4ZUSA

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zusA01
2RBLA 5E8EB 5DJ0A 1F4AA 5CGYC 1BFVL 4X6CB 5AUMA 4KTYA 1EHAA 2ED7A 1FL5B 4U1KA 3BEVA 4JFQB 3PXHA 2ORBL 4PJCB 1BAFL 2IH3A 1FLRL 4Z5RA 4CU6A 3K4DA 2D0GA 5TDPB 5SWSD 3RWJA 2VZVA 2AK4D 2LVEA 3O3BB 1NAKL 3MRPA 5GRVL 4R0LA 3DUUB 2NY3C 4OCSH 3NABH 1T0NB 5EOCL 3WHXB 3V5DA 4OCMC 4Y5XA 3SGKC 2UYLA 1H8SA 4LRNL 4GAGL 1BZ9A 3EOAB 3ARDB 5TDOB 1F13A 1IGFH 1RZ7H 3QIBD 4Z0XA 2IQ9L 2YD1A 4NPYA 2NXYB 1B0GA 3QIUD 5MHSE 4IIQB 5D5MB 5I1JL 3RWHA 1K8IB 3PIQA 3PE9A 3IFPA 3IJSA 4IDJH 4NRZA 1OSZB 1AQKL 1DLFL 1T03L 1SYSB 1KENL 4LCCA 1CIUA 1QFWL 2A77L 5DEFA 1G7PA 1S7RB 3CH8A 4RFEA 2B4CH 5FA3A 1IEHA 3BPLB 5E6IC 1QRKA 4FABL 1DBKH 5DLMH 4OCYH 1D5IL 1VFAB 4CGTA 4UU9A 1B0WA 2HFGH 3BX7C 3WD5H 4O2FB 4LPUA 3SJVA 4R2GC 3GSOB 4XGZA 3I6LE 2Z4QA 5T1KB 1D3CA 3VG9B 1CGSH 3VH8G 1MF2L 3U0PB 5F9JA 4KV5E 1R3KA 1YEHH 4JFDB 4PJBB 3REVA 4M8QB 2H6PA 2XTJC 5ICYA 3B9AA 2FIRT 2X40A 5CP3A 4G8GA 4H0HB 4K71C 2H2SD 3MRRA 3O4LA 4AIZB 5FA4A 4YBHA 3QDJB 4MJIB 3JWDL 3MGOB 4OCNC 2UVFA 3S7GA 1HQ4A 5CGMA 4KDTA 2XG4A 1S9KC 1GPOH 1ZS8A 4LPWA 3H6JA 3AXLA 4JDVA 4I3RH 3CPLB 4PGEA 3ALPA 4P46A 3TJHA 2IPUK 4QHUB 2K1MA 3K4AA 1P4BL 4F37K 2MQCA 2G2RA 4LNRB 4TOYL 4HUXB 5F9DC 2DN7A 1I3UA 1QQDB 4L4VD 4RISL 5SX4H 2YD2A 2FSEB 2KBGA 3QEQB 5T3XH 3KYKL 1EX0A 3LKPA 3Q48A 4QXUL 1E6OH 2R4RL 3CFCL 1CYGA 3QJFA 3BN9D 1ORSB 1LVEA 1IAOB 4RAVB 1FGNL 1KN2L 3QUXC 5E2TL 3DX7B 3IRPX 1Z0MA 1XR8B 2ADJB 3O3AB 4XPFH 4K23H 5CCKL 1PD6A 1UGNA 4JVPA 3CK0L 1A7OH 3QBTB 2DIAA 3B9KA 5L2KB 4UOW1 5GZND 4JG1L 4XBGA 3KPSD 3HC4L 4F57L 4ALAH 2A6JA 3WJLA 4UNVA 4WHYG 5EPMB 4XVTH 4ZFOL 3QDGB 4HCRA 5ISZD 1K3ZA 1F4YL 4HS3A 4JDTH 4ODHL 3B6SA 4XBPA 4NZUH 2H2PD 2MTPA 5F1IB 3TH4T 3U79A 2EC9T 3MA9L 1MHPL 5JO5A 1E4KC 2NY2C 1NDGB 2DWEA 2HT2D 3AB0C 2HRPH 5HBBA 4X4YB 4M3KB 1KEML 4N0FB 4KJYB 3QHZL 2XQYK 5JHDE 4WTZG 3P73B 4YK4C 4PY8J 3UEZA 3KPQA 3F7VB 2XI9A 4F37F 1M7IB 4JFZH 5EZIH 1DE4A 2GITB 4PJGB 4R4FH 5BMFL 3HLAA 3T3ME 3MFFA 1C1EH 4M03A 3CVIH 3Q3GA 1U58B 1BD2E 2ITDB 1Z5LB 1JPTH 3V5KB 4XP1L 1ZEAH 4WUUE 3EFDL 1KIRB 3UX9B 1IGCH 2DMBA 1EBAA 4HDIA 1A7RH 4HIJA 3RNKA 1CFTB 2NXZD 2BJML 3ARBB 2YPLA 4ONFH 5HD8D 5IW3A 3RVVC 2YK1H 2HTKC 4ZPVB 2BNRD 4UDTB 1CTOA 1MPAH 2NX5D 2IPKA 4OB5H 2P8MB 5CIPB 1JF5A 2J12B 1IC4H 5EUOE 5C0AB 4HAGA 1KCLA 3BVNB 3GMOA 3O8XB 5CEYB 1W72B 1FYHB 4RAHA 5DJXA 3ZT5A 4HJ0C 3E6FA 4Z7VA 4KJQC 4WJ5B 5CS7A 5IW6B 5E6YA 5KSUA 4JHZA 4U6VH 5D1XC 1JHKL 4JKPL 3A6OA 4OF3A 2VDMH 3FOMA 4GKSB 1QR1B 4MJ2A 1UM5H 2EIEA 5D7IE 5IB3A 3MBEA 3WO4C 3HPJB 3A6CH 2UUDK 4OLEA 2CO7B 1IEBB 3VWJC 4JHBA 4S11A 3NACH 4R9HA 1YEGH 3MXWL 5EO1B 1U93A 2K9UA 4OZIE 1WFOA 4QHLB 2FR4A 5SWSB 4MJ5B 3BO8A 2AK4B 3FB6B 5HXMA 2YKLH 1T83C 4MJ6A 4Y89A 4YDVA 3I6GB 4PGDA 1DDHB 3CX5J 4GQ9L 4KWUA 3ZDXE 3VD5A 4PP2B 2PUQT 4QTHB 4X9FA 2J8HA 4IHOB 2J1KA 3LKSA 3TJEH 1VFOA 2DIBA 1G7QA 3DBXA 3VFNB 3IFLL 1QBBA 4HWBL 3S96B 2BMKA 1YN6B 4CDGC 3NGBC 3F7QA 2HKHL 5HHMD 4JKMA 2PO6C 2GSGB 1BQHA 3GMQA 5IVXB 1YQ2A 2VJXA 2KQMA 4P4RB 1S7VB 3BPOB 5IFHH 5C0ND 1W8NA 5BZWB 5A2KH 1NCBL 2PTTB 3QPQC 3ZKND 3T0ED 5KSBB 1JUFB 1WQVT 4GAGH 5IB4A 2ZUWA 3V6ZB 4HX1B 3P4NB 4POZD 1NGPH 3BPNB 4L1HA 2IQ9H 5JA9A 5EIQA 3ULVD 5I1JH 2IF7A 4NQDA 5IESH 5E03A 2LU7A 4NN7C 2VXSH 2Z8RA 1GYAA 4P5KB 4NUJA 4WWKD 2OI9B 4XNZC 1WGOA 3EJYD 3RVUC 3MPCA 3MREB 4MB5A 3BPCA 4AEIL 2AQ3A 1G9ML 4TTDD 3QUMA 2DAVA 4YH6A 3FRPA 3IGAB 1A7NH 4OFPA 5F6HI 3F12A 1E27A 2KUTA 1OARL 1T66C 3E8UL 3QUKA 4ZSOE 1HDMB 3CAFA 4XCYA 3VCLA 1SJVA 1D5IH 4CAGA 3NH7L 4Y4HA 1QSEA 4WV1B 4OLUH 2E9WA 4D3CL 3D6GA 3VXME 1R5WA 3QH3B 5GJSL 4KAQL 4L4VB 3GSNA 4GH7B 4NN6C 4L9DA 3VXUE 1KJ2B 1C7SA 4FQHB 4XXDA 3TIDA 3NFSH 4JRXD 4EUPB 1U8NB 1Q9KB 3WO3B 5JORB 4JVUA 5IHZB 4FZ8L 1UJ3B 1QBLL 2ZKHH 2Q8BH 3WXVL 1X4XA 3MRBB 3V6OE 3MA7B 3G5VB 3LDBB 4NM4L 3GBLA 2CO6B 4M1CD 4YZFE 3U4BH 5JPNA 5ISZB 2M26A 3UTSD 3KHQA 1ZVYA 1PQZB 4Z8FL 4PBXA 4PJ5A 2NR6C 3WNOA 4BKLA 1XH3B 1BLNB 4LLYA 5B39G 1NGYB 3JWOH 3HAEB 4EI5D 1S7QA 2F5AL 4RISH 3CH1A 2W59A 3MOAH 5C09D 4KK5C 3WDIA 2Y72A 2EDOA 3CFCH 5F72S 5I2IB 5GS1B 5IJVA 2PNDA 1IQWH 1FZKA 3HS0B 5C0CB 3DGCR 3D5OF 5JZ7D 2R2BA 1ND0B 4NUGL 3K2UL 5E2TH 4PJIA 1FAIL 3I02A 2Y07L 4U1MA 5CCKH 1I9RH 1KIQB 4V2CB 3T2PA 5I66A 5SWZA 4F57H 3QEGL 1EHNA 1T5XA 1Q1JH 3QAZC 5TF1L 5L0QB 1Q72L 4DOHB 5HHXL 1U8OB 3RWFA 1INEH 3ULUH 4ODHH 4OFYD 2BSRA 5FK9B 2NXZB 2XKNB 3VWKC 1A6PA 4NJAH 4N0UE 3RZCD 4GW5B 2BNRB 3MA9H 2AJ3A 3KYOA 1BBJA 3GJFB 3UBXI 2NX5B 3MGTB 1JGLH 4JRYA 4Y8DC 2OYPA 5LWYH 2AXJA 3TBYB 2YN5A 3TPUB 1JYXA 2E9BA 1KEMH 3IDIB 4WO4C 3QHZH 1WC7A 3ARGC 1NBZB 3IETA 5JQHC 3AGVA 5CP3H 3N1MC 1HYRC 1S8DB 4Z95L 1MIEL 1EXUB 1BVLA 1DP0A 1AFVH 1DUZB 5KSAD 4XX1E 1UB5A 2EH8H 2NY0B 3ARQA 2VDOH 4WW1A 5F7LB 1QVOB 3PJSB 3HZKB 2V2WA 2ICEB 4UAOC 4M7LL 2YD7A 5DJCA 3WIHL 5FKPA 3CFDA 3EO0A 2DOCA 3P4MA 4XP1H 2ICES 2CLZB 2ADGA 1M71A 4KI5C 5HY9B 3L5IA 5F7EH 2I9TB 5C0GB 3QDMD 3O3UN 4YHMH 5TH2B 4IDLA 1NCDH 1C8PA 1I1YA 1G7LA 3PWPE 2IFFL 5F9OL 1IGYB 2FX8H 3OJ2C 1E0OB 2I5YL 1FP5A 4JY5L 1MQKL 4G42A 4RQQA 2A74A 3QXVA 2X4QB 4FTVE 1KB9J 4FA8A 5DD5L 5DK2A 3K81A 2BXZA 1N5AB 2E6QA 2ZOLB 1VKXA 2D9CA 4X4ME 3DGGB 5IF0A 4TULH 3TN0C 3PABA 3WUWG 5EU4B 3VFMB 3KPSE 5F1OB 3MJ9A 3PWNA 1VEMA 4HCRH 3NIDF 3U9PH 2B1HH 3V5HA 4PTUA 5J11B 4MXWH 4LKCB 3MNWA 4OLXH 2VDLH 1KOAA 3BGAA 4J3OC 5ELIA 3U1SH 1FIEA 4HG4K 1LO2H 4EN3A 3FO1B 3QEHA 4ZUVA 3N85L 3CU7A 4NGHH 1Z9MA 5MEOA 2P5WA 3S5LB 4G9FA 2IJ0C 4XI5D 5CEXA 2OMBA 2HG5B 5JDSA 2HJFA 1R3LA 1NKRA 5IEHA 1NFKA 2JB5L 3AREC 5C07D 2KPNA 3PNWB 3SDCC 2OM5A 4ZNEA 1AY1H 1Q94A 4UV4H 4ENED 2FB4H 4LSSL 4Y2DB 2JB6A 4ELMF 3C6LD 3R1GH 5DEGB 2VZTA 4FQXA 1N5YH 2J88L 3REWB 3O6FC 4AQ1B 1FBIH 4MAUL 5GGQL 4PB0H 2HKHH 3Q2CA 4JFFE 4F2MA 2NTSP 1JNLL 4QHNB 2VERN 4X5WB 5F8QC 4U6XA 3P9LA 2DIJA 1OW0A 3X12B 1UVQB 2FIKA 4N1EA 3NPZB 3IKKA 1JGDB 2IPUG 1HILB 5FM4A 3UCRA 4LCWA 5IFAH 1ZE3C 3RWDA 1MLBA 3EO1A 3WFZA 1OQOA 1J0YA 4J6RH 4YGVB 5DJ8A 5CINL 3C87A 3MRGB 1JNJA 3VE0A 3PP3K 3QO0B 2E7BA 5TGBA 3VFPB 4ZFZA 4I18C 5DHVA 4JRXB 5A3IC 1VFBA 4AEIH 3CLEL 1G9MH 1XGUA 2CUHA 2IANB 3SKJL 4OGYL 5K33A 5JQ6H 4KQ3L 4LEXH 3E8UH 4P23A 4NO5A 2W91A 5DJYB 4EOWH 1YEDA 2H26A 3CX5K 4PJ8C 1X5XA 3UTSB 4KY1H 4XPHH 2BNUB 2Q7NA 2FX7H 5BV7L 1KCSH 2KDGA 1NCAL 4LKXB 1AGFA 4OGXL 4ZS6C 4HKJB 4EI5B 4PUBL 4PRID 4ETQA 5GJSH 4KAQH 1CLOL 4I1NB 3H9YA 4Q9BA 5I1IL 4QRQB 1NFDA 4N8VG 2NLJA 4O9HL 5FUCE 1VADB 2ZCKL 3VGAC 2XQYG 3O4LD 4YFEA 1NC2A 3Q6GH 4P57A 3UBXG 4NZDA 2CRYA 1S7SA 3C08L 3U0TA 4MA1B 5GZOC 4PJ7B 4O5LH 2CIKA 4ORGA 4E0RB 4HGWB 2H32A 3MX0A 5HHME 4P46D 3TJHD 3HCVA 3L3OB 2BVYA 1CFNA 1NGQL 1SJEA 4MB4A 4YHPB 4RCAA 1FL3B 3UXFA 4L9LC 4YXHL 1TTFA 1KB5B 2EH7L 3MLXL 4I0KA 1NJ9A 4OM0H 3MV9A 3L9RB 1I1AC 3HR5A 4ZAKC 2C3HA 3T0EE 2JCCA 1HXMA 3EDEA 3ZTJH 1CLZL 4ONHB 2PR4H 4P5TA 2YC1B 5H94B 2OK0L 5CSGA 5KG9A 1OF2A 1CD1B 1HCVA 4NN5C 1XT5A 4KQ4L 3PV7A 4IOIA 1QA9B 4XHJC 4LHUD 2HP4A 3WLBB 4Q6IB 4WFGD 1XF4A 3B9KD 3FKUS 15C8H 3QUMH 4OZ4B 2VR4A 5DK3A 4UOW0 4BSVA 5ALCL 1X3DA 4ELKA 3O3EB 1EJOL 1WFTA 4HFWB 1F45A 2WM0A 3QDMB 1H5BA 1XAUA 1MFNA 2R69H 5I18H 1XMWA 3PWJB 4RA3A 5DVLA 4JFEA 3B5TA 2YXFA 3VFUB 2VDKL 4NKOB 2VDNH 3BUYB 3GSNH 3QFDA 2L4OA 3JTTB 4W4NA 1F58H 3CC5A 1A6ZA 4XP5H 5C9JA 4J1UB 4Z95H 3O4OB 4W81A 5FYKL 5JPMA 3MRDA 3MUGA 1CE1L 1T1YB 2P4AB 2ZSVB 1B88A 3V9FA 1E4XL 1TDQA 3HRPA 3I6KB 3WFHA 3ZHDA 1RZJL 3E3QA 1R6VA 4BZ1L 3GEWB 3V4UH 4ZQKA 3FQRA 4H8WL 3QPXL 5IOPB 4LPCA 2VLJA 1RMFH 1FC2D 3L3DB 3LY6A 4IMKA 4NYLB 5EIIB 3HI6H 3O9WC 2GTZB 1NBVL 2B1AH 3I50L 4FFWC 2IG2L 4PD4K 2Y1VA 1XF1A 2CJUL 5TE6H 5C09E 5F9OH 3M8OL 2X7LB 4OZGA 1Q9WA 4HQQL 4JY5H 1MQKH 1IEAB 3NA9H 2CXGA 4NO2A 1QTYT 3OG6B 2P8LB 3DVGB 3LKQA 1YC7A 1W8OA 5HDQL 4KKNA 5J3HD 5AUMB 4I5BA 3MBED 4ACPA 4XRCB 4U1KB 1NSNH 3BEVB 1QPPA 2XZAH 2IH3B 4Z5RB 1YJDH 5HI5C 3QXDA 2K3TA 1TFHA 4U1LA 1ZMYA 2BDNL 1U6AL 4X6CF 4NOFA 3MRPB 4R0LB 4IJ3B 2DTMH 1U8IB 2R9HD 1TVHA 5HI4D 3CU1A 3L1OL 3IT8D 3WE6A 4ERSH 3N85H 3V5DB 1RZFL 2F54E 4Y5XB 4OCWH 2UYLB 2CUMA 5DJ6B 4PJ9D 4PJCF 5D9SA 5E70A 4O02H 3KG5A 5J06A 2DQUL 4NQED 1WWBX 3MRIA 3EUUA 3FQNB 4Z0XB 5I75B 1SBBA 4NPYB 5HVFB 1BGXH 1B0GB 4JEGB 4WTZA 5E08L 4X98A 1XZ0A 5I30H 3RWHB 3TP4A 3PIQB 1A5FL 3OQ3B 3K46A 3IFPB 4WCYH 4NRZB 2ZOKA 1YPZA 4GOSA 1I7RA 1BIIB 2VLKE 2QBWA 1NGXA 5DEFB 3EYOA 5E1AA 5GGQH 4RFEB 1J8HA 2HA1A 1ETZA 5D5MF 5BQ7A 5CFHA 1JNLH 4NBZB 5FYLH 3O11A 4UU9B 4JPVL 1IBGL 1MRDH 3EDDA 3SJVB 2P49B 3UJIH 3T0DA 1GGIL 2EIZA 1YNKL 3N06B 3QHFL 2V2XA 4XGZB 5KS9A 3DMMD 2HLFD 3RJQB 3CFEA 1KPRB 5F9JB 2V17L 5C08A 2WUCH 1R3KB 3L5HA 1A0QL 5EZJA 5T3ZL 3SBWC 3MZGB 1C5DA 2H6PB 4U2YA 3JV6A 1KJVA 3T1FB 5DD3L 3FRUB 3PV6A 4G8GB 3MRRB 3O4LB 5J0BA 4XXCA 4PRBA 5FA4B 1DQML 4Z9KB 1P9MA 2D7QA 4MA3A 3K7UA 4F8TA 1VACA 2FLRT 3MJ9H 5IBTH 5IHLB 1FNFA 1UM6H 4JDVB 4HUNB 5C71A 1MCNA 3VFRA 4KQ3H 1OD7A 4LVOB 3OXRA 1ZHNB 4P46B 3NIDE 4JM2F 4UIKL 2Y06L 4H1LB 3B2VL 1U8LA 4Y4HD 4X4ZA 4U1IB 2G2RB 4MDJA 1UB6A 2A73A 2GHWB 3D3VE 5HYQA 2Y6SD 4HT1L 1QFUH 3G5ZA 3ZKQD 1AR1C 4MXQD 4PUBH 3X3FH 5KVDL 4XPGL 4I9WE 3LKPB 1GHFL 1CQYA 4UILH 2PW1A 1R24A 2IC2A 4O9HH 3U4EB 5C07E 1JFQH 1XGYH 4OLYH 1YEEL 2XN9D 5BOZG 5J13C 3O2VL 1YMMD 2R0WH 4YEFA 2OL3L 1E4KA 2XPGA 1CFBA 4FQ1H 4RGMC 1RY7B 1EGJL 3EZJB 4PJHF 2YA2A 4LHUB 1UWXH 2ICWI 3B9KB 4K8RL 5I8KL 4XBGB 1MCLA 4HIHA 4PJAF 2A6JB 5IVZA 1F6LL 1NEZG 4GW1A 4BH8A 3OKNB 1GOFA 1FQ9C 4FS0A 4HS3B 4XCCL 1JGVH 4XBPB 5JMRA 5BS0A 1JGEA 5GIRA 1A21A 5F8RC 5JO5B 3FO2A 1N64L 2AVGA 5DVOA 2DB8A 4BQ6A 4EQ2A 3FO0L 5I15L 1LEKA 3STBA 2MJWA 4LFHD 1TETL 3UC0H 1ZK9A 3WL9B 3GSXA 1EUUA 4APQC 5BVPH 3GI9H 3VFOA 3WKML 1X5LA 4IOFC 2OK0H 5CUSH 4FFYH 1DE4B 4AEHL 2VB5A 5DHVH 1R0AH 3HLAB 3GJEA 3SPVA 2Y7QA 2IQAA 3TM6A 3Q3GB 9CGTA 3QXTA 3FCTA 2VC2L 4KUZL 2EDHA 2H9GA 1R5IA 3CFBA 3DROB 5ALCH 4HDIB 3RNKB 1KIPB 4HIJB 2ZZUT 3TEUA 1V3KA 5IW1A 3OJVC 4UT7L 5D1XA 5I1GH 2YPLB 2PYEA 5HGAA 3KYMA 4K3GA 1F8TH 3NCMA 2A9NH 3OHXA 1MCOL 4WFED 4L8DA 3DHJA 5E8DL 3L5WA 4I0PC 4PRIE 5DMIL 2CH8A 3VWJA 1OTSC 4X7TB 5DJXB 4R7DA 3E6FB 4Z7VB 4NQSA 3WSQL 4MXVF 2GFBB 3T0AA 2DLEA 5KSUB 5GQBA 3TBVA 1NUGA 2X5PA 4NNYA 4HWNA 5IB1A 1NUFA 1T1ZB 3IU3A 4G6MH 1T83A 2FEEI 4R97C 2KZ1B 3VW3H 3FOMB 1TTGA 4R4NC 2GK2A 2H32H 2IWGA 4JLRB 5JXAH 2WWMD 5IB3B 3MBEB 4P3CL 1WZ1H 1U8QA 5JOPD 1C08A 1QSFE 4OUUA 4ODUA 1U93B 3DVIA 5FYLD 3BO8B 1H3GA 4MHHI 1MCFA 2C5DC 3ELAT 1N4XL 5IG7A 5H8DA 4WEBL 1O7VA 5D6DA 1U3HC 4LGSB 2J7LA 4MJ6B 4OQTL 4YDVB 1WAAF 4K7FA 4LOUC 5DMKB 5FYJE 3GUTA 4JO3L 1CK0L 2PO6A 5GXBB 3P0YH 5B39A 4M6AA 4NQEB 2XOTA 4JHWH 4NM8H 1N59A 4GUPA 4W6WB 5KJRH 4YUEL 3JUZA 5CJQL 5CJ5A 5JHLL 5HHOE 2BSSA 3LKSB 3DETD 1ZANL 3HFML 1G7QB 1KXTB 3ARFC 1FNSL 2FJGB 5E8NA 3BGFC 2Q20A 2BMKB 2V6HA 2NY7H 4DN4L 1UXWA 4GG6E 2A9ML 4YHYB 2IADB 5F7NC 5TE4H 5CZVL 1BQHB 3GMQB 1JN6B 3VGFA 2Z92A 3VGGA 6CGTA 2LABA 4AIOA 1HI6A 4TQEL 4KKBC 2Q1EA 3GKZA 2BFVL 2VISA 4GO6B 1A7PH 3C2SA 4C59B 4UTBH 3HE7C 1T2XA 1IKFH 4Y16C 1U95B 4HWUA 5IP4A 3QUYC 3DMMB 4DGYH 3WFEL 1KGCD 5FGSA 5IB4B 2DICA 2BHZA 1VB9A 5M7QA 4DQOH 1DBBH 2DMCA 5JW3L 4MS8A 4TUJB 3V79C 3IDYC 2ICCA 4NUJB 1Z3GL 1VERA 3RRQA 1KCVH 1XGQB 5EOCJ 3BPCB 4D9LH 3HKFA 1R3HB 3L95A 3QUMB 3MUY1 3OKEA 3F12B 1E27B 2NZ9C 3QUKB 1S7UA 1CR9H 3MLWL 3I84A 5C1MB 3L5XL 5CJOL 3DX6B 4FMFA 1AGEA 4XCYB 1WEJH 5ANMA 4Y4HB 1CE6A 2YZ8A 1QSEB 3NTCH 5I8EA 3OX8A 3O6MH 1BF8A 3IJHA 1B0RA 4LCWD 4PRAB 4PV9A 1O0VA 5JW4Q 5JXEC 5E94A 4ZS7L 3B9EA 4GAYB 1H15B 2VXVH 3HC0A 3GSNB 4XVJL 4MQTB 1MIML 5GGRY 1IAII 5HYJA 4IIQC 5EU6A 3FMGL 2GYSA 1DANU 2DM2A 4LL9A 4MA8L 4I4WA 4ODTL 5HHVH 5DD3H 2E5EA 2YR3A 3TIDB 2O5XH 4XNXL 3THML 2VQ1A 3FQUA 3LN5A 3IDXL 1JYWA 4WTWA 4F7MA 3CLFL 3KPTA 5ICZA 4O58H 3PQYD 3UTPE 2XZQL 3BPLC 3WUWA 3UZQA 4WHYH 1G0DA 1GVIA 1RK0B 5GRXG 5JPNB 1KUMA 5DGRA 4UIKH 2Y06H 1MWAA 2YSSA 5LAXA 4PJ5B 1MJJA 3WEXA 4BKLB 4TNWK 4LLYB 4UT6H 3GJFK 3ECBA 1IGJA 3WXWL 5TDNB 5GS0L 2MKLC 4U1SB 3RAJL 3KPRA 5T1DH 3UYPA 1A4JA 5F71A 5GGRA 5IJVB 2GUOA 2B8OT 2CGRL 1HZHH 4F3FA 3OAYH 5INCB 3VWKA 2R2BB 4MLSA 4PG2A 5JIHA 5J4MA 4PJIB 2FD6L 2DYPA 2ZP0T 3I02B 4HKZB 4U1MB 2Y9RT 4LASL 2BP3A 1A6WL 2VXTH 3DJ9A 5MP6L 3ARGA 5I66B 1W0WB 1F97A 1RU9H 2RCSL 1CXKA 1T5XB 4GXUM 4ZDHA 5F7WC 2VXUH 5EA0L 2P43B 1ZHLA 1FNAA 3W9EB 1TZHA 5BO1L 3WLWD 3VXOA 5D7SL 4B7IA 4XCCH 1I9JL 3S98A 2DLFL 2BSRB 4EXPX 3K80A 3UZVB 3KYOB 1BBJB 3TT3H 3GIZL 4JRYB 4HXAL 3DYOA 5I15H 3QG6B 1EVUA 4P5TD 3TFKA 2W1NA 1OVZA 3BQUC 4OKDA 3U46A 2F53E 3MLPA 1UB5B 4R6UA 4PB9H 3TBTA 1A9EA 3MACH 1ZAGA 4MD0A 4LSRL 5DJCB 3VJ6A 1NQBA 1S78D 2F5BL 3ARWA 5FKPB 1PJ9A 3CFDB 1INQA 5DVKA 4KUZH 3P4MB 4JFDE 1FHGA 1M71B 1ROWA 2ADGB 4PFEA 3VG0H 5JR1L 2OP4H 4LLQA 3HC3H 3G6JA 4J3XA 4NWTH 2G5RA 5ID0B 2CR3A 1HE7A 1RI8A 4JFED 1P7HL 3FQTA 3RUGA 3TN0A 1L7TL 2DL9A 1I1YB 3MV7E 4WY7L 1MCOH 3QO1A 2A6DA 43C9A 1WBYB 5DMIH 3SOBH 1KELL 1WTGT 3MLRH 1U92A 3MRNA 4J23A 5I1EH 2Q3AA 1XF5B 3RU8L 4RQQB 3PGCA 1JWSA 1LO5A 2A74B 4JVWA 4M6NH 3WSQH 5DK2B 2XN9E 4N8VA 5FGBA 2V9RA 3KPPA 1YMME 5K93A 4MQXC 4HKXA 1VKXB 2XRAL 5IF0B 1QRND 3PABB 3VA2C 4J3TA 5T33H 4XAKD 3PWNB 3H3KA 2CK2A 4PJHE 4TVSa 1FDLL 2VLJD 3V5HB 4PTUB 3AM8C 4AG4L 3AREA 4MD4B 3SDCA 4PJAE 1CVRA 3A67H 3QJHA 3MR9A 3ARBC 5IKCA 1JTPA 3VGDA 1BQSA 3QEHB 2DQCL 4LSPH 2OTUA 1AC0A 2DWDA 5DGQA 4ZUVB 1MVFA 2P5WB 3QIWD 5BV7B 3O8XC 3KNBA 1J0KA 4U0QB 5KVEL 4D0CB 5CEXB 1AI1H 5JDSB 4JO3H 1CK0H 2HJFB 1R3LB 5T3ZD 5IEHB 4M6ML 1DANT 4U2ZA 2G9HA 1E28B 4YUEH 5CJQH 1Q94B 1RUKL 4CW1A 1YNTA 4UQ3A 1V3LA 5HHQA 1QP1A 3JV0A 1Y6KR 3F7PC 1J0IA 2JB6B 3CSYB 4EQ3A 4TSCL 1KN4L 4FQXB 4OT1L 3RA7L 4AH2B 4UB0H 1FPTL 3VRJA 3ZE2E 3V6OC 5F89A 5K9JH 2ICWJ 2A9MH 2VIRB 2ILLA 4KJWC 1KYOJ 1UCBH 4F2MB 5D8JH 3INUL 1K4DA 5IQ7L 4Y4KD 4U6XB 3P9LB 1WBZA 1GC1C 1JF1A 3OKKB 5HTSA 5FKAA 4N9OB 4XVSL 4I18A 4Y8AA 4Z7OF 1JRHI 4MMXC 4FRWA 4LCWB 3HNTL 4Z7QF 4HWZA 2OZ4A 4QRRA 1UM4H 1MLBB 3EO1B 3WFEH 3KPNA 3FAXA 2AI0H 3QIBC 2DLHA 5FCUH 3D69A 4M6OL 5DJ8B 2QADB 4QRPE 3QIUC 3D0LA 1INDH 1MCWW 3BKYL 3VE0B 4MXVE 3TBWA 5TGBB 1Z3GH 2AXGA 5DHVB 4JR9L 3NN8A 4M48H 3MLVL 2Q8AL 5D2LA 3QWQB 4K8RD 5DEZA 4OIIL 1GIGL 5C0AE 3SHSA 5TPWL 1QD0A 4DVRL 3BRFA 1DBMH 5JOPE 2XWTA 4NO5B 2DQDL 2OR7A 1TZIB 2C3XA 5FGCB 2FLBT 3DX8A 1YEDB 3LPWA 2P1YA 3UO1L 2H26B 1A8JH 4HS8L 4FQLH 1BWMA 1QSZA 2X1PA 5DRXA 1KLUA 2DQJH 5ADOL 4LGRB 2UWEE 1AGFB 4EJ1C 1TMCB 4X6DA 4ZD3L 3BP7B 5A16B 3LB6C 3MV8E 4ETQB 4BUHA 2H41A 3EGSA 4D8PB 1NFDB 2VE6A 2NLJB 5F7HA 1MIMH 3EYQD 4LLVA 2JKXA 1Z9LA 3G5YB 5E99L 4MA8H 4L9LA 4YHOL 3MOBL 2OI9C 4ODTH 4QT5A 2H2SC 4D9QD 2HMID 1S7SB 3ARTA 3U0TB 3THMH 2Y36L 1KACB 4GAFB 4ZAKA 2OQJA 4LCUA 4U1GB 4QNPE 2VLRA 2CIKB 1BFTA 3IDXH 4ORGB 1IT9L 4RGOH 2QSCL 4RBPH 4WEMB 4S1RH 4KKLC 1VCAA 5DUMH 1FYTE 1SJEB 1RULH 4AL8H 1J1PH 4IEFB 4QTIL 4WV1C 4R26L 2QSVA 1Q0YH 3BXNB 3EYSH 4DKEL 1RIHH 4I77L 4XZUA 1S9WA 4MWFA 5GGVL 4DGIL 5GRVK 1QFOA 1NJ9B 1FV1B 3MV9B 3ARPA 3HR5B 3NCJH 2JCCB 3RAJH 2OJEA 1F4WH 1FIGL 3BN9C 4P5TB 4Y1AA 2CMRL 4L8BA 1S3KH 4UOJA 1OF2B 3J7HA 4LAJH 4KHTL 1XCTB 3AROA 1XF4B 5HVHC 5CKAA 1UJ3C 1WICA 5GZNC 1PW3A 3LDBC 3MODH 1UQSA 1B90A 4TSBH 3BP4A 3ZKSD 4ELKB 1RUQH 2APXA 5JTWA 1T1XB 4O51A 4R8WH 3CMOL 3ULSA 5BS0D 2H2PC 1UWGL 5DK0B 3U7YH 4EVNB 1G7IB 1ZA6A 4JY6A 4JFEB 2GTWA 2HT2C 4G6JL 2XZCL 4IBLT 1FNGA 3RVTC 4X6FA 2D03L 2DQHH 4DFHA 4BFGA 3CC5B 1A6ZB 1A9BA 3UPRA 4TN9A 5F7FA 2IBZX 1SEQL 1MHCA 2I07A 5C9JB 3LS5L 2HTKD 3FB5A 5E8OA 5JPMB 3BSZL 2Z8WC 3MCKA 3MROA 3O9WA 4NCDA 1RAMA 1UJTA 5D6CB 4CN1A 4QOKA 2EYSB 5DO2D 2AJYH 1FVDA 5FUZH 1IFHL 1I7ZA 2E8YA 3WFHB 4JJ5B 4HXBL 4LNVA 3OWEA 3VXNB 5C7XL 4NHCL 1QRNB 3FQRB 4UTAL 2F5BH 1FE8H 3RI5F 5L0QC 1CDUA 1JF6A 2UZYB 3OPZL 2VLJB 3BH8A 1K5NA 4H88L 3TCXA 4Z7WF 1MWAH 3C5JA 3G9VA 2NXZC 1JV5A 2RFXA 4CL7A 2YD8A 5H35B 2EDLA 5GSVA 2B20A 4XBEL 3JUYA 1JZ2A 1YDPA 3EZ8A 5SX4I 2Y5EA 4HIXH 1JVKA 1MFBL 2KKQA 2XTLA 4XC1L 3DTXA 2CQVA 5EZLA 4ZXBD 2MSPA 3RWCA 1CGWA 4HIIA 4UINL 5CAYB 3QCUH 4NO2B 3B5GA 3TBSA 2B2XL 5FYKE 1U8JA 2NY3B 5H2BB 5GGUB 1RUPL 2R2HA 4ZYKB 2J2ZA 3SO3B 1MCDA 4I5BB 4H26A 3CIQA 1ZWIA 1T5WB 4EUPG 1FDLH 2B4CC 3QXDB 1PBYA 1EO5A 4FXGA 5C0CE 3BE1L 2FBJH 4QHKJ 1NEZA 1KTRL 4JG0L 4L4TA 5BRZE 1TVHB 1CFVL 3D9AH 4X7EC 4OD3H 3C5ZC 4PPTA 3QWRA 3BESR 2N1KA 3LQAC 1OOAA 3BW9A 2GAZA 2WLZA 3MRIB 3HAEG 2P7TB 35C8H 4YXLL 3VXSD 2Q7YB 4JO1H 3S36L 4K2UL 1VGEH 4X7FC 1IZJA 5GHWL 2VZSA 5FV2A 1U8PA 4OLVL 2ZOKB 4NKIH 4L5FL 1I7RB 4H20L 5KVFL 3WS3B 3RA7H 1ES0A 2VABA 1BQUA 1NGXB 5DJ2A 3SBWA 2E7MA 2X1WL 3EYOB 5E1AB 5J11C 3T2OA 3U9UA 4PRNB 3DXAA 2H1PL 4DAGL 3INUH 5IQ7H 2P42B 1BZ7A 1SVZA 4YHIB 3VXRA 4Q9QH 4X6EA 4KDWA 1U91B 3JTSB 1AGDA 5J6HA 2QQNH 1OY3B 5LBSH 5C0NC 3CDGA 4WHTA 2ZNXA 2V2XB 5KS9B 4UNTA 3ZKNC 3HNTH 3T0EC 5FHBL 5TQ0L 1UYWH 1WZMA 2IBZY 5EZJB 3SE9L 5GS0D 2W60A 1C5DB 4POZC 1OAKH 4MS8D 3JV6B 1D5XA 1KJVB 4M6OH 5AEAA 5GISL 3NFPA 4UV7H 5A2JH 25C8L 3ULUF 1BEYL 3ULVC 3PV6B 2AJVL 4ZTPL 4Z7NF 3QG7L 1RZKC 4F15C 4PRBB 4WWKC 1HKLL 5AYUH 5ADPH 4YDJB 1GOGA 2P5ED 1NEUA 4MA3B 2DQTL 2HJLA 3EJYC 2VR9A 3TLRA 1VACB 1VFUA 4JR9H 1HIMH 4RWYH 2XWBA 2PCPA 3R4DA 3X13A 4Z7UA 4OIIH 4I2XE 3U36B 1KNOB 4JQIH 4DVRH 3IFNH 3QCTL 1XR9A 2BVPB 2DQDH 3V52L 1KLFA 3GB7A 1HHGB 3ROLA 3UO1H 3TH3T 4HS8H 1PKQE 4MDJB 1KC5H 3WYRA 3QFJA 3RNQA 2A73B 4MX7A 5ADOH 5HYQB 2O93L 3GRWA 1QHOA 4ZUTA 3G5ZB 4NOBA 4ZD3H 1AD0A 2BC4A 5F21B 4OF5A 1P5UA 3SDAA 3DVFA 4A2MA 1UADC 3ZYJA 3DOSA 3U2SB 5IBUG 1F4XH 2X89D 5T3ZE 1R24B 1MI5D 2JELL 4L1DA 3F8UB 1TZGH 1KYOK 2HKFL 1NUDA 1G9EA 2XPGB 3AB0B 4HPYH 3ESVF 5EO9A 3STZB 4P59L 1GGBL 4YK4B 1IT9H 4HIHB 1JZ8A 4GKZB 4APQA 1F2XK 1WIPA 1J9CT 4LSUL 2BNQA 4GW1B 4BH8B 2QL1A 5E7FA 4CVUA 2X44D 3WHE1 4QTIH 3VD3A 5DHXB 5BS0B 5KBNC 4R26H 1Y0LB 4U05A 2VRAA 3MLYH 4EI5C 2OZ4H 3RWIA 3L7EB 1LEKB 1J1OH 4MCZA 4Z7OE 4IMLA 1SBSL 2FECL 5F96H 3GSXB 3VFOB 4PGCA 3VWKD 3QHTC 3HR6A 3C09B 5JZ7C 3H0TA 4XVUD 4MA1C 1ZT1B 3SPVB 2Y7QB 4K3HA 2VQTA 1KTKE 2IQAB 2R56H 2DLGA 3T2NH 3FCTB 3KLDA 3PGDB 5GRJH 2H9GB 1R5IB 3CFBB 4M93B 4M5ZL 2OR9L 1LWRA 1MJ7L 2BRRH 5IW1B 2VXQH 2PYEB 3KYMB 5IUSA 3RZCC 5HDBE 4KTEL 4NBYB 4L8DB 2XZCH 3WO4B 3L5WB 4WFHE 2YWZA 4KI5D 4P9MH 2D03H 3TFKD 2IANE 1MUJA 2Y25A 4KXZH 4R7DB 3V7AE 3MJGX 4JHAL 2YBRA 4EXKA 5JIPA 3LS5H 3QRFM 2I26N 1DBJL 5MEPA 3ROOB 1TJGH 4FQCL 2B0SH 5KSAC 4PJFE 4OLWH 4NNYB 4KHXH 3TYFA 5IB1B 3L3KA 2MFNA 4Q6IC 1U3HA 2JIXA 2MCPH 2UY7A 2C9AA 2DD8L 5K9QG 4HXBH 5D4QA 5D7LD 4LLMB 12E8L 3VFWA 3IF1A 1BJ1H 1DL7H 2E9IA 3H9ZA 2FGWH 1U8QB 1RVFL 1C08B 4OUUB 3OPZH 4H88H 3OR7A 4GRWB 3UYOD 4RMTA 4U49A 3ME0A 3ARFA 5DTFA 4PGZA 4JPWL 1LE5A 5I1LB 3GUTB 2PO6B 1XF2A 3M1BA 2AEIT 3MYZA 4HAFA 4XC1H 4WU5A 5KAQG 4JDZA 4QRUA 5E2WL 2VLMD 3O4OC 5CEZH 1N59B 4GUPB 1XGPA 4XP9H 5EBGA 2BSSB 5DQ9A 4J3UA 3HE7A 5BXFA 2W0LA 4JO2L 3QNZA 4Y16A 5E8NB 3QUYA 2YXMA 2D0HA 1I3RA 5KSVA 1CXEA 1P6AB 1UXWB 1P7KA 2VKWA 1ACYL 4JQVA 3SDCD 1EEZB 2WUBL 3QRGH 5JW4M 1KCRL 4N90D 4NQTA 2Z92B 5LXGL 1RUMH 1W0VA 5DRNA 2VISB 4FZEH 3GSRB 1T7ZA 4JFQA 3L3GA 4XPBL 5I73C 1JWMA 3WIIL 4EBQL 3TWCL 3S88H 5SWQB 4M62H 4YXLH 1GAFH 3S36H 1TNMA 1T0NA 4ENEC 1FRGH 2VITA 3UP1A 5IBLD 4OLVH 1EK3A 3C6LC 4OF7A 3SE3A 2P5EB 3EOAA 2XG5A 5JXEA 4P2RE 5DXWA 4L5FH 3JWDC 5M94B 4H20H 4XNYL 5KVFH 4WI7A 4K94L 3QWOB 3L95B 1DSFL 3OKEB 2XY2A 1VENA 1NMCC 4IIQA 4ODXA 1S7UB 3WFCL 3QNYA 4LLUA 4LK4A 4I48B 1AGEB 2HAZA 3RWEA 5GPRA 5ANMB 4RWHA 4IJ3C 1OSZA 1D6EA 1T7WA 1CLCA 4Z7WE 4NZRL 3OX8B 2WIIA 1VEPA 3IJHB 1B0RB 1FORH 2D4FA 3R8QA 1M4KA 2ADFL 4OTXH 4S1SL 4PV9B 3BFOA 1BD2A 1EPFA 1SEBA 5E94B 3TPKA 4GXVL 3NA4A 4N8CL 4WUUA 2YUXA 5I75C 4K7PL 3SE9H 1UWEL 1VFAA 5HYJB 1RFDH 5I1AA 4H25A 3F58H 2F9BT 1MI5B 1YECL 4I4WB 4NWUL 5KVGL 1KJ3L 1HKFA 4ZTPH 4DGVL 3L5JA 4WW2B 4ZS6D 3QG7H 4FNLL 4YR6A 3I9GL 5T1KA 3TCLA 2VQ1B 3U0PA 1MFCH 4NHUB 3LN5B 1CS6A 3P40A 4PJBA 2I24N 4F7MB 2P24A 1QSVA 2WINA 3KDMA 5HYEA 3WUWB 3QCTH 1CXFA 5I1KL 4S10A 4G9DA 1RJZB 3BWAA 5CHNA 1V8HA 5FV1L 5JUEH 3VXTA 5LAXB 3SO5A 5FEBA 3RBSA 1MJJB 3WEXB 4BZYA 1IL1A 2PKDA 3ECBB 1HWHB 1IGJB 2J6EA 4K3DH 1BJ8A 2BX5A 3KPLA 4PJDB 1A4JB 4OZIA 5GGRB 1NMBL 3X17A 1NCUA 3VXSE 4LNRA 4HUXA 1MJ8H 4WHCA 4YXKH 3VWKB 1H3VA 1PLGH 2DYPB 3K74B 4URTB 4OM1H 4BM7A 1I1CA 4D2NA 2VLRD 4DW2H 1UACL 2ENSA 2YD3A 4ZPTA 5FOBA 4P59H 3T0XA 3V4VL 1U8KB 4Z0BL 3ALWA 4OIAA 4RAVA 4ZDHB 1I3GL 4S1QL 4P46C 3TJHC 6FABL 4LSUH 1ZHLB 3BQUA 1TZHB 5DJDA 3D18A 3VXOB 3O3AA 4PJIF 4XHJD 5KZCD 4A6YL 2YMXL 3RIFF 2BOCB 3ZL4H 5B3JF 4UAOB 1LK3L 1RJYA 4QYOA 4HUMB 3DPBA 3KXFD 4G7VL 2ZJSH 4LU5L 5EH1A 1NLBL 4NC1E 5EPMA 5DMGD 1Q0XL 3RY5A 3QDGA 1BPVA 1SBSH 4DTGL 1U3JA 3W2DH 1NANI 4ZUUB 4IRSA 3IDUA 4JZOA 4AK1A 2R1WB 4XMKL 5DJAA 3O81A 2XXCB 1W2KT 1YEJH 1R3JA 4X4YA 4PRPD 1HEZA 4N0FA 4KJYA 3TBTB 3B9KC 1L7IL 3SQBA 3VJ6B 3WJLC 4NC0B 1MELA 1INQB 3AVEA 2GCYA 3GMRB 1M7IA 1A3RL 1ITCA 4M5ZH 5FCSH 4N68A 4HGKC 4LLQB 5IMLA 5F93C 1MJ7H 3G6JB 4RMSA 1F6AB 3ZHKA 4G8GE 5J1SC 4AY0A 3GRWH 1BF2A 3F65A 1P69B 1U58A 1NKOA 2DDQH 4OBSA 2J6EL 3RUGB 3W5MA 3TIEB 3NMEA 1VA9A 4KTEH 1Z2KA 1Z5LA 3V5KA 3QO1B 1KIRA 4HBCH 4MLIA 4AT6B 3MBXH 3AM8A 3MRNB 4ZSOA 2EDDA 1UKQA 3PGCB 4JO4H 3O9WD 3TT1H 4PLJD 5HPOA 1YYML 4Q7DA 1U8MB 3HG1A 4N8VB 4QOKD 3WFDL 3KPPB 3WCYA 4YDKH 4KVNL 2EICA 1WSST 3IAPA 3JXAA 1MFEL 3O8XA 3BVNA 4S0TD 1ZHKA 2DD8H 2Q86A 1N7ML 4P4KD 3H9HA 1YUHA 1OAQH 3EBAA 4YE4H 1MCEA 1OP5K 3QT2A 3VXUA 1UWXK 3PP3H 2D7NA 5IW6A 3OZ9L 3AREB 1R3IL 3SDCB 4RGND 3MR9B 4M1DL 1NAMA 5IKCB 2ZUYA 3QEUB 1I7UA 4KRLB 2GW5A 1IAMA 3SDXB 4FFZL 4KZEL 4GKSA 1B2WL 2OTUB 2DWDB 5C70A 4YO0A 1MJUL 1N8ZB 4H1LG 2EKJA 5JA8B 1HSAA 2XIDA 3V6OA 3KNBB 4JPWH 5HI5D 1PKOA 5C0RH 2YA1A 3GK8H 2VZUA 2BHYA 4QHLA 2IBGA 5SWSA 2ED9A 1F42A 4TSAL 3AY4C 2LAGB 3ES6A 2AK4A 2G9HB 5FM5M 2AJSL 4HKBB 1IM3A 4U7KA 1FFOA 1YNTB 4NKDA 3JSSA 4UQ3B 5HHQB 3EKCA 4JPIA 1A6UL 4AENA 2WLYA 3I6GA 5J3HC 3PG2A 4NRXA 2NY1D 1DDHA 1AR2A 3MBEC 4OD1H 5AAMA 2QHRL 3DLQR 4ZFFA 1G9MC 3MO1A 3AS3A 5F89B 4N5UA 4PP2A 3QIBA 2WUBH 1PSKL 1OD9A 3QIUA 3MCLL 4IHOA 4LHUG 4N0YH 3LHPH 5C2BL 1K4DB 3MTRA 1F3DH 1JTOA 1QLEH 4L4TD 5FKAB 1MVUA 1AXIB 1OGAD 1OLLA 2C1PA 5HI4C 2R9HC 1CU4H 2D31A 2EECA 5T1LA 4NFBA 3ZSTA 4HWZB 4PJ9C 4QRRB 2K7PA 2JJTC 1QO3A 3TESA 3WIIH 1XFPA 4F7EA 4FQJL 1A14L 1L4IA 2XXMB 3D69B 4P4RA 1ZTXL 3D0LB 2W92A 2XICA 3I75B 4N0UA 3TBWB 2AXGB 3V2AR 4Y7MA 5LCVH 3FQWB 5KSBA 3V4PL 5D7LE 1GH7A 2BXYA 3V6ZA 5D2LB 4XNYH 4YHYC 4K94H 3PGFL 3HE6A 4CADA 1DSFH 2VYRE 1PEZA 1FO0L 3PHQA 3MXVH 4U3CA 2XWTB 3SQOL 4RDQG 3VGAB 3WFCH 3DX8B 4HFUL 5EC2B 3VXRD 2R29L 4M3JA 2OI9A 3KGRA 4EIGB 5DRXB 3MREA 5F7MC 1KLUB 3B2UD 3X14A 3DMMC 3LMJH 2HLFC 1PG7X 2DJUA 3EGSB 4V3DB 2VLME 2X2YA 5E4EB 5A1AA 2O5ZL 3ZYZA 3W0WD 2DBLL 4WV1A 1J05A 4L9LB 1YECH 1C12A 5E24E 4F7TA 2WWKT 4DGVH 3RTQD 3PWPA 3WFBL 5HGBA 4WUKL 4L4VA 4ZAKB 2OQJB 3P11H 1YC8A 2VLRB 5FF6A 1OHQA 1SY6A 4UQ2A 3MJ8B 2DQEH 4DUVA 1JZ7A 4JKKA 4FTVA 3V6FA 4WU7A 2Z35A 3QNXA 2JJSA 5I1KH 2NPLX 4Y4HC 1WK0A 5F88B 1U8NA 1LNUA 1UH2A 4R96A 5EWIL 5KZCB 3GI8L 5JORA 5J6GB 3JV4A 4WHDA 5IHZA 4X4MA 3O2DL 4XZUB 4TNVK 5FO9A 4MWFB 2Y6SC 3LEYL 3KPSA 1DEDA 3MLSH 1KT2B 5ICXA 3SDAD 4P2OD 4MXQC 2JJUA 1Q8MA 3F7YA 5D2NE 3SN6N 1FZOA 1A7QH 3BMVA 2D9QB 2W65A 4Y1AB 1I1FA 5D7KD 1LE9A 5L88L 1GGTA 1XH3A 1BLNA 4Y19D 1WIOA 1BJMA 4PRPB 4U0RB 3IJYA 4APQD 4NDMA 2OS7A 4QHMA 2LAAA 5T1MA 5I2IA 2BNQD 3I3DA 1I3GH 1UQSB 3VI4F 3BP4B 1ND0A 1LO4L 4M7KL 4GG8B 3ULSB 2AGJL 4NQDE 1KIQA 2FATL 2AJZA 2YMXH 1ZA6B 3D39D 4M8VA 4TUOA 4B7LA 4JY6B 5DZNA 1C5CL 2GTWB 2E9JA 4LU5H 4X6FB 2A83A 4QF1B 2WQ8A 1RURL 3BN3B 4GBXD 1A9BB 1WWAX 5D72H 4NRYA 1MHCB 1IRAY 2I07B 4D0BA 3JTCA 5FK9A 4XWOD 3FB5B 5E8OB 5ITFA 1M6OA 3OAUL 3MCKB 2X1XR 3MROB 3O9WB 2BNRA 4GW5A 2Q6WA 5FYJU 4TUKL 3GJFA 5ESVA 4QOKB 5EU5A 2E7LE 3N50A 5GS2D 4NO0D 3NCCB 1X5GA 4P4KB 1TQCB 4HC1A 1EXUA 1T21A 4YDIH 3KVQA 5MHSD 2ZPKL 3BH8B 1DUZA 3AMLA 5D71L 4CU7A 3CCHA 2HFFA 2W9DL 2RFXB 3FRPG 1EFQA 3PJSA 5AWNL 2ICEA 5GSVB 1JNHA 2QQLL 1X5FA 5E8PB 1N3NA 2J6EH 3CXHJ 2PXYA 1V7NL 1BQLL 4GLRH 3NAAH 1BP3B 2CLZA 5HY9A 3ZKXB 3DTXB 3M45A 5C0GA 4DKDC 1ITBB 5TH2A 3RWCB 1V3JA 1OPGH 4HIIB 3TBSB 5MERA 2F58H 1YYMH 1U8JB 1YN7B 1U3HD 5IEKB 4CMMA 1JBJA 2R2HB 3N9GL 5EO0A 4MJ4A 4PJ5E 3C5ZA 4HW6A 1F90H 4H26B 5DUPL 2NY1B 4DK3A 1ZWIB 1VEOA 2WWMC 4KGJA 5IB5B 5CBEA 5DR5L 4OZGF 2X4QA 1B6DA 1IILE 3OZ9H 2L7JA 2A1WH 1N5AA 3EYUL 3C9NA 3R0NA 4R90L 2FDBP 1T0PB 3RIAK 2DM4A 1TJHH 4L4TB 4LAQL 3UYRL 5EU4A 1OGAB 3GHEH 4UIMA 1FFPB 5DMYA 3FT3B 5HHMA 1MRFH 4JN1H 1OAUH 5SWZE 5T5FH 4MNGB 1J10A 2GAZB 4KTDH 1S5IH 4V1DD 4TSAH 3OGOE 4LQFL 5DQDL 3HMWL 3HE7D 2CD0A 3H7LA 1GXEA 4LFHG 3DETC 1QACA 1G9NL 1KEGH 5E95B 1A1NB 1MEXL 2ID5A 5SX5H 3AS1A 5J7CC 4O2EA 1T6VN 1TQBB 3OKLA 3T0EA 4JRYE 1ES0B 4JM4H 4ODVH 2QHRH 2X4NA 3OKMB 1M05A 3I85A 5DJ2B 2MKWA 1CLYL 4LDLB 1CGXA 3MRJB 3U9UB 3V8CA 4KROD 1AGBA 4D0DB 5AAWA 1OTUD 3CDCA 3VXRB 4WWKA 1JYVA 4X6EB 4OF0A 5J6HB 5IVNA 3REWA 1YPZF 3PP4L 3DX9A 3WMSA 3CDGB 3EJZC 4WHTB 4P99A 4XP4L 5BV7C 2EE3A 3RDTD 5IK3B 4KVCH 3DUSA 3V6BR 2W60B 3ET9F 4FQJH 4HWEH 1UA6H 1D5XB 3RIAF 3IU4H 3NFPB 1JGDA 1FGVL 3W0WB 4OLZH 3O2WL 1HILA 4L4JA 2C4XA 3WBDA 3D25B 3KWWB 2RGSA 2HJLB 5JHDD 4GKNA 5JXED 2AEPL 3QZWA 3UMTA 2XZZA 4BA8A 3RTQB 2C4FT 2XWBB 2PCPB 2VL4A 3X13B 5DJZA 4Z7UB 4YGVA 3MRGA 3OKDA 1NAMH 2GQHA 3D2UD 5GGSA 1JGUH 1H3PL 1XR9B 4RGNE 5J13B 2VUOA 3GB7B 2ARJQ 2R29H 3ROLB 3RHWF 4GW4B 3UAJD 2R1YB 4JRXA 1LP9E 4F7CA 1YEFH 3QFJB 1FNEB 3RNQB 4MX7B 1A2YA 4IRZL 3BJ91 1BD2D 3ZE0E 1AD0B 2BC4B 1ZGLA 3SDAB 1GZQA 4P2OB 1RZ8A 4JFHE 4M7JL 5ACMA 1BFOB 1GC1H 4UBDC 3BKJH 3KJ4B 3ZZ1A 4TTGA 1QFHA 1OGTA 4LKXA 1FL6B 5KTEH 1E4WH 4NKMA 3OKOA 4LSVH 4EI5A 1PX3A 4Y19B 4RA0C 1LEGB 4DUXA 3WDJA 4KRNA 2P5WE 5C09A 1VADA 4G9FE 4APQB 3ARXA 5EOQL 4KZDH 4KUCD 3HNSH 1KXVC 2BNQB 1LQSR 3G5XA 2I60L 4ZNEE 5EWIH 4FXLA 4PJ7A 5AG9A 4S2SB 1M7DA 1FG2A 3HNVH 5TFSL 4HGWA 1DQDH 3RWIB 2RQ8A 3DURA 2D7TH 3RZWA 1NL0L 4MCZB 2E27L 4IMLB 2X9XA 2EDEA 4CMHC 5DD1L 2VQUA 4XMLL 4XCFL 2IALA 4GBXB 1P4LA 4PGCB 1H0DB 5ALBH 2GY5A 1KB5A 1AXSB 5ILTL 1U9KA 3RZCA 3H0TB 4YX2H 4GMTH 1V3MA 2AXHA 1DQLH 1I8IA 4U1GC 2H45A 1ZVHA 2E7CA 3O6KL 1RZJC 1J0ZA 4LHJB 2MQ3A 2YC1A 4HUUA 4UT9L 4PS4L 4H8WC 4M00A 3DWTA 1CD1A 4ISVB 1ZLSH 3WLWC 5IT2L 1A64A 5KSAA 2VWEE 5EBMA 2Z9TA 1YNLH 4ONGH 3WLBA 4R97B 1ZT4A 5E9DD 5CD5D 1A6TA 4LCIL 1OB1A 3LZFL 1IC1A 1CZ8H 1SVCP 1BX2A 4P2QE 3HB3D 1PGRB 2P48B 3O3EA 1J18A 1MUJB 1UEYA 4P5TC 3QA3A 3R8BB 4IRSD 4XNMA 3KLHD 3QDMA 1JPGA 2CLVB 5MEPB 3PWJA 3LRHA 2LTQB 4LSQL 4TUKH 4NKOA 3EO9L 1U3HB 2JIXB 3X3GL 4J8RA 1SY6H 4NZTL 5FDYA 2R0ZL 4CJ0A 1S78C 3LH2L 3ZTNH 1LO0H 2AABL 3VFWB 5ABDE 2IPTH 3Q5YA 4YC2B 3OR7B 3PF2A 5D71H 1D9KD 3NFNA 3I6KA 3FFDB 5J57B 5EU3A 5BW7A 1JPSL 3ARFB 2CIIB 2QQLH 1MAKA 5FB8B 1MRCH 1V7NH 5IOPA 1LE5B 4KPHL 1P84K 1XF2B 4L3ED 3M1BB 1IGML 4WU5B 4JDZB 4QRUB 3GBNL 3R0MA 1QBAA 5EIIA 3D48R 1XGPB 3IDMA 3Q1SH 5IB2B 2R4SL 5DQ9B 1OAXL 5I1CL 3HE7B 5BXFB 4G59A 2SEBB 4ZUSB 2V5SA 4WFFD 3VXMD 4PJEA 3QNZB 1MCPL 4AEFA 2X05A 1JPFB 3VXUD 5DUPH 1I3RB 5KSVB 3HPLB 1P7KB 1II4E 5C0EA 5B38A 4N0CD 5C07A 5GJTL 3GKWH 4JB9H 4X99B 4IMKC 4PJXE 4MMZC 2XA8H 1FCGA 3IDYB 3BAEH 5DRNB 3C6LA 3D39E 4YQXH 4LAQH 1J5OL 2VSDA 4XRCA 4HK3J 2MQ0A 3QIWC 4HD9A 3L3GB 5IHUH 4KJWD 1H8NA 3BIBX 4BUGA 4RSVA 3RVXD 1JWMB 3E0GA 1RUAL 5CILH 3GJFH 1U8IA 3S34H 5EORL 5D70L 5BOPA 2VITB 4ZTOL 5DVNA 1MEXH 1Y18A 4GAJH 3SO3C 5DJ6A 2NNAB 1UXSB 2GJ6D 4HC1H 1TTUA 1DVFD 4G7YL 1WCBA 3FQNA 3CXHK 2KQNA 1ADQA 4HMEA 3G6DH 4ODXB 3S9DB 3TO4D 1TENA 3QNYB 4LLUB 5C6TH 4Y4KC 3H3PL 4TVPL 3RWEB 1D6EB 1A7BA 2WSKA 4XTRC 1MCHA 2WIIB 3HZMA 3O3DA 1BIIA 2EDQA 5T1LD 5J8OA 2E3VA 4X9BA 5I1DB 4G3YL 1BD2B 3E3QE 1SEBB 3FN0L 5ERWB 3BKCL 4N9GA 5DC4B 4WUUB 4MA7L 4C56D 3TV3L 1DCLA 4ZFOA 3MUJA 1KFAL 1S5HA 3UTZB 4JJHA 3RY4A 4H25B 3UJTL 5I1AB 4NIKB 2CR6A 4HH9A 1IQDA 1HXYA 1FGVH 4N1CA 4YR6B 1LILA 2HVJA 3LB6D 3TCLB 4OZHF 1KPRA 5EUOB 3LQAH 1BWWA 4PRIA 2FX9L 4PBWD 3HE6D 4K8RC 4ZOEA 2P24B 2WINB 1CD0A 3KDMB 4MAYA 3T1FA 3M17A 3FRUA 2ATKA 4OZGE 4N0RA 5EG6C 4M7LT 1QKZL 1I8KA 4G9DB 2X1QA 3BWAB 5CHNB 3VXTB 4QGTA 4G5ZL 4HLJA 2UVEA 4CN4A 1PG7H 1IL1B 5D7IB 4KKLD 1Y6NR 1T04A 3AAZA 1ZHNA 3L3IA 3JBG7 3KPLB 2O5YH 3OL2A 4H1LA 4JY4B 3EYQC 3MRFA 4V1DE 4UI2A 4OZIB 4JRWA 4U1IA 1KPUB 5JMOC 4XXCC 4OI8A 2ZUXA 2HMIC 1P9MC 3PWPD 4LIQL 1T7YA 5J12B 1NCCL 4MSWB 2AXFB 4NJ9L 3MLZL 1G6RL 4ZPTB 5FOBB 1ADQL 5HYSA 4JAMB 3TZVD 3U4EA 3DSFH 4OI7A 3BEWB 3N1QC 4FTVD 5TE7H 3ULVH 3BQUB 1RZKH 4AEEA 5DJDB 3D18B 5HHOA 4I3SL 4LHUA 1EHXA 1X5AA 3WNLA 3RPKA 1RJYB 4QYOB 4DN3L 3MZTA 3SCMD 1YPZE 3JWNC 4RIRA 5IMOB 3BDXA 4GG6A 3F5WA 3BH9A 3EAKA 3OKNA 2W07A 1A3QA 2XTJE 1J8HE 4IRSB 3CJJA 1M1SA 4JZOB 3DYPA 5C0IA 5DJAB 1JHTB 1S9VA 1X6LA 3BZEA 4KJPC 1MAMH 1R3JB 3V8OA 1CDIA 3RVTD 4OZFG 1HEZB 2WP3T 2A6KA 1EH9A 2J8OA 3OG4B 3WL9A 2HH0L 4KI5F 3CFIC 5FYKU 5C08E 2GCYB 2ICWA 5TQ2L 2E8ZA 3EOTL 3O45A 4NT6A 1KV3A 5IMLB 1B4JL 5JNYB 2VN7A 1A1OA 2EIBA 4C57C 1CGYA 4HWBA 2NY4D 1YQVH 1K4CA 4OFDA 4WNQB 3DROA 3LZFH 4JFFD 4QXGH 1KIPA 3T08A 2BVUA 4ZSOB 2CSPA 2MPAH 4OCRH 3C09C 4LCYB 4O4YH 3HG1B 5CD3A 3RUGF 5IMKA 1UZ6F 2QQKL 3SKNA 4LSQH 5DO2C 5IHBA 1ZVSA 5FYJL 3KR3H 3GIVB 1ZHKB 4X7TA 2Q86B 2AEQH 1QYGL 1YUHB 2EC8A 3LS4L 3H9HB 1Z6JT 2EXYD 3LH2H 3VXUB 3WS6C 2AABH 4M93C 2GFBA 3AY4A 4UUJA 2HVKA 4QRTB 1AE6H 1FO0B 1NAMB 1T1ZA 2QSTA 4GSDL 1I7UB 3VFGL 1IGTA 1YYLL 2PXYD 5A40E 2PYFB 3E6HA 4JLRA 4YO0B 3BP5B 1NLDH 3RVWD 5E5MA 1MHEA 5GRUH 1HSAB 5FDWA 3B8YA 3MSPA 4KPHH 4NCC1 1IGMH 4ZXBC 2X9WA 1LK2A 3ES6B 1KB5H 1IM3B 3ALXA 1FFOB 5IGXL 1QBML 5L9DL 4NKDB 2X70A 4BSWB 4JPIB 1SJHA 4AENB 1HINH 2WBWB 2JF1A 3C5ZD 1CL7I 4NRXB 5DMKA 1X4ZA 1P53A 4PJ9A 2JJTA 1AH1A 3EJJX 3OR6B 4ZFFB 4NQEA 3MO1B 1S9YA 1NCWH 3QIBB 2MWCA 5I1HL 3KLSA 4ZUWB 1U2CA 5GJTH 3QIUB 1N6QL 4HULB 3TO4B 1BFVH 3P30L 1MVUB 2FJGA 4YAQA 3GDBA 5D6DC 2C1PB 1OSPL 5E9DE 2D31B 4XH2A 1L8JA 2C3GA 2IADA 5T1LB 4U6HA 2ORBH 3BHBA 3O6LL 5DHYB 4MNHB 1BAFH 1EMTL 1JN6A 1FLRH 1FLTX 1XGTA 1QO3B 4F7EB 1VFMA 4FHBD 3CMGA 1NAKH 5DC9B 1RUAH 1JIBA 1F3DJ 4RFNB 3RL2B 4NBXB 4N0UB 5D70H 5EOCH 5J56B 4XNUL 3NIFF 1T20B 1U95A 3SDDD 3DMMA 4LRNH 3P3YA 2NY5L 4WEUD 5EZOL 5IV2A 2VDPL 3HE6B 4CADB 3P77B 2VOTA 3PHQB 4PG9A 4TUJA 2F53A 2HTLD 3IB4A 4CUCA 1XGQA 4K9EL 2O26U 1T6WA 1AQKH 5F1SA 1R3HA 5C3LD 1DLFH 1T03H 1HH9A 3X14B 1KENH 4C4KT 1QFWH 2A77H 5F70A 4G3YH 4NC1C 3C2AL 2AJUL 5B4MD 4L3EE 4F7PA 5GS0C 2ZCHL 3DX6A 3PWLA 5J89A 2YD9A 4FABH 3KJ6L 4JN2B 3S35L 1D6VL 5L7XL 4P9HL 4MS8C 2F8OA 3UJTH 1J05B 1UCTA 1DFBL 1C12B 4F7TB 4PRAA 3E1F1 1DQJA 3MV7A 4WFFE 5EFIB 1KCUL 4X6DF 5DA4A 2FEEL 3PWPB 5F3HB 5HGBB 3DI2B 1MF2H 1H15A 4GAYA 2WBJD 4MXQA 3VRLE 5FF6B 3GNML 3HZYA 4GT7A 4UQ2B 4YBQD 1IAIM 1MY5A 2VH5L 3AC0A 3TZVB 1PZUB 1OM3L 4FTVB 3JV5A 4WU7B 3V6FB 2Z35B 3D87B 3QNXB 2XN9A 2KL6A 2VDQL 1YMMA 1QNZL 1LNUB 4R96B 4XNQA 3JWDH 3JV4B 5HVHB 2LFGA 5FO9B 3HMXL 3DARA 1V7ML 3KPSB 5ICXB 3WIHA 3SCMB 3MRMA 3F7YB 4MNQD 5J1AA 1RK0A 3EW3B 4PJAA 4HF5L 3S6CA 1FZOB 3MLUL 2R0KL 4PLOB 4OF6A 2W65B 5FHAL 1P4BH 1I1FB 1LE9B 4WW2C 4TOYH 4MQ7A 5TDNA 1BBDL 4GRLA 4U1SA 2GJ6E 4IRJD 3KYKH 3IJYB 1PEWA 4NDMB 4QXUH 4QHMB 5I9QB 2R4RH 5T1MB 5DD6B 4N1HB 1FGNH 5INCA 4L29B 1KN2H 1DLHA 4HUWA 1P4IL 1ACZA 3LPGA 4HKZA 2DJSA 1FH5L 1TCRA 2J4WL 4I3SH 3ZO0A 3CK0H 2AJZB 3AS2A 2FHCA 4TUOB 4X5XA 1W0WA 4JG1H 3HC4H 4RMUA 1NC4A 4HEPG 2FRGP 2NY4B 2A83B 3W9EA 1TCMA 4KMQA 4RFOL 2V7NA 2MCG1 4JFFB 4C56E 1Q9LA 1K85A 2BVOA 1F4YH 4NRYB 3MRLB 4D0BB 4MZ2A 3A0OA 1M6OB 2OSLA 4PG2C 5ITFB 2Q6WB 4R4BA 1J1XL 1MHPH 4HK0A 4XVUC 2N7BA 5ESVB 5EU5B 2F54D 2FL5B 2F19L 5B3NA 3QG6A 3T8XA 2J3SA 4QO1A 1YEIL 4OZHE 2W0FA 2CK0L 1T21B 2HWZL 3MJ6A 1ZLWH 4E5XB 1WCQA 1A1MA 4XPTL 3CCHB 2HFFB 5HYJE 5EU6E 5BMFH 2Y5TA 3T3PF 4KMTL 1DN0A 3QQNA 1JNHB 3S97C 3GZKA 5DMJB 1N3NB 2VLKD 2PXYB 3HI1A 3LKOA 3EFDH 5E6ZA 4H1LH 3TFKC 1RZGB 5GGTL 2FO4B 3GO1L 4FP8L 5F3BB 1IAIL 2VDRL 3V0VB 2BJMH 3HN3A 5ID0A 2CDEB 3RJDA 1XIWA 3FHAA 1NBYA 5MERB 2JJVA 5IBUB 2DQIL 4CMMB 2UWEA 1JZ4A 1WBYA 5EO0B 5FYJH 3C5ZB 3MV8A 3T77A 1SM3L 3LS4H 1QLFA 1L9NA 1XF5A 4K3EL 1J8KA 5CBEB 1G7HB 3KPRE 1AGCA 3GFUA 3C6SB 1FG9C 3C9NB 4XAWL 1JHKH 4LLWA 4TRPL 4JKPH 2LU4A 4TVPD 3CNKA 2ZUVA 2VUYA 1HHIB 4Y5YC 2BSED 5MENE 2FBOJ 4UIMB 1WLHA 4MD4A 2RR3A 1MCCA 1KXQE 1OAZL 3MXWH 5HHMB 4PR5B 3V95A 4XC3L 3TO2A 1NDMB 1IC5L 5FGBC 1I8MB 2X4TA 3D3VD 3O0RL 4XMPL 3LQMA 2FNBA 3QUZD 4O2EB 4M1GL 3OKLB 4D0CA 4I9WD 3SDDB 3T0EB 4S0SD 3OB8A 4GQ9H 3QQ3A 3MJ7A 2X4NB 1M05B 2ESVE 1E28A 3LEXA 3MRKB 5CMAB 4BELD 5IMMA 1FC1A 1AGBB 1H3TA 1I7TB 2DLTA 2L7UA 3VGEA 1N6QH 1C5BL 1S7TA 3LVEA 4F15B 4WWKB 1UH3A 3V0WL 3CSYA 3IFLH 2G60L 4DKAA 2GT9B 4HWBH 4AH2A 3DX9B 3DNKA 3BIKA 1CG9A 1W72L 1XF3A 2QHLA 1T0MA 2VIRA 4RZCB 4PP8C 1QLRA 3I3EA 1EMTH 2ARJA 4KXZI 4OD2B 3DUSB 5D2NC 4OCXL 1JI1A 4ZG1A 1YEKL 3OKKA 1IGIL 3OTTA 1AD9B 1LQVA 2YRZA 3B9VA 4BQ9A 4DZ8A 2DKUA 1I9IL 5IBLC 1NCBH 3FAWA 4HLZG 3RL1A 4GKNB 3QZWB 4X80L 2WBJB 4DK6A 5CJXC 5DJZB 2NZIA 2VDPH 5D1ZA 3OKDB 4I3GA 2D0FA 5GGSB 3QULB 3W39A 2X4PA 4PRHE 1BZQK 2R0LL 4F7CB 4WI8A 5LJYH 4YIQA 1A2YB 3FFCE 3VXQB 1ZGLB 3PQYA 3SGDI 1OARH 1CBVL 1GZQB 1TZIA 3C2AH 1RZ8B 3S35H 3TVMD 3IDGA 3NH7H 1KTDA 4O00A 1LDSA 4P49A 4E41D 1OGTB 4Q58C 1TMCA 3BP7A 4NKMB 4D3CH 5A16A 5BZDA 3OKOB 2E7LC 1CDBA 3H42L 4U6YA 4CBPA 3T1WA 4P3DA 4D8PA 5C09B 3GNMH 4DKFL 4LPYA 4MAYD 1EHLL 3Q0HA 7FABL 4M9PA 5AYQA 3G5YA 3L6FA 3G5XB 2FEDD 5ITBL 2DI7A 2RB8A 1M7DB 1FG2B 4FZ8H 4JFXB 1QBLH 3WXVH 3DURB 4FN0A 5AZ2L 5D7JA 1UH4A 4GMSL 3GMPA 4NM4H 1QSFD 2IGFL 1KLGA 1F4HA 1TVDA 4F80A 5HPMB 5E4EC 5TF0A 2IALB 1P4LB 3FHQA 4HZLA 2QJDA 4Z8FH 3BXNA 4F8QA 2FHFA 3QCVL 3GHBL 3RZCB 1FV1A 1B6UA 2F5AH 5F1NA 1I8IB 2F54B 1BBDH 5FYJD 3SE8L 4PYGA 3NIFE 3ZE1F 1R5VA 4HUUB 4QRRE 5F9WC 3NZ8A 3UTTD 1VHPA 5HHOD 1RIVL 1CGTA 4NUGH 3NZHL 3K2UH 5I16A 4GS7B 5KSAB 1FAIH 2G5BB 5EBMB 3B8SA 2Y07H 1XCTA 2ZCLL 3OGCB 3ZDYF 1S9XA 1ZT4B 2WV3A 4BZ2L 5LGJA 3K8MA 1A6TB 3T09A 1REIA 1OB1B 1JRHL 2CDFB 3QEGH 2VLKB 1KJ2L 5DMGC 5TF1H 1BX2B 1Q72H 4RFOH 5HHXH 3QA3B 1T1XA 4JKWA 1KTLA 4XNMB 2P8PA 1CFQA 1JPGB 1CXLA 5DK0A 1BHGA 4EVNA 1G7IA 3U7AA 4CDHA 3TH2T 4F58L 1LGVA 4OJFL 2AP2A 4J8RB 2F19H 3HUJF 4U0RC 4X6DE 3H2WA 3UJJL 1CTNA 3I3BA 4TPRL 2WAHA 3VDAA 2WK2A 4P5MB 1MIEH 4LF3A 1MREL 1E6JL 2Y23A 1OCWL 3GGWB 5D6CA 2CRZA 4PLNC 2EYSA 3NFNB 5I74C 4LSTL 3I2CL 4JJ5A 3BGMA 4KMTH 5EU3B 3OF6A 3VXNA 4YHKL 4M7LH 2XKSA 1QRNA 4Y5VC 3WIHH 1PDKA 4KV5F 3NVQA 3ILQD 3MCG1 4I2XA 3BD3A 4XWGL 4DCQA 2X4UB 4MNQE 5F6HJ 3GO1H 5E0QA 4B50A 2YS4A 5F7KC 1IAIH 2VDRH 5H35A 1JHLL 1SMOA 2AKRA 3IDMB 4HJJL 3PXJA 4PLJC 4X4XA 3BDYL 2IMNA 2X42A 2DQIH 3L7FA 3D3VB 4IOSD 1FN4A 4PJEB 5E4IA 4J4PD 3S4SA 3ARYA 3QIWA 2IFFH 5IWLA 5EOTB 4P4KC 1TQCC 2I5YH 5I73B 1UEMA 4OF8A 5C0EB 5B38B 3PHOB 5C07B 3WJJC 5DD5H 1ULVA 1LO3L 4RGNC 5H2BA 5GGUA 4ZODA 4ZYKA 5CEZE 2X4OB 3C6LB 3CDFA 2V5MA 4OCSL 4CU8A 3NABL 1FCCA 1T5WA 5FECA 3ZSSA 3UTPD 4PY8I 3ZKXC 1NMCB 1IGFL 1RZ7L 1AO7D 3QR2A 4Y4KA 4L3CB 4CVZA 1OWRM 3K0WA 3C60C 1L9MA 2HT3D 4IDJL 3RY6C 2FH8A 3OXSB 1IE5A 1Y18B 3WNNA 2NY1C 2YD4A 2J8UA 3WIFA 1WCBB 4OZFA 1G6RB 2JB5H 2P7TA 2UY6A 1YY9C 5AZEL 2Q7YA 5LKNA 3NCYS 2GSIB 1DBKL 5DLML 4OCYL 1YMHB 2HFGL 4LSSH 4MYWB 3D0VA 3WD5L 5ESAB 2OL3A 3WS3A 3O3DB 3HZMB 2J88H 3T3PE 1EGJA 4MAUH 1CGSL 3ARDD 4HV8A 4N9GB 4PRNA 4MD5A 3FZUC 2NXYD 4ZFOB 1S5HB 4YHIA 1EIBA 2COQA 1NGZA 1U91A 1U42A 2WQRA 3JTSA 4HH9B 3TVMB 3T3MF 1IQDB 1KB9K 1HXYB 3AS0A 1TQBC 2HVJB 3L3HB 2QR0B 5HSFA 1V5JA 4PRIB 4R3SA 1GPOL 4I3RL 2B7DT 4MAYB 5CINH 2F53D 3M17B 2ATKB 3H7BA 3TNMB 4HMDA 5KVMC 1I8KB 4YDJA 4PJFA 2ZG2A 4FMKA 5TJWK 3PWUB 4TVPE 3W9DA 4GFTB 3GSWA 4NO3B 2HFEA 3B2UC 4PJBF 3CLEH 3SKJH 3U36A 1HYSD 1KNOA 4OGYH 2R2EB 4JFDD 1T04B 5T3XL 3AAZB 2BVPA 1E6OL 3L3IB 1QSFB 4LVHB 1ZV5A 3BZDA 4LBEB 4NQCE 1HHGA 2X6MA 3MRFB 4JM2D 2HFTA 4EI6A 4RMRA 5BV7H 3MV7D 4XPFL 5MEQB 1NCAH 4K23L 3WDHA 4MJID 2Q76A 4OGXH 1A7OL 5KANG 3RTQC 5SX5K 1ONQA 1CLOH 4ALAL 3U2SA 5HYSB 5I1IH 5B8CC 2PETA 4XVTL 2ZCKH 1EHLH 7FABH 5F7DA 4DZBB 5HHOB 4KC3B 3C08H 2ITCA 1OP5H 3MOQA 5KN5B 1QFPA 3STZA 2VMFA 4ELME 4GKZA 4XT1C 3QEQD 3SDAC 1CDJA 1D5MA 4RIRB 2ZUUA 5AZ2H 4P2OC 4GG6B 4YDLB 3F5WB 3BH9B 3ARZA 4KH2A 1NGQH 4L8CA 2NW2A 8FABA 3KJ4C 3DXAE 4RRPA 4JFZL 5C0IB 1Y0LA 5EZIL 4YXHH 1S9VB 4R4FL 3BZEB 2V5TA 2EH7H 3MLXH 3L7EA 1C1EL 4GRLD 3G6AA 4H0GA 3CVIL 4LIQE 5L2KD 2X4RA 2A6KB 4OQTA 1BMGA 3K2MC 3DO3A 3PUCA 1NPUA 1KULA 1CLZH 1JPTL 3AFLA 1ZEAL 4Z78B 2ICWB 1A7RL 3O45B 4BQ8A 4NT6B 1RIVH 2OCFD 3MQIA 3BISA 4ONFL 1ZT1A 4KQ4H 1A1OB 1MPAL 4OB5L 4BZ2H 1NC4D 4P2RA 1BVKB 1IC4L 3PGDA 1K4CB 1JRHH 3WS6A 4RX4D 3K1DA 2P44B 4GBXC 4PJGF 1EJOH 1NGWB 2GKIA 4XWOC 4U6VL 4Z7WA 5CD3B 4E41E 1ZOXA 5IMKB 3SKNB 2VDKH 4OJFH 1ZVSB 1JZ6A 4N8PA 3A6CL 2L0DA 5E1HB 3RWGB 4ZXBA 1CQKA 3NACL 1YEGL 4QRPD 3H9SE 3ROOA 5FYKH 5EBLA 1CE1H 4UUJB 2HVKB 1E4XH 4J12A 1EO7A 2DI8A 4AZ8A 1RZJH 1IGTB 4BZ1H 4LLMA 3E6HB 5C0AD 5E5MB 1MHEB 4H8WH 3QPXH 2ED8A 5FDWB 5C0BE 3L3JA 3PL6D 4P48A 5CZKA 3DO7A 1MHHA 1LK2B 1XIWD 4FQQA 1NBVH 3TJEL 2LTQC 3I50H 2X70B 1H9VA 1SJHB 2IG2H 1B3JA 3MV8D 1CT8B 2CJUH 5I1LA 2HJKA 1S7WA 1D5ZA 4PJ9B 4CRPA 3HRZA 2GJZA 3M8OH 1LDPL 3FB8B 4K94C 1S9YB 4HQQH 4YZFF 3KYNB 4YC2C 2EYRB 3UTTE 3ZE1E 3VXSA 1F11A 1LO3H 4LPTA 1AQDB 2V2TA 5HDQH 5IFHL 3HA0A 4P2CG 2YOCA 4YAQB 1Q38A 4KK9D 2NY6D 2H8PB 4XH2B 2C1OA 3ZDYE 4PY7B 1NFIA 4U6HB 1EEZA 2IH1A 3BHBB 2ERJC 1XGTB 3U30B 1FYTD 1NGPL 2Z31D 1LHZA 2BDNH 1U6AH 5IESL 2VXSL 5DFVC 3EJZD 3GSRA 32C2A 3L1OH 4LGPB 1RZFH 5A43C 3QXAA 4WGVB 3IAQA 5HHPA 5IVXF 2DQUH 4JQVC 1A7NL 2YRLA 3HUJE 5IV2B 5SWQA 5HGHB 5E08H 5AZEH 4PG9B 4V2BA 3MLTA 4KROC 4S0UC 2F53B 1ZLUK 1A5FH 5T5NG 1OTUC 2CLRA 3CZFA 2CKNA 2P5EA 4OLUL 2EDFA 5KSBF 1HH9B 1I85A 2WIMA 3QWOA 4GLRI 4OUOA 3RDTC 2G75A 2B5IB 5DD0L 1J88A 1DTUA 1OLZA 4F7PB 2AV7A 3PWLB 5E7BA 4I48A 4MQSB 3O41A 4JPVH 1IBGH 3F6LA 1G7JB 1U3ZA 3FN9A 4JM2B 1HHHA 1GGIH 3NFSL 1YNKH 3BWUC 1DQJB 3QHFH 5EDXA 3MV7B 3SE3C 2ZUQB 3LPFA 2V17H 2ZKHL 1A0QH 2Q8BL 3HZYB 5T3ZH 1DBAL 4I8DA 5HGDA 1F2QA 5D1ZD 4Q97A 2X89A 4UBDD 1MI5A 3U4BL 4YPJA 4YGAB 2XN9B 4WW2A 1TIUA 1YMMB 3WNKA 1DQMH 3UAJC 1ZLVH 1W0YT 4XNQB 4NHUA 2WMPA 3JWOL 2PN5A 4PJHB 3MOAL 3MRMB 4F9PA 4YHLL 5J1AB 5I76A 4PJAB 4CKVX 1RJZA 1AO7E 5C92A 3B2VH 1IQWL 2VZ1A 4BK5A 3B9DA 1L0XA 1RHFA 2EZ0D 2YEZA 4KK8D 2V5YA 4X6CE 4HT1H 1J12A 3ARSA 1I9RL 4MQ7B 5L6YL 2YUZA 4GRLB 1GZPA 5KVDH 2VN4A 4OZFH 4XPGH 4PJDA 2LVCA 4KI1A 1GHFH 1Q1JL 2DLIA 4UDUA 4PJCE 4XCNB 4P3WA 3LKNB 1EEYB 2WBKA 3W11D 1DLHB 1YEEH 2QKIB 1U8HA 4HUWB 5FYKD 1INEL 3ULUL 3O2VH 2OL3H 2NTFB 4HJGA 1TCRB 4NJAL 1LEIB 3TA3D 1EGJH 4PV8A 4YHZL 4U7MA 4X5XB 4K8RH 5I6XB 5LWYL 1JGLL 5I8KH 1U8KA 5D7JD 1NC4B 4NSKB 4HIEA 3CX2A 4U3XA 1HOCA 2V7NB 1Q9LB 4HG4J 2BVOB 5C0CD 5D5ME 2OSLB 3NIGF 2BOCA 1AFVL 5BRZD 4R4BB 2EH8L 2VDOL 4HK0B 1N64H 2EO1A 5J12C 3ZKMD 3FO0H 3T8XB 1TETH 4PP1D 3AUVA 5JOFA 1KG0A 4ZUUA 3WKMH 5AD0A 3KS0H 2W0FB 2R1WA 5K9OB 4QRPB 5F7EL 1A1MB 4TNWF 4AEHH 3DV4B 2Y5TB 4YHML 3GBML 1GGYA 4OIBA 4KK6D 5D93C 1NCDL 1DN0B 4K55A 4JFOA 1DR9A 5CD5C 5D7LA 1EO8L 2IAMC 3HI1B 2VC2H 3GMRA 3DV6B 1G6VK 3LKOB 2FX8L 4PJBE 3HB3C 1F3JA 1WTLA 3BIAX 3Q5TA 3PL6B 4IRSC 4UT7H 1F6AA 3KLHC 1WUNT 1XIWB 2NY0D 1NBYB 2BSTA 5I19L 1Y6MR 3E2HC 3TIEA 3QDJE 4MJIE 2UWEB 1VGKB 5E8DH 4Y5YA 4TULL 1CDCA 4AT6A 1UFUA 3MV8B 3T77B 1UG9A 3CSPA 1QLFB 3DVNA 4HCRL 3U9PL 1CXIA 2B1HL 4MXWL 1AGCB 1U8MA 3X11A 4OLXL 2VDLL 3U1SL 3PWVA 1D9KC 1LO2L 4LLWB 1IM9A 2OTPA 2IMMA 4G6KL 3P9MA 3OF6D 1Z9OA 4MVBD 4AM0A 4NGHL 1SJXA 1UZ8A 2NY6B 3NCFB 3QEQE 4P3CH 1EFXD 2RAMA 1WZLA 2YZ1A 3QEUA 1FYTB 3TO2B 3WN5C 3SDXA 4YNYA 1AY1L 2Z31B 3SE4A 4UV4L 4QY8A 2X4TB 1N4XH 2FB4L 2FHBA 4WEBH 1N8ZA 3R1GL 5GGVY 4OQTH 2XYCA 4XB8A 5L2KE 1N5YL 5IR1B 4LEOA 2O61A 3B4NA 1HNFA 1FBIL 1X5YA 4R7NB 5D2NA 3QQ3B 3MJ7B 1LDPH 4PB0L 5LQBL 3QDGE 4HKBA 3LEXB 4G43B 3EYFA 4N0CC 4H5SA 5IMMB 1F00I 5JHLH 2OXHA 3KHOA 1ZANH 1S7TB 3HFMH 1UT9A 1XCQA 5EN2A 3S36X 3VDBA 4B5EA 2W9EL 1FNSH 5L8JB 1EUTA 3BIKB 1CG9B 5CJXA 4DN4H 1XF3B 3NPSC 1T0MB 5IFAL 1KJMA 5JDJA 1QLRB 4X6BA 5CZVH 2ARJB 5T3XD 3RVXC 5DI8A 1X4YA 4OFVA 3W82A 4J6RL 1X44A 3ULVF 4TQEH 2BFVH 4PJGE 4XTRD 4DZ8B 4Y2DD 4JGUA 2BVQA 3MRCB 3RL1B 4M4PA 5J9PA 1HHJA 1DVFC 2YUWA 4C54A 5EU7E 5JQ6L 1AHWA 4LEXL 2YA0A 2R39A 4M02A 5D1ZB 2W38A 3T0BA 3TO4C 4EOWL 5JW3H 3MNVA 3W39B 2X4PB 4OV5A 3I75A 5IFJA 4KY1L 4XPHL 3UZEA 2E7LA 5CP7B 3HG1E 2C7UA 3FQWA 2FX7L 4G8IA 1KCSL 2FGZA 4YIQB 2NQCA 4GRWH 3PQYB 4DJMA 5DD0H 5JW5A 3MLWH 5EC2A 3BJLA 3L5XH 5CJOH 5DYOA 3MYJA 2HT4D 4GKOA 2Q87A 4RFNC 3IDGB 3Q6GL 3C8HA 1KTDB 5LVEA 3CXDL 1OTTD 4QWWD 4Y88A 5DZLA 5BZDB 1JL8A 1WJ3A 3FT4A 4WFHD 4U6YB 2X4SA 1EERB 4O5LL 4ZS7H 3V7MA 2IAND 3EOBA 4P3DB 4XVJH 2R1XA 5DFWH 4CMHB 1WAAE 3HE6C 1DBAH 4M61A 3ARUA 3ZMRA 3FMGH 3L6FB 5SWSE 1SHMA 2AK4E 5KAQF 4XNXH 4FG6D