TULL 2G60H 1N64L 4R4ND 1W0YT 1UWGH 3RZCA 4NQVB 3UO1L 3VXTA 3QI9A 2W65B 3CVHH 4G8GE 4XCEA 4JFDE 4IRJC 5DD3L 1L8JA 1A6TA 1D5ZA 1QFWL 4LCCB 5F89A 1GGUA 3PL6A 4G8GD 3UJJH 4JFDD 3PV6A 4EZMA 5CZXC 1LNUB 4I0CC 2VQ1B 4R26H 1KLFA 5C0CA 5HHNB 4NQEB 5HY9A 2CR6A 2J1KA 4NC1E 5CFHA 2I5YL 2YPLA 2DD8L 3MRHB 1DDHA 2X4TB 4GG8A 4ONFH 3VMPA 4HWZB 4P9HL 4JKLA 4JM4L 3ZZ1A 3REVA 3LKNA 4L9DA 4KHXL 3FOLB 4PRDB 5B4MD 1OP3K 1J5OH 5E4EC 1GGCL 2XACC 3LD8B 3MQIA 2VO5A 1A6UL 4HMDA 3DYPA 4L5FH 1NCNA 1RULL 1UACL 4UNUA 1GZQA 1A2YA 3RHWK 4MZ3A 4KXZH 1YNKL 1UB6A 2W91A 1BAFL 1X6LA 3TV3H 3V0AC 5C3TA 3V4VH 4KI5C 1B2WL 1U58B 4G9DB 3LRHA 4Z76B 3T3PF 4HWBA 2Q6WB 1GAFL 3ALXA 3OF6D 3MA7A 3PWVA 3U79A 3W82A 5JHDD 1YPZF 1IBGL 1XFPA 3IDMA 3QUMA 2SEBA 1HQRA 1U8NB 1T80A 2J8UB 4XI5D 1SYSB 2M2DA 2CPCA 1B0RA 2YSSA 4AYFA 3BZEB 2NY2B 4LLQA 3RX7A 2G2RB 2EDNA 3MACL 2B4CC 5GRUL 3V95A 4OIIL 3GO1L 5E00B 1JI1A 1A7QH 3PP3K 1TENA 3MV9E 1KTDB 4M8VA 1IGML 5JDSA 4PJBE 2OXGA 3P77B 1JGDA 1P7QD 3MV9D 4PIRF 1SEQL 3M8OH 5I75C 5F72S 4GUPA 4JFFE 1SJXA 3F7VB 3D2UA 1CDJA 3G5YA 3ZDZE 4QXTA 4WCYH 1Z0NA 4JFFD 4UV4L 1FN4A 3BP5A 4QRRE 5I1GH 3LCYA 3MRBA 1BFOA 2E7CA 2Z4QA 3CGTA 4JB9H 5DDHA 4X5WA 1MF2L 4QRRD 4NZRH 2DWDB 1JHLL 1URLA 3C60D 4JQIL 4JHBA 5CD3B 3L3DB 3CLEH 4NN5B 1A7OL 3GJFK 3U1SH 4PRHA 1WWCA 3M17B 3WLWD 1UA6L 4ZODA 1U3HC 3QAZC 3HG1E 4G5ZL 2K1MA 5C6TL 4H88L 1TJIH 4FQ2L 2IC2A 4ELMF 3MRFB 3HG1D 5GJSH 1NFDE 3VE0A 1W8OA 4ODBD 4Y4HD 2VLRB 1JNLH 4NO5B 1GSMA 1RJYB 2PYFB 5EU7E 1QYGH 1L7TL 2DKUA 1TJHH 4ZNEE 3QRGH 2I60H 1GGBL 4MNGB 5IGXH 2FX9H 4LCUB 3ARGC 1YYLL 5F1IB 4RAUB 1J8HD 2KUTA 3WJLA 5CEYA 2ITDA 1AQKH 3TBYB 4XNUH 5I15H 1RUPH 4JRYD 4DQOH 2FBOJ 5IB1A 1ZHNB 1RVFL 5ITBL 2Y36L 2VZSA 3H7LA 2DDQL 1NFKA 5IT2H 3HPLB 1INDH 3JTSB 3QIBC 5HDBE 4OI9A 1BIIA 1CGXA 5BMFH 1T20A 2XG4A 3QIWB 1YEGH 3TO2A 4LBEB 4GMSH 3V8OA 1H3GA 4X7TA 4DW2L 3EJYD 1ZANL 1R5WA 4PPTA 1A6VL 1IJ9A 3N06B 5BVPL 3PNWB 4WDIA 1KLGB 3QUZC 4QRSB 5KVDL 5DO2D 1R0AH 3O6ML 5HGAB 5T1MA 3H6JA 2DL9A 2OSLA 3EYFB 3HE6A 5TQ2L 1VACA 3QDMD 3VXNB 2VZOA 1RQ5A 1NH6A 3PWUA 3MLTA 3D87B 4KJPC 4KI1A 1U0QA 1H15A 3LS5L 1QR1A 4NRYA 5ESAA 3FO1B 3HZKA 3QDJB 4JHAL 4ZTPH 2A6KB 4PLJD 4JJHA 4OZGE 2DQCL 1M71A 4ZFFB 3OXSB 4X7CC 3KJ4C 1S9YA 5HHOB 3O11B 4JN2A 2JIXD 3U83A 2X4PB 5DHYA 3LDBC 4J4PA 3WJJC 5I1IL 4O4YH 1UH3A 2IF7A 2EEBA 4JDZB 4NQTA 5A43C 1ZA6B 5IUSA 1OAXH 4IMLA 4NC0B 1KJ3L 2R4RH 2QQKH 5GHWH 4EDWH 4QY8A 3LEXA 1BZ7B 3MNVA 3TVMB 3VG9B 5L88L 5J1TC 4LNRB 4I1NB 4N9GB 4Z7VF 4L8BA 5HHMA 1G7QA 2WBJA 5IHUH 2BRQA 2Y5TB 3HS0B 5GGQL 3ARFB 2C1OB 1ND0A 2P5WB 1KCSH 1JZ6A 4J6RL 2D7NA 4KUZH 5C09A 1A0QL 2Z91A 1UWEL 3BSZL 1ZLUH 1FCGA 3JZ7A 4GS7C 2VITA 1U6AH 1JP5A 2ZJSL 2JJTC 4MCZA 1BVKA 2EXYD 5TDPA 3FKUS 3AS0A 4PJGF 2APVA 3RL1B 1CL7H 3A0OA 5ICZA 2IFGA 2OQJB 2HFGL 5EO0A 1RK0B 4ZSOA 4YXKH 3TF7C 2UZIL 1Q9LB 1U8PB 4UIMA 4HKJB 2P24A 1MCIA 4N5EC 5SWZE 1DFBL 3QBTB 4XC1H 2NY1D 2Y06H 3VJ6B 3UPRB 4BH7A 4JAMA 5HSFA 4DEPC 4P4RB 2LQRA 2COQA 4KKLC 5EOTA 3JBG7 4ETQB 2WWKO 2W0KA 1IC1A 4G6JL 3QUKA 5D96B 5CJQH 4LSPH 2Q7NA 1JWMA 2ITCB 1X4ZA 5E7BA 1KG0B 1HH9A 1T5XB 1P6AB 4OZIB 3ULVF 5D2NE 4NRXB 1MHPL 5KTEH 3O6FA 3WE6B 4X4YA 5KSBA 3C6SB 5A3IC 3ZTJH 3KHQA 2VN4A 2H32H 1WBYA 4MNHB 1MCWW 2FGZA 3VRIB 4WI6A 4PD4J 1YEKH 5JW4N 3OR7B 1F45A 5C0ND 3I3BA 4P5TC 3AFLA 2VDRL 2PYEB 4KK5D 2R4SL 1GGTA 5TGBA 4GQPH 1DVFD 2E6QA 5J57B 5JXEA 3TH3T 3DV4A 3QEGH 4FTVB 3LKPA 5CWSA 3T4YB 3KYKH 3UYRH 3GBNH 1CDHA 4KQ4H 4M61B 2C4FT 3ARWA 2D2OA 5FDWA 3CDCA 5IVNA 2IAMC 1G7LB 3NFPB 4P0DA 5IEKA 1HHIB 1A6PA 2PW1A 4FQHA 1DQLL 2DKSA 2OCFD 4OD1H 4D2NA 3BXNA 4PP8C 4R90L 4ZTOL 4K55A 5I1AA 4C4KT 4UNTA 5CP7A 3TT3H 5EUOA 4PJEA 2BOBA 4OLUL 3CSBA 1FVDB 4KXZI 1T2QH 1FAIH 1Q0YL 8CGTA 1DBJL 1T1ZB 1PGRB 2YD1A 1Q9KB 3GSNA 1MRDL 3C6LA 5F7MC 1MIMH 4HS8H 3U36B 2J5LC 1NUGA 4RCAA 5GGVY 4PUBH 3C09B 2GCYA 1YN6A 5CEXB 1IGTB 1NAKH 2A0LD 3BT2H 2AJZB 5DMYA 1A1OB 4R0LA 4X4MA 1PDKA 1KENH 4J3XA 1MWAL 3HI1A 2IH3B 5I1CL 1QPXA 2YK1L 3LRSA 4NT6A 4PJFA 1MIEL 1NC4A 4DGYL 2BSSA 2JJSC 3O8XD 5CBAA 4FZEL 2OK0H 5ACLA 1F58H 2YS4A 4XHQA 2BXZA 4JG1L 3D0LA 4C56A 3QPQC 2EE9A 5AG9A 4YDJA 3LV3B 4HZAA 1BFVH 3AAZA 4XH2A 5LAXB 2DMBA 3V0VA 1MQ8A 1PBYA 1LEGA 1TQBC 1NCBH 1CU4H 3L95B 4XWGL 2V2XB 3SGKA 4PJ9B 4K3EL 5EBWB 2FIRT 3S4SA 1ZT4B 5D1XD 4OV5A 4N8PA 1CWVA 1BJMA 3HB3C 2FECL 4UDTB 5FKAB 1MNUH 3LEYH 4WTWA 4OB5H 5CIPB 4RISL 3ESUF 5CJ8A 5DD1L 4WO4C 4P9HC 2N7BA 4LL9A 1HE7A 1FNGB 1ORQB 1OCWH 4P5MA 3RWHA 1LO5B 1B4JH 1MUJB 5D7IF 4RMTA 4EOWL 3NIDF 5EUKA 1AGEA 3Q6FA 3VGDA 1KTKE 1XZ0A 4JFOB 3BW9B 2RR3A 4ETYA 4OGXH 2AGJL 4U6TA 3EOBA 3K8MA 3KPRA 2Z8SA 2VZVA 2R2CA 1U95B 4M1GL 3HE7B 5KJRL 1NBVH 5IW1A 2Z31D 3QQ4B 4JM2A 1WAAE 5CZXD 1I1AD 3FOMA 4YDLC 4UTBL 2QL1A 4R97C 3MZTA 4L9LA 2PCPA 2HN7A 2VC2H 1VCAA 4RGNC 4O2EA 4BJLA 1LO0H 4KY1L 4JO2H 1DEEA 1UH4A 1KB5H 3GKWL 4QRTB 4F7TB 5C0BA 3S96A 1RURL 5J6GA 1YYMH 3OQ3B 1V5JA 3O3AA 1QACA 2OZ4L 2W9DH 1IGIL 1NLBH 2Y7QB 2X70A 3MRDA 3ULSB 3FO9B 1SVCP 3KGRA 5DJ0B 2A6DA 5IJVB 2P42B 5AEAA 3ARUA 2X4NA 4OGZA 4WJ5B 1XF3B 4JZOB 4K3JL 3IU3A 4M93B 2Z8VC 5FCUH 2A1WH 4MXQA 4KI5E 4Q9RL 5C8JA 5DVMA 2ZNXA 25C8L 4LPVA 3T2NL 4LCIH 4YHOH 3CX5J 5C0IA 5FO7B 4KI5D 3HMWL 1VENA 5DC4B 4DGIH 2IANB 4UIKL 1W8NA 1MAML 1YPZB 1KN2L 5E8DL 3M17A 5T1DL 3RZWA 1CI5A 2DQFA 1XGRB 4XVJH 3LEVH 5EIVA 4PJIE 5K9OA 3HPJB 3MLXL 4FXKB 4YWGH 4XP5H 1NCDH 1YNLL 1PKQE 3KG5A 4RBPH 1X5JA 3NZHH 4LVEA 5HVGB 3MLUL 1YEIH 3WHE0 5I76A 3UZQA 4NUJA 2H6PA 3GM0A 4PTTA 2GJ6A 5TE4H 3BZ4B 4PLKD 3EKCA 5IBTH 2C3GA 2M8XA 4XT1C 2ICWJ 3G6DH 2E6JA 3RTQB 4X7DC 4MQSB 3OB0K 2DF3A 3CFBA 4OCMC 4PJHE 4JKWA 1BD2B 2DRUA 3S7GA 3H3PL 1JHTB 1TZHB 3BOVA 5B3NA 3EDJA 4ZXBC 5MI0B 1TTGA 4KUCF 3WDIA 2IBZX 3J8F7 3TA3A 2GTWA 2NY4C 1FLTX 2AK1H 3BP4B 5FYJE 4E42A 1RUKL 3UC0L 3H7BB 5HYJE 3P4NA 4FFWC 2HVKB 5BOPA 5M7QA 3TPUE 5FYJD 4K7PH 5ICXB 4M6ML 4AMKH 1AR2A 4TSCH 4F2MA 5JOFA 2MKLC 3BIKB 1N6QH 3D85B 2DWEA 1U3HD 1WISA 4ODWB 5EBLA 1PD6A 5E6IB 1KC5L 4ELMB 2J6EH 4LRIA 3MGOA 1S9XA 1CL7I 2AJSL 4JKPH 1J0HA 2N1KA 4D8PA 2F8OA 3MRJA 3I6GB 3FONB 3OKLA 3GMPB 4UAOC 3VFTB 4B7IA 4Z7NE 1BZ9A 3N1FC 1MCOL 3ZE1E 2R69L 1CICA 1ZEAL 2HRPL 5J1AA 4OAWB 1C1EH 3QCVL 4CVZA 4WEBH 3T09A 4YXLH 3D6GA 1CLCA 4L4TE 4BZYA 2Q7YA 3BAEH 3DXAB 3RIFF 3P2TA 1SMOA 2VZTA 4QEGA 4M1DH 1JCKA 2HTKC 2W59A 2WAHA 4DVRL 3LKQB 4APQB 5DJAB 1T1WA 1NFIA 4X98A 1MCRA 5DMJB 12E8H 2QSQA 1OARH 5DK3A 3SDCD 3QULB 3CVIH 2E7MA 4FP8L 1LP9F 1ZS8B 5CGYD 4QHUB 3VD5A 4CL7A 4EDXB 5IMLA 3P40A 3JV6B 3DX7A 2CRYA 3LIZL 4CNIB 2B8OT 2AI0L 5FGCE 3P30H 3C08H 4PJAA 4HHAA 4XCYB 5E8NB 2QKIA 4TUKL 3QCUL 3ARDB 4KJPD 3DIFB 5DMGC 1JWUB 1OTUC 5EN2A 1F4WH 1S7QA 3RNKA 5LVEA 2LABA 4L29A 2WWMC 3V5KA 1K6QH 5AUMB 1EFQA 4X9IA 5DR5L 2QQNL 1WC7A 2P46B 1WT5A 4G8IA 5I1KL 4MJ5B 1YN7A 2X4QA 5EFIB 1ZLSL 1HQ4A 4Y2DC 1QSEE 3QUYA 3U0TB 2NY7H 2F58L 4JGUA 1PG7W 3BN9C 2NY3D 4W4OC 4PGEA 3ZTNH 1QSED 5C08B 5T5NF 4QXGH 4MDIA 2ZKHL 3D18B 4O2FA 1HZHH 4PP2B 5CSBA 3X12B 1K8DA 3BH8B 1K4DA 2VH5H 3MOBH 3D0VA 4RFOL 5GGRA 4K94L 4KRPB 4YDIL 4LNVA 3KYNB 3RKDD 3T0AA 3H3KA 1OAKL 4KHTH 4YHKH 2ICES 5IBUB 5C2BL 3OPZH 3UTSE 2UUDH 4TVPL 1U8QB 1JZ5A 4GAJL 3OWEA 4I48B 3PHQB 1KJ2H 5CUSH 4ZOEA 3TZVA 3UTSD 3V6OE 4K7FA 1OAQL 4Y16C 4BK4A 3HUJE 4PJGB 1T1YB 4GKNA 5BS0E 1OF2A 4Q9CA 4LAQL 4I3GA 1N5AA 3QO1A 5BS0D 1HHKA 3BQUA 1FSKB 3QA3A 5HGDB 3MCKB 1NBZA 2DTML 2FX7H 2FZ3A 4OFDA 5FHAL 5JHLH 4KZEH 3HMXA 2A77H 1I8MA 5H35B 3UTTB 2NY5H 4LPYA 5A2LH 4C83B 1E6JL 1FORH 5ADPL 1IVLA 1PG7L 3QIUB 5BRZE 4S2SA 1ZT1B 2AKRB 2XG5A 3NIGE 5JPMB 2HH0H 1U8LA 5BRZD 3L1OL 2QBWA 4CU7A 3FHAA 4J3VA 4AM0A 4FABL 3TH2T 3WL9B 1RZJL 3JV5A 3VDAA 1Z3GH 4WUKL 4X6DF 4XB7A 3ULUL 5ETUB 2IADB 1O7SA 1X5AA 2CUIA 3GSRB 3WCYA 4L3EE 2R2EB 5K9KB 3EDDA 3CPLB 3DMMD 1FGVH 1F3JA 3IKCB 1W2KT 3HI6H 5IHZB 1BFSA 3HMXH 4L3ED 2O61A 1D5IL 3RDTD 1OB1A 4CU6A 1SBBA 2EYTB 4NNPL 1J0JA 2HJFB 4C55A 3B2UC 3OAUL 2AABL 1LO3L 4P2RB 4L8CA 1R3HB 5I1DA 3ROOA 2X4SA 3L6FA 2YPKB 5DT1L 4PJ5B 1P9MA 5GSRA 4M02A 3EO9H 3QHFL 2HKFH 3REWB 2N56A 1QA9B 4G9FB 5D5ME 1YMME 4OBSA 1EEZA 4W81A 2JJVA 2AJYL 2IJ0C 4LPUA 3MREB 3HLAB 3ERYA 1OGAE 3OKEB 1A7NL 1QBBA 1G7HB 1M7IA 4RZCB 5IB5B 5FUZH 4PJXE 1G9MH 4XNQB 1BQHB 4LFHG 5HGGS 1OGAD 4Y4FC 2GY5A 2VLKB 2BSRB 3GRWH 3N1QC 2AERT 5C0FA 5AD0A 4OGAC 4YPGB 4N8VB 3GSUB 1U3YA 3G6JA 5I6XB 2DMKA 3U7AA 4P23A 2CIKB 3CK0H 1ZV5A 2AQ3A 3LSOB 3QZWA 3P73B 1INEH 3FN0H 5TQ0H 2XFXA 4I5BA 3G9AB 5CEZE 1KPUA 1OAYL 1IAIL 4L4VB 5CP3H 4QOKE 5KSUA 5E9DA 1BBDL 3MYZA 4MSWB 1PEWA 3G5XB 2GSIA 3QH3B 4Q9QL 3TIDA 4XXCC 3V4UH 4Q97A 3TO4A 4WW2F 3WIHL 1NGYB 4XPTL 3GMMB 3VXMB 5DEFA 2JK5A 4NNYB 3RGVA 4EN3B 3D3VE 4Z9KB 3ES6B 3O6LH 4OSUL 2XA8H 1EEYB 1T66D 2GIYA 1R3IH 5BXFB 3QHTC 1MHHB 1U2CA 3D3VD 2D31B 1AIFA 1OAZH 2F53E 4QYOB 2CIIA 4PJ7B 4I0PD 1KPVB 3LKSB 5GGUA 5I2IB 1F3DH 3ULSA 3S35L 3TWCH 1E4WL 4M7KH 1QLRB 2QQLH 4BQCA 1MQKH 1BM3L 4TTDD 4J3SA 5DEGA 1DSFH 5F9OL 3HB3D 4HH9A 3IVKB 3CMOH 5JW4Q 4LKCA 3IJSB 5KS9E 1HI6B 1EUUA 4HBCL 1P4IH 4WO4D 1IKFL 1C16B 3DROB 5D7IB 4YHPB 5EDXA 4P46D 5L8LB 2CUHA 3L5WA 3ZDYE 3PQYA 3L3HB 4YE4H 1N0XH 4HEME 2HFFB 4XP4H 4XVSL 2VL5B 1BLNA 4WHTB 2E9IA 5E5UB 4XWOC 5JW3L 3I2CH 3PP4L 4N0YH 4U33A 1XGTA 4LLAA 3QO0B 1WBXA 4EI5C 5DRNA 2DLTA 3QFDA 4HH8A 4G43B 3HZMA 2H32B 3TLRA 4PJCF 4XVTH 5JZ7D 2VDML 2WV3A 3EIFA 5EIIA 4XVUC 2V2WB 3W2DL 3NABL 2CKBB 3U82B 4KZDH 5EBMA 3Q1SL 3T77B 3UBXI 3WHE1 5IBUG 1KPRB 2B2XH 3SDAA 1MCDA 4HUUB 5BQ7B 4MX7A 3WXVL 5DJ6A 1YECL 3LMJH 1AQDB 3U4BL 2AK4B 3NTCL 1UGNA 4ZFGL 3WO4B 5MEND 4NZDA 1YUHB 5HI4C 5T3ZE 3NA9H 2UWEF 1YY8A 4CDGC 2AEQH 3WD5L 1F6AB 2F5AL 4P2OC 4TNVK 3GGWA 5T3ZD 3X3FL 4U1LA 4IHOA 1WLHA 4J2XA 2HLAA 1J1OH 2Y6SC 3T3MF 3QB7C 1IM9A 4KH2A 4XCCL 1JRHL 4GMTL 5JORA 4LPXA 1XIWC 4ALAH 1FC2D 1XEDA 5LXGH 4L3CB 1GPOL 3QG6B 3UTPE 3MBXL 1NCAL 3M45A 4MD0B 3I6KA 4MNQA 4PY7B 1JMXA 2R23A 4POYA 4LLDB 3H9HA 3RX8A 4RMQA 4C57C 3VWJC 3UTPD 1FDLL 4LIQL 1GVIA 3GMPA 3BJ91 1RJZB 1CT8A 5F6HI 4WWKB 4PRPB 1T5WB 3RVVC 5CGMA 2VXUL 4OZGA 4XMKL 3NN8A 4HJGB 3B3IB 2FL5B 4AEHH 3QJHA 2JB6A 4DTGL 4GW1A 2CH8A 3CAFA 5E08L 3KS0H 4YHLL 3ARZA 3P3YA 2Z93A 1G9NL 2C3WA 5EU3B 2YBRB 1X5ZA 5T1LD 1Q38A 1FHGA 4PJDE 1KCGC 4G6AC 4F9PC 1S9WB 3NAAL 3FFCA 1MCJA 4Q6IC 5IF0B 3MGAA 3OJDB 4LEXL 1MRCH 2PTVA 15C8H 5D1ZA 5IEHB 5F7DB 1HXMA 1JJUA 4OCXH 3JWOL 1IM3B 3L7FB 1UZ8B 1IQWL 3OX8A 2ZSVA 4LSUL 1A6ZB 2OR8A 2P5EE 4KKBC 5IWLC 5DMKA 3SKNA 5BJTA 4NQDA 3SGEH 3O3BB 3H9YA 4N8VG 2EYSB 2P5ED 2ZUUA 4Y2OA 4U2ZA 3QP3A 3MLSH 4YPJA 1S3KL 1NDMB 2GJJA 2YN3A 1ZT7A 5INDA 4N0CC 5ENWB 1CQKA 1HIML 5DD6A 5I9QC 1NGPH 3P9MB 4DN3H 4RX4D 4U1SA 5D6CB 3VI3F 2DI8A 3QUML 4GH7B 1U8JB 2I25N 1MHEB 3T0EC 4ZPTA 3RWEA 4ZFZA 1D7FA 5DQJB 4OLEA 1AH1A 5EA0H 3RWJB 3P4MA 4Z7VA 3SJVE 3IDJB 5F44A 4YX2L 5F7EL 4K23L 4HUWB 4OLZL 3HZVA 4LQFL 3T4AB 1HXYB 5JPNB 1OL0A 2XOTA 3N85H 1KJVA 1IAOA 3SJVD 1DBML 4YGVB 1AGBB 1A4KB 1LP9B 3ARBC 1E6OH 3EO0A 4TOYH 2NXZB 3O2DH 1KB5B 4GRWF 4IIQB 3VXPB 1CVSC 2IPUK 3ZDZF 4Z7UE 5I19H 2QHRH 1I1YA 3IJHB 5KVGH 1MEXL 3TBTA 5CCKL 5KAQF 3F7YB 1XGYH 4NKMA 2BHZA 1TVHA 4K94C 5DMGD 2OM5A 3VXUA 1AXTH 5M95B 1V7NL 5C0JB 1UYWH 1JTOA 1S78D 2WWMD 3VGAC 4XBEL 3MRMA 1PLGH 2HYMA 3PDOB 4KTDH 5IW6B 3M1BA 2E3VA 4U6YB 4FZ8L 4I2XE 3OKKA 1J87A 3B2VL 4U1MB 4HUVB 1C5DA 1DN0A 3TN0A 2VLLA 5ICYB 4MVBC 4OM0L 4LDOB 2RFXA 4WUUD 5J1SC 1PY9A 4PJ8B 4XPGL 5IMOA 4FFYL 3IFLH 5E8EA 1D9KA 4BSVB 3BEVA 3SDDD 4U1KB 4Z0XB 5F88B 5ACMA 2GTZA 5ABDE 4XZUA 2IQAB 4HZLB 4LLVA 1N4XH 4WEUD 4DVBA 1CD0A 2G5BA 3MNZA 2Q8AL 2E7BA 1H5BC 2ICEB 2VDKL 4H8WL 4E5XB 3ZTJG 4QTHA 2GAZB 1DP0A 1I9IL 2WUCH 5D71L 1RZJC 2CK0L 4GQ9L 1MY7A 1LK2A 3MLVH 4POUB 3ZKQD 2X4RB 5IP4A 3QNZA 1DQQA 3DVFA 2MNUA 3ULUC 4WU7B 1FYTE 3JWDH 3H9SD 4P4KA 2HT4D 5BO1L 1D6EA 1FYTD 5DJDA 3RX5A 3UJIL 1W72A 1AGCB 1CBVH 3RI5F 1N7ML 3G08A 2QSCL 1MFCH 3KXFA 5I1HH 1L0XA 2BNQE 3V7AE 1QSFB 2J4WH 3W39A 3UROR 5MP6L 2ERJB 4F58L 5DTFB 1I1FA 2NR6C 3GI8L 4Z7QF 2VXVL 2X1QA 2GFBB 3S88H 4JANA 3TBSA 3U30C 4L8DB 1T6WA 2HFEB 4J8RA 4Y4KA 3CH1B 1UB5B 1W0VB 1NGXA 2AJXH 1FO0L 3GIVA 4QF1B 1MY5A 3O4LB 2EC9U 3EYSH 5B39B 1MH5A 4HCRA 4GRLC 1NMCB 5EPMA 1JGUH 4NP4H 5T1KA 1W72H 1EJOH 3DURB 4FQXB 2IFFL 4R3SA 3BVNA 5F7WC 5ERWA 3STZA 5KSAD 3BKJH 3DUUA 2PN5A 3UBXB 1HCFX 4R7DA 3C9NB 5KVEH 3B2UD 5D9SA 1F8TL 3RPIA 2DYPB 5C0AA 1AP2B 2J8HA 3C5JB 5JO5A 1F2QA 3LQAC 4IS6A 4UV7H 4X4XB 2ADIA 3T8XB 4IRJA 2FD6H 3RA7L 1NGWA 2PTTB 4FMFA 1TXKA 2R1WB 5HVFB 4B53A 1T3FA 3E8UL 1KCRL 2ZSWB 2EIDA 1MFAH 1WEJL 1AR1C 4XP9L 4OKVA 4Y4FD 4JY6A 3O3DB 2EEDA 1EFXD 4E9LA 4GJTB 5J89A 1NJ9B 3AROA 3PGCA 4U1HB 4OGAD 4P3CL 5DQ9B 4GXVH 3ETBF 3FRPG 3N9GH 4G8FB 2H3NB 2L7UA 4ZUVB 2FSEA 3QPXL 4N0UE 3EBAA 1CXKA 4NKDA 1QQDB 3W11C 2ZCKL 5JLZA 4G7VH 2R0KH 3W0WB 5GS1B 3I85A 1J9CT 5DUMH 5L2JB 5H37H 5FHBL 5FOBA 1S7TB 5ITFA 5HHXH 5E1AA 3VI4E 4P2CG 4JO1H 2WP3O 3SKOA 1K85A 4OLYH 3EYUH 5J13B 4JGMA 4U0RC 3FB7A 2R2BA 3VD7A 1KN4L 2DTSA 2VDPL 4WW2B 4KJWD 1EAPB 1ACYH 4J1UA 5HI5C 2WK2A 5E03A 1SYVA 1JPSH 4F8QA 4H0HB 5I71B 3TBVA 3EW3B 1TLKA 5AZEL 3S4SG 1S7VA 4JFHE 4LDEB 2PR4L 3HCVB 4OF8A 3NA4A 4YBLB 3VFPB 3CCHA 3CFEB 1E4XL 1JNHA 2ZUYA 4X0KB 4JFHD 4Y1AE 5HHVH 1KJ2B 3IDXL 2X4OB 3B9KD 2OTUB 2W07A 3BIAX 2JCCE 2MQCA 1X5KA 4BH8B 3QDHA 3P0YH 4HX1B 4Y5XB 1SY6A 2WQ8A 5FYLE 4P3DA 5L9DH 1TCMA 3O9WB 1G7IB 4MWFA 4RWYL 4D0DA 1YEEH 2Q86B 1FFRA 3KPNA 4H25B 5FYLD 4D0BA 1P84J 4POZC 2FJHB 1JUFB 1M05A 5D1QB 4Y19B 3PWPB 4U6XB 3PHSA 2PO6D 4GSDH 4R8WH 5I0ZA 4IMKC 3TJHA 4AL8L 5KOVC 3OAYH 4M9OA 5I17B 5A2JH 3AB0B 2B4CH 4GAYB 5ISZE 3FT2B 3HNVH 4GW4A 2NZIA 1IEBA 5EOCJ 3WNOA 5ISZD 5J11B 4QHLB 1B0GA 3VFWA 3SCMB 5SX5K 2ZG2A 3GMLA 3CH8A 4F7PA 4ELKA 3SGEI 4KDTC 4PJCB 4QRQA 4IRSD 4V1DB 4UT7L 2MCPH 2F54B 5EOCL 1UCBH 3RWIB 4H5SB 1HSBB 2HP4A 4X8JA 2G9HB 2IGFH 1UJ3B 3ARGA 5ID1A 2XICA 3FZUD 3Q3GB 5FM5M 1ZK9A 3GSVA 5D72L 3CSYA 4M6OH 3CLFH 2FEEL 5GJTH 5C0RL 5CJXC 4AG4L 5DJZB 2EDWA 1XGPA 4IJ3C 5DRWA 5FYJH 1FZJA 4XX1G 2Q8BL 3MTRA 1EXUB 4XPBL 3D39E 3I75B 2XZAH 5GPRA 1WBZB 5AYUH 3GSWB 3QIBA 4Y88A 3VH8A 2ID5A 3LZFH 3OG6B 3RZCC 4OZ4B 3D39D 1RZ7L 1BOGA 3QEQE 5D7JA 3FQXB 5D2LF 3MODH 3HR6A 1GZPB 2NQCA 4PRIB 5JUEL 2VAAA 1G84A 2WIIA 1DBKH 5FKPA 3V52L 3L3OA 4U1JB 3EOTL 1R3LB 4R96A 3A6CH 2H2SC 1MCSA 3DRQB 4DN4L 1G9NC 5IMKB 1MREL 5LBSL 1B0WA 2FWOB 5EWIH 1P7HL 3VWKC 2DQEL 2FYYA 2WNGA 43C9B 4HXAL 5HDQH 4MXVF 3TIEA 4HFUH 1I7ZB 1X5GA 1ULVA 3V6BR 1BVLB 2VAJA 2CXKA 1YJDH 1DQTA 4G8GB 3UEZA 4JFDB 5DJCB 5B39G 2E8ZA 1QD0A 3PJSA 4UU9B 3F12A 3GI9H 3BI9X 3RVVD 1OY3B 4OIAA 3FT4B 2EDEA 1EAJA 4M5ZH 5F6IB 3INUH 2Z8RA 2WSKA 4I18B 3JWOC 3CFJA 4OF7A 4LASH 4KGLA 2ENSA 3ARFD 1QPPA 1QLEL 2P5WD 3UBXG 3K46A 5IG7B 2D4DA 1ZLVH 3O2WH 2XWBB 3SE8L 3GHEL 1VSCA 4QWWD 3VXQB 5D7LA 4QO1A 1CGSL 3E6FB 1P84K 4K8RD 4D9QE 1AXIB 1PX4A 4G6AD 2BVPB 5DVKA 4JZJB 2NMSA 3MJ9L 2DQUL 1F90H 2AV1A 4OFYA 4WI4A 4ODTH 4D9QD 1Q9WA 1T0PB 3NVQA 4OBRA 1LQSR 4LLWA 1M7DB 3X3GH 2E7LE 1LEKB 2X89D 3GMQA 4YAQB 3VFMA 2D7OA 1J12A 1KT2A 2IALB 4HKXA 3FQUB 4NJ9L 2CDGB 3RWFA 4OLVH 3BX7C 4MD4A 3BKCL 4ODSH 4Z78B 4MQXD 4XPHL 5I8KL 3VXSE 2JJTA 2HG5A 2LFGA 3HUJA 5EO1A 2W92A 5JHDB 3VXOB 4O58L 1JV5A 1RIHH 4S11A 5F3HB 3ZKXB 2P8PB 5KVFL 4E41E 2NYYC 4OFPA 3TF7A 1D5MB 3BKYL 4GKSA 4FQCL 3FT3A 2D0HA 3KYMA 3T0EE 4XC3H 4E41D 4NFCA 2QR0A 3ET9F 3X14A 2BSED 4N5EA 4LSVH 4JFEE 4FXLA 1NUDA 1I9RL 3T0ED 2IQ9H 4QT5B 4YEFA 3NCFB 7FABL 2I27N 2XQBH 1T04A 3RUGF 4JFED 4XBPB 4YBQD 2GY7B 1GGIL 5HI3D 1RAMA 1P7QB 3MV9B 4R4BA 4PJBB 1TJGL 4U1NB 4R7NA 1N5YH 4GRWB 1UC6A 5C2UB 3ARBD 1T7WA 1KNOA 2BDNL 2ADFL 2ESVE 4JFFB 4CVXA 2YD2A 3HNSL 5LCVL 1T0NB 5J12C 4F33B 1JHKH 2DL2A 2ESVD 1CFNA 2EYRA 1JGLL 4M8QB 3MRGB 4YGAB 5E2TH 4QRRB 1A9EB 3C60B 5F1NB 4P5TA 2DM3A 2YMXL 3AXLA 4LVOC 5MERA 5SWSE 1VPOL 2BNRA 2X4UA 2K9UA 4ZS6C 1C12B 4ZAKD 1FJ1B 4XCNB 1KCUH 4PS4H 3GSXB 1PQZB 1EGJL 4UQ2B 3HG1B 1LDPH 4H8WC 5DRXB 1NANH 4Y4HB 1JIBA 1NFDB 2E9WA 3SN6N 5D5MA 4DZ8B 3ZKMC 4ORZC 2F9BT 4I9WE 2IAMA 3PABA 3LY6A 1DUYA 1ZVSB 4FOMA 4NCDA 3ZE1F 4JRYB 4X6DA 3SDXE 2DJ4A 4K2UL 4HIXH 2PW2B 1CFQA 4NO2A 5EORH 7CGTA 1OP3H 4KQ3L 4PGCB 4HIIA 3QXAB 1UWXH 3E2HA 3EYVB 3JXAA 4A6YH 3D25A 5F9JA 2GK2A 3VDCA 3U9UA 5H8DA 1U8KB 3G04B 5EU5B 4FG6D 5F96H 1NBYA 4PGDA 5ILTH 1PZ5B 5BV7B 4NO0A 2BY3A 4LLMB 1SVZA 3LPGA 4H20H 2IH1B 3C5SB 3FO2B 3GSQB 5IB2A 3A67H 1SBSL 4H1LB 2VERN 5MEOA 3QDMB 5JIHA 4W70A 2P4AB 2OR7A 1OTTC 1HYSC 2MPAH 1B4RA 4TSAL 1IE5A 4GG6F 3P11L 4F57L 1ES0A 4X6CA 3WO3B 1VERA 2BXYA 4TQEL 5KSVA 1OGTB 3MV8E 4LHUD 4L8SB 2JJSA 5CKAA 4XNZB 3P4OA 4PLNC 5TF1H 1Q72H 5JMOC 3O3EA 3MV8D 2JIXB 2YRPA 1JWSB 2HWZL 2R1XA 3VFSA 5DUBB 4F80A 5CEZH 1JL8A 4BSWB 3GJFA 1P4LB 2P8MA 3BEWB 5L2KA 4I0KA 1IAMA 3MSPA 4TYUA 2EDKA 5FUCC 1FLRL 3GMNB 3WMSA 2XTJE 4PB9L 2Q76B 1TTFA 4FS0A 3DTXB 5DD5L 1GHFH 1CTNA 4YUEH 2GJZA 3PHOA 1KEGH 2XTJD 2B0SL 3ROLA 1FFOA 4TULH 4ONGL 2APWA 2XKNB 2XYCA 3W5MA 1U36A 2X2YA 4GXUN 2DQGL 2AXFA 2O5YH 3D9AL 1UM5H 5DMIH 4MA1B 3GIZH 3BKML 2D0FA 4QCIB 2LAAA 1FZOA 4ZO9A 4KJQD 5I1LA 3MLZH 3FQNB 3E6HA 3GJFH 5BVJA 1BQUA 2ADJB 4NYLA 1GJIA 1KB9J 1WICA 5TE7L 4Z77A 1QRNA 3MROB 2I5YH 2VLJE 2DD8H 3CFDA 1KXQE 2CDEA 2OJEA 4ORGB 4P9HH 3KPPA 4JM4H 2VLJD 3O41B 4M48L 1ED3B 3T08A 2BJMH 1CR9L 4KHXH 2OTUA 2NY1B 4YIQA 3BGAA 4KFZC 3GHBL 3EJZC 3U4AA 3QUXC 1GGCH 2X9WA 3MJ6A 3UTQB 1A6UH 4MCYA 3FMGH 1JF1A 4Z5RB 1RULH 5HDOA 3ZYZA 4NIKB 3MBEC 3GKZA 3BD5A 3W11D 3FQRA 5CHNB 2AEPL 2BVUA 2ZUTA 5B3JE 5MEQA 1ZVHA 4JRXA 3TM6A 1UEYA 1C08B 3FFDB 3HNTL 5D2NB 2UYLB 2HKHL 3TESA 1LILA 1X7QA 3BPNC 4UQ3B 4WI8A 3UAJD 2Z92B 4HUXB 5HI5D 2YD8A 2AJVL 3KLDA 4WI9A 2HT2C 1IBGH 4M1CC 4GBXC 4ZUUB 4JFYA 2X7LA 1Q0XH 4LMQI 5GGSB 2VZUA 1YMHB 5C0EA 1NDGA 1TPXC 3AC0A 2R56L 3MACH 2DJSA 3DSFL 3U2SB 3FB6B 5I30H 3GO1H 9CGTA 3CDFA 3DRTB 4LFHD 2R0LL 4MDJB 2R2HA 4ZUSB 3F5WB 1WV7T 5F71A 4DKEH 1J1XL 3WHXA 1WIUA 4NKQB 3PDGA 1FNLA 4W6YB 4POZD 4M4PA 5LGJA 2C7UB 1A21A 1CD9B 1H0DA 4ERSH 2UWEA 5AYQA 1DLFH 1RZ8B 4UV4H 4ZXBA 5IFAL 1EHAA 3VRLF 4HAGA 4KMLB 2Y5EA 4NKOA 1I7UA 4X6BB 3UTZA 2C4FU 2P7TA 4JFPA 1JHLH 5J6HA 3KLAA 1MLBA 3DI2B 3IF1B 5DEZA 1A7OH 5ANMA 5F9WB 1UA6H 2XWJA 3TJEH 1QHPA 4G5ZH 4N5UA 1NMAL 1QKZL 4AEIL 1HHGA 4H88H 1ETZA 4FQ2H 5FO8B 1F3DJ 3KPMA 3Q5OA 1IEAA 1ROWA 4E0RA 4HIEB 4RAVA 2L7JA 1RFDH 1BX2A 4JPIA 1F11A 3KWWB 3O8XB 2EDTA 4YQXH 5DJYB 3PG2A 1ZHLA 1U8IB 5LQBL 3BO8A 1FE8L 5F8QC 1WQVT 1DQJA 2VXSL 1RVFH 1Q94A 2ZNWA 5EU6A 1AO7A 4M7LL 4NFDA 5A2KH 5B8CB 4NUGL 5C9KA 4PR5B 2A74A 4I13B 1PZUB 2VWEE 4U4BA 5D1XB 2IBBA 3VFOA 1HHJB 3QI9D 1XCTB 1CIDA 5F7UA 4LSQL 4R4FL 1U8HB 1ZANH 5C0CE 4PY8J 1OW0A 1RHFA 3PL6D 1J05B 2XZQL 3V5DA 5BVPH 2YPLE 4NDMA 1FG2A 3EFFB 5C0CD 3U0PB 3IFPA 4HSQA 3O6MH 6FABL 2YPLD 3LN5A 4XNMB 5TQ2H 2NY2C 3MPCA 4I77L 3D69B 4JGJA 4KAQL 4LF3A 1K2DB 1SJHA 5BZWA 4ODXB 1UG9A 5DFTA 4XHJD 1CFTB 1ZGLP 2DLGA 3LS5H 4FFZL 4CJ1A 3BRGC 2Z31B 2DI7A 4CUCA 3OHXB 1N2RB 1QEWA 1N8ZA 3ZO0A 2DQCH 4W6WB 3OTTA 1NANI 3DX9B 1FL5B 1VFUA 1I1AB 3AS2A 1LE5B 4YO0A 1HCVA 4I3SL 4KDWA 1OAUL 1OWRM 2FBJL 1NAMB 4PV9A 4KK6D 4U3XA 5I1IH 2DM7A 1GOFA 5EZOH 4Y2DA 1I1RA 4HIJB 4F7CA 4NKIL 4AQOA 1RU9H 1K4CB 1UKSA 1FBIL 2QADD 2NTFA 4OD2A 3MXVH 3MGTA 3NZ8A 3W9EA 1BJ1H 4AENA 5L88H 1IZKA 1SMAA 1HNFA 4NN5C 1QHOA 2ZWLT 3WIIH 2EO9A 3CX2A 3B5HA 4MAYA 2E5EA 4AEFA 4OCWL 4GAGL 3LHPH 1DLHA 4HS3A 4RGOL 2HAZA 2N7AA 3RWCB 4RA3A 3GNML 3BSZH 3B8SA 4WGVB 4DZBA 1BQSA 5HHQA 1G9EA 3R0MA 5F97E 1P7KA 1JNNL 5M94B 2ZJSH 4Y16A 4C58B 4LLUA 4P5KB 1A7PL 3RVTC 1UT9A 4G3YH 1H9VA 1G7MA 1U8MA 1J0YA 5A1AA 5J9PA 5KN5B 1A9BB 2UZIH 1H3VA 3TP4A 5HJ3A 1E28A 1KCVL 3CZJA 3H3BC 1A6AA 5FCSH 5IIEA 3D2UD 4PJIB 5C7XL 4JFQA 2EDJA 4KKAD 2OS7A 2NY6D 3W9DB 1XCQB 1PKQB 3TA3C 3QIWC 3L3GB 1J8HA 2E27L 5DHVB 1VFAB 1LEIB 4MJ6A 2YPVL 4G6JH 5CLWA 2GKIA 4PRHE 1MJJB 4QRUA 3X13A 4PRHD 1MHPH 2G60L 3HC0A 1S7UA 1IGJA 4PJHB 2WINB 5LWYL 1TITA 2BVYA 3KPQA 4X6FB 5GS0L 3IU4L 2AJUL 4QHNB 4NHUA 3R0NA 1RHHB 1K3ZA 4Z7WF 3UJJL 4NQXA 1N3NA 4R26L 5HYJB 2XWTB 5I74B 1D5BA 1U3HB 3QAZB 3TPUB 3FN9A 5H2BA 2ZOLA 2EKSA 4HJ0D 4LCWA 3U7WH 2NW2A 4NZJA 4OCRH 4ONFL 1FVEA 3S97C 1V3KA 4MJ4A 1CE6A 3C8DA 1B3JA 2YA1A 4HFWA 1HKLL 1TCRB 3JVGC 4OI8A 4MMZC 4P2QA 5SWQA 1MFDH 3KDMB 3VD3A 1J5OL 2Z0BA 3ISWA 3TVMC 4U1GB 5JDJA 1RJCA 1UENA 1DQLH 4YHIA 3WLBB 1FNEB 3ILQC 1Y0LB 1CIUA 4ZTOH 4PRNB 4LLYA 4TUOA 3VFVA 5FK9A 4DK6A 4RWHA 3G5VB 1MWAA 2FO4A 2OL3B 3V6ZA 3MR9B 3P9LA 3TV3L 4L4TB 2BOCB 2C3HA 1TIUA 3V4VL 3HE6D 5DJ8A 1KJMA 4YBHA 3UJTL 1ONQA 3GUTA 1Q0YH 5EU4A 4XP1H 3RRQA 3SDCB 1MRDH 3GMRA 1DBBH 2G75B 5E8OA 5GIRB 3CNKA 3WIFA 3QUZB 3OJVC 4NQCA 3DPBA 3UDWC 2APXA 3MYJA 3RWGA 4J4PD 3KNBA 3MLWL 4GG6B 1JFMA 3PV7A 5I1CH 2XN9A 3PWLB 5FGCB 1O0VA 1JYNA 4O5LH 3UPCA 3LQZB 4DGYH 5IK3A 2CR3A 4FZEH 4LSTH 4JG1H 5D96C 4YR6B 4CADA 5HHME 4RIRA 4C4KO 3KJ4B 5IVXA 1UXSB 1U8OA 5I8EB 5HHMD 2WBJD 2GSGA 2GYSA 5C09E 4WCYL 4XWGH 2FIKA 2HRLA 2VISB 3FCTB 3L3IA 3VXRA 5C09D 2EIZA 1QSEB 5INCA 3U46A 3TZVC 1AD9A 4JB9L 3TYFA 2VDQL 3Q2CA 1QO3A 3G5ZB 3ZL4H 4MA3B 3OB0H 1LE9B 4RISH 2R1YB 1JPFA 3GB7A 4LPTA 3T65B 4P57B 3CLEL 1JI2A 3LVEA 3MUGB 4ZSOE 2Z35B 2BCKB 3QJFB 2IG2L 1KXTB 4K9EL 2EE6A 3U9PH 4LRNH 4AIZB 1K5NA 3MRPB 5IJKC 2OZ4A 5H37G 3IAGC 2GW5A 5TDNA 5I8CB 4NRZA 1U92A 5GJSL 1W0WB 1M1SA 2YWYA 4HK3N 1BPVA 2MMXA 3QWRA 3UTSB 1JNLL 2AGJH 2GITB 3DBXB 3WN5B 3BPOB 4G8EB 1HEZB 5KJRH 3WFHB 4M1GH 5K9QI 1TJHL 3MJ8B 5ADOL 2I60L 4WGWB 5ESQA 4NM4H 4EI5A 1DVFA 5BS0B 2IPKB 1H3UA 2JE8A 3KAAA 4UTBH 1C5BH 1N26A 1XH3A 2ZUSA 4DQOL 2YKLL 4X99A 1AY1L 2B5IC 1RURH 1K3IA 1WCBA 3O6FD 2ENYA 1INDL 1FAKT 1NEZB 2OZ4H 1IGIH 3EJZD 5F1OB 4NJAL 5BMFL 5BRZB 1JK8B 5IB4A 5E5RB 1CS6A 2YXMA 4EKXA 4IRZH 3DGGA 4GMSL 1TMCA 2Z8WC 1IQDB 5ESVA 1LD9B 5CD5D 1FL3A 1WZLA 3C09C 4QHMA 1U2HA 1E27A 2JJWA 4HC1H 3OKNA 4NQSA 3BP7A 2XTLA 4M3JA 3DMMB 4Q9RH 1FP5A 3QXDB 1NGQH 3QNYB 25C8H 1Y6KR 3T2NH 2K7PA 2FJFB 5JXED 3PXHA 4L3EB 1P9MC 4P2OA 3RDTB 5T3XL 4KROD 5F7LB 3GK8H 1GC1L 1S7SA 1ORSB 4HCRL 1RJLB 3LKRB 2KBGA 1KYOK 1MAMH 1J0KA 3BGMB 3GBMH 4ZTPL 3THML 3AREA 1XIWA 4QRPA 5T1DH 3TCLA 3HAEH 4P48A 3DSNA 1OSZA 5LGHH 1Z2KA 2BVOA 2MFNA 2OLDA 3RY5A 4KK8C 5DK2A 1DUZA 1CXIA 2Q3ZA 4A6YB 3MLXH 1WTLA 1XGQA 1JZ4A 2P43B 5CSZA 1KEML 1K9TA 1WFUA 2FEDC 5EUOE 5JTWA 4HPOL 4PJEE 1WSST 3S35X 3VWJA 1OAXL 1AHWB 5F93C 2R4RL 4RFEB 5GHWL 4G7YL 4CMMB 3QEHA 1OGAB 4YFDB 1QVOA 4HGWB 3MRCA 4LHQB 1YEHH 4NWUL 3C6LD 4PJXB 3TBWB 1UJTA 2OMNA 1I9EA 2NX5A 5GGVH 5B38B 4YHML 1R24B 2A73A 1OTSD 1KCSL 3PGDA 4X4ME 4JDVB 1KTLB 5D2LA 1FC1A 2CLZA 5DRZB 4BFEA 1U6AL 4PTUB 1RUKH 4PJFE 4F9PA 3HE7C 4Q6IA 1WF5A 5I73B 4C56E 4Y89A 1NC4D 5EC1B 5BZDA 2J5LB 2AJ3B 1A3RH 3DX6A 4RQQA 3BH9B 3CZFA 1KC5H 4C56D 2J8UF 4QOKB 3ECBB 3V6FB 2AJSH 1ZHBA 5IWLA 3IXTB 3I6LD 4V2CB 3VG0H 4AH2B 1MLCB 3DECA 3S37H 1VGKA 4BFIB 5K9JH 5HYQA 2R69H 3WFBL 1DZBA 4MS8C 4NNXB 4JKKA 1XR8A 3SY0A 2PETA 3PXJA 4K8RH 2ZG1A 4RAHA 3QCVH 3D3VB 4NC2B 1RZIB 4N0CA 1EO5A 2JLLA 4TSBL 2NXZD 1MPAH 3C5ZA 4M93C 4XMLH 2F53B 1TETH 4YK4B 3TNNB 3DETC 4JLRA 2VRAA 3WFEL 3KPRE 1HN1A 3DARA 3QWOA 1PX3A 2CKBL 3KPRD 1BEYH 1CYGA 4WO4B 2VIRB 2XPGA 4JM2D 4YHZL 1YEJH 3RJDA 1BGXL 1QBLL 1U91A 4P46B 5KS9B 1WVZA 1HSAB 1CLYL 4HKBB 3MRRA 2AI0H 5IQ9B 3FB5B 3QEGL 4WFED 2OJZH 1FFNA 1SQ2N 4ZO7A 3KYKL 5E94A 4TUKH 2BVQA 4O51B 3JV4A 5C0BD 1ZSDA 4HV8B 1R6VA 3CFKB 3C8HA 3FB8A 2HT3C 1RK1B 3VFRB 1CK0H 5LJYH 2MHAB 5LGKA 5ECJE 2ADGB 2VDLH 2XZCH 4MMXC 4OD1L 3RTQC 5DR5H 5DQDH 4YDLB 2QQNH 2NPLX 2V9RA 1A4JA 3GJEA 1OOAA 5EC2A 2X1XR 4PRAB 1N59A 1BFTA 4P99A 3ZSTA 3BRDA 3FL7A 4MXQD 2V5MA 3RUGA 3NCYP 3ZHDA 1EIBA 5H94B 4ZUWA 4MVBA 1T2QL 1FAIL 3HZYA 1MIML 4JY5H 4YDIH 4HS8L 5C70A 5MENB 2I9TB 1XGUB 4IOSD 4PUBL 5E6IC 4J3OC 4LEOA 1UQSB 2FRGP 5DVNA 4TVPH 2V2TA 3BT2L 4LCYB 4OLXH 2NNAA 3PGFL 4P59L 1H5BA 4PG9B 3QDGA 2J12B 1INQA 1HHHB 2AQ2A 1FG9C 2GJ6E 4NSKA 4OJFH 4OT1H 4K7PY 1NEZG 2OK0L 2GJ6D 1UXWB 1KBGH 3VDBA 4WWID 5T33L 2C3XA 1K8IB 3RVWD 4XCFH 1BFVL 5FHAH 4GKZA 43CAB 5GS0C 3CXDH 1GXEA 1E6JH 1IT9L 1I7TB 4G80B 4ZO8A 2D7TH 4WEMB 3FAWA 1HOCB 2N4IA 2WBWB 4APQC 3BESR 1G7PA 2HJKA 4FABH 4AIOA 4O2CA 4Q0XH 1MNUL 3LEYL 1ZHKA 4WUKH 3BWAA 1I8IB 1NSNL 1S8DB 4RNRB 4D0CB 3FO0L 3ULUH 2ARJA 1S9VA 1BVZA 3QQ3A 4GRLA 3U48A 4EI6A 3OL2A 1D6VL 3STLB 5E2WH 4G42A 5T1LB 5GGTL 3ARDC 1G6RB 1SEBA 2L4OA 1FFPA 3SOBL 3IETB 5J3HD 3B9VA 1CZ8L 4PJDB 1NBVL 1E0OB 1VFBA 3OAUH 5BCAA 5I18H 4NOFA 1CICD 3CUPA 2H1PH 2KZ1B 4BA8A 4IOFC 5DJXA 5HVHB 2VC2L 1M6OB 2V5RA 1RUQL 2VJXA 5DT1H 5GRYA 2P49B 3DO7B 4GG6A 3EYOB 3KPSA 5IV2A 1YYML 3OSKA 8FABB 2W9DL 2P5EB 4UAOB 4LSRL 1A7NH 3GMOA 1MOEA 2Y25A 2A9MH 4JZNA 4NM8H 2B39A 4YFLI 4KRPC 1LO2L 4NPYB 1Z6JT 1NGZA 3I3DA 3WV0A 4U1IA 3WIHA 1T22B 3KR3H 4LQ1A 5FCUL 2A1WL 4TUJA 3OKMA 4NZTL 3T0DA 4PJAE 3S36L 3LQAH 1G7JB 4LCIL 3RWDA 2BNUA 2C3VB 4MAUL 4O02H 2XNAB 2VDOH 1TNMA 5MEPB 1PSKL 1JGEB 2DM4A 1BF8A 3SJVB 1EBPA 5JNYB 1I4FA 1OAYH 3N1MC 4ENEC 2BC4A 1IAIH 4MB4A 3RQ3A 2GUOA 4F15B 3TFKC 3BPCB 3LEVL 1BBDH 4NO3B 1MI5A 5CMAB