5ACZA

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
269
structure length
269
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
total genus 61
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aczA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5aczA01
2AJSL 1GRWA 4LBEB 3CFKA 3EFFA 3HNTL 5K9OA 4DFIA 1KYOK 3SDXE 2FSEA 2NZIA 3F58H 5JOEA 1FGNH 5GGVL 5K9JL 3ARGC 1UXWA 4R7DA 3U7YH 5KSBE 2D9CA 2EO1A 2AP2A 1K8DA 4HLZG 4KZDH 4KKAC 1MRCL 4MD4B 4Z5RB 3CXHK 5KSUB 2F58H 4YZFF 5KJRH 2DQHH 2V2WB 5EU6A 3N0PB 2AJ3B 1FBIH 3OJ2C 2BSTB 1QO3A 5F96H 2PO6C 3KS0J 4U4BA 3LQZA 3RX5A 1OP9A 1E28B 4KQ3H 3EDFA 5F71A 1V3JA 5F93C 2CH8A 4NZUH 2X4UA 5FHBL 4HIEA 5B39A 1S7WB 4QRPB 4S1DD 4YDJA 3WNKA 3EFDH 3RX7A 1FFNB 5I15H 1O0VA 4YHLL 2R2EA 1U8JA 5L8LB 3D0VA 2I9TB 1LNUA 3PABA 3QI9A 4RGNB 2Z31B 3TJHC 1LGVA 1OPGL 4XNZC 4X9GA 5D96C 4JFQA 2VZ1A 4NNXA 2Z4QB 2J88L 1NGQL 3L3KA 1KJMA 1U41A 1RHHB 2O26U 3WIHA 4DN4H 3T0AA 3ARVA 1XGPA 4H8WH 5DMIL 2BOCB 1A6TA 3DX6B 1OQXA 2VL4A 4M62L 3WFDL 3U30B 4X0KA 4OLVL 5DD6B 4PJCE 1TETH 2V2XA 4F2MB 4PJ8B 1PYWA 1RZKL 1XGTB 3N1PC 4FFWD 5FUOH 1Q9KA 3UJJH 4LCCC 1GGIL 4Q97A 2BNQE 2UWEF 2PW1B 3QIWD 3SDDA 2QQLH 4N8VB 4ZUWA 3UPCA 2K1MA 5DRZA 3PDDA 5EWIH 5KZCB 4DQOL 3VFSA 3CPLB 1T66C 3D39E 1P6AB 1V8HA 3NCMA 3EOYG 3D5OF 3ZKXC 3VWKB 4EN3D 2N7AA 4V2CB 2MNUA 2P8MB 3RIAK 2IANA 5BZDA 3DYMA 4HUVA 1KTLB 1RUAL 3X13B 3ZDZF 3FHAA 3V6FA 3TYGH 4L9DA 5T1DH 2CSPA 3F8UB 4WVRA 1UENA 2ZCHH 5F88A 3RTQB 5TH2A 1EJOL 4LSPH 1PFCA 1XIWB 1HZHL 4UOW1 4P2QD 5IOPA 2APWA 1HIML 3KPQA 3RKDD 5LJYH 5FF6B 3CSYB 2IFFL 4JGJA 2H3NA 1IGIH 3CX2A 3QNXA 3BSZH 4QTIL 5DR5L 2DMBA 4KKBD 5F9OH 3O2VH 3SDAA 1MJ7L 3WMSA 2IGFH 4UV4L 2OP4L 3C60D 4OZHF 1CIDA 1FFPB 3MBEA 4Z7WA 1WFUA 1PY4A 3SE8H 3SQBA 1LO2H 1P7QA 5CIPB 2F5AL 4P5MB 4ONFL 2DQTH 15C8H 1KC5L 1YZZA 1YNLH 4NJAH 4LHUG 2RGSA 3HA0A 3B5HA 3B2VL 4WFGD 4DUVA 1XGRA 3O9WA 3MA7A 4PP8C 3A67L 1IT9L 4ERSH 3BPLB 1K2DA 4U1GC 2AEIT 1IFHL 1EH9A 3BHBB 4X80L 2OJEB 5FO9A 3VMPA 3VWJA 3LHPL 2VDQL 3ROOB 4DUWA 4KJWD 4TULH 2FJGB 2IC2A 4YDIH 4RMUA 5FYKU 3K81A 2Y6SD 2DWEB 4O2CB 1RZ7H 2VXQH 2ZJSL 4OFIA 4U31A 4IRJD 4X98B 4LOUC 5B8CC 4PJIA 5HDQH 3KR3L 5D7IA 3TN0D 1MAMH 1NEZA 4LSRH 3MYJA 5D7JA 1IAIM 1I7UB 2VDRH 2JCCA 1I9RL 2OTUB 5DSCB 5EUOA 3TZVC 1F90L 3LN9A 3QNYA 5ADOH 2P5WA 2NY0D 2NY5L 3G6DL 3VA2C 3BP4A 3BKJL 4C83B 4P9MH 4NNYB 3R0MA 4LEOA 5J6HB 1PY9A 1WJ3A 1Z9SA 2JIXA 2Z93B 2HH0H 3WFHB 3TJEL 1JI2A 1W72L 1IGCH 4PGEA 5B38A 4GG8B 2R2HA 3BDYL 2IBBA 2XN9A 4LSVH 3FAWA 2OI9C 3E3QC 3RVUD 3ZKNC 3CUPA 3NPSB 4LPYA 4O2FA 1A6ZA 2NY4D 1OB1A 3C5JB 2R0WL 5DEFA 5J1AA 1WEJL 2Z9TA 5IMMB 1QHPA 3FT2B 2GTZB 4RFEA 2ICEA 4G6AD 5I30H 4G80B 5IUSA 4P23C 1CDHA 4OD3L 3QXAA 3DBXB 3FT4B 3LDBC 1S9YA 4MVBD 5GGVY 3BZEB 4G8GD 2OCFD 2GY7B 2YUWA 3CFEA 32C2B 3MTRA 4I3RL 2YPLE 3PHOB 4P0DA 3ARQA 5HXMA 2OZ4H 2GQHA 4QXUL 3U1SL 3ETBF 3HRZA 2IQAB 2CLZA 2JJTA 1KLGA 4EXPX 1I8IA 3O3AA 3MPCA 1KB5B 1FO0H 1CE1L 3W2DH 1RIUL 1QRNB 3DRTA 1MJJB 5HI3C 3IDJA 2R0ZH 4KTEL 4QY8A 4WTXA 3MNVA 1C8PA 5D2LB 3L3JA 3FRUB 3KPRB 4N0FB 3CLEH 1U8QB 2NXZB 1YMHA 2QQQA 1M6OA 2CXGA 4C4KO 2J12B 5DD3H 1OHQA 3PF2A 3BAEH 2VABA 4ISVA 3VXUA 4V1DE 5IWLC 1INQA 1WICA 4YXKL 4Y5XB 5KVFH 2E6JA 2JCCE 1JK8A 2YPVH 3N85L 5KG9B 3JWOH 5DJYA 4X4XB 1QA9B 1CXIA 3LB6C 4XMPH 5EU5B 4U1HA 2YPKA 1XF5A 5I1AA 5L2JB 4NKMB 4LCYB 2FBJH 4XVUC 2YKLH 1S7XB 4JPVL 2XTJE 3VXME 3B9KB 4NN6B 4QXGH 4Z78A 1CVRA 2OJZH 3GSVB 3VCLB 3DO7A 1AXTL 2E27H 4ZUUB 4BYHA 3TIEA 3PWPE 4L8SA 1HKFA 4FQ1L 1HH6A 4HIHB 3W0WA 1G9MH 5EU6D 3ZTJH 5A43C 5KSBF 4LMQE 4HULB 4LGRB 1ZHLB 2NY2B 3QQ3A 5T3XL 3TLRA 2JB6B 2Q7NA 3G5ZB 3P0YH 2DI7A 1A7NH 4U6HB 4XCCL 1CF8L 1MVFA 1W0YT 3RP1A 3TWCH 3I6KB 3TO4A 4OLWL 2J8UB 5I8KL 4L3EE 4WEBH 1RAMA 4TN9A 5GGQL 4OTXL 3LEVH 3ULVL 2YWYA 3GJFB 2R0LL 4MDIB 5SWZE 1KCGC 3MMEB 4Y4HB 2OL3L 4M61A 1CT8A 4FXGB 2AW2A 5TE7H 4JO4L 4DUXA 5J8OA 3I84A 1M7DB 2IG2H 2DM7A 3SDCA 1TZGH 4GG6E 3VXQA 4ZSOA 3HNTH 4Z0XA 4O2EA 5C0NC 4BM7A 4O58L 1Q9LB 2Y72A 1WZLA 3MV01 5E2UH 4MD5A 4YFEA 5E03A 5IMKB 2VDOL 1SMAA 3RZCC 2HN7B 2FEDD 5J3HC 2C3XA 1X6LA 4WTWA 4KRNA 1Q72L 3TBWB 3BEVA 4WI8A 4ZNCD 2ATPA 4KTDL 1G6RL 4EIGB 3SDDD 1A1MB 3VXUE 2GY5A 4PJCF 4X4ZA 3P9LB 4JFEE 3I6GB 4RGNC 5F7WC 2Z31C 2EICA 1DBJL 4D9LL 1B4JL 2X4NB 1QSZA 3MRPA 4A6YB 4CBPA 4FQCH 4WI2A 1ADQH 3D6GA 4APQB 1V3MA 5EO1A 3MSPA 4XCEA 4HBQA 1JYNA 4QHNA 3BUYA 2IAND 1MWAB 3DHJA 1MQKL 4ODTH 1QBLH 3RUGB 1KG0A 3GSXB 1HQ4B 4EVNB 3LRSB 2UZIH 2HFEB 3MRRA 2EE3A 5JZ7D 3KLDA 4Z8FH 2IAMB 2IH1B 3IDXH 3P77A 1U8HA 2EIZA 3U30C 1JZ3A 4MYWB 4RQQA 2VIRA 2DM2A 2EYRB 4JAMA 2YD4A 4GQ9L 3MOAL 3O6FA 3U82B 2CDEB 4NC1C 4TRPH 3L5WB 4PJ8C 3WHXA 2Q86B 4B7IA 3C8KA 3NTCL 2FLBT 2I27N 5T33L 2FL5B 2YD3A 5K9QG 4JFDA 1H0DA 3MFFB 3S34H 3SDAD 5I1EL 4NZRH 2JKXA 5C0CA 4FTVE 3MBED 4YE4H 1LP9E 3VWKC 1P7QD 3B5TA 2DTSA 1LDPH 1I1AB 2XZAH 4BSWB 2H9GA 1AGEB 2VXTH 2PR4H 1W8OA 1IGFL 3GIZH 5IBUG 3MJ6A 3RTQC 5DD5H 4JJ5A 3O9WD 5FV2A 5MEQB 1XIWC 5IEKB 5JXEC 5ESAB 3NAAH 2BMKA 2A0LC 1I9JH 1C1EH 1D5MA 4GKZB 5ISZA 4FNLL 3VWJD 4PJHA 3UTQA 2FD6L 4MAYA 5J11B 3BQUB 4U1LB 5F1SA 4NGHL 1JGVH 4QYOB 2CIKA 4ZSOE 4NZTH 1R3LB 4I77H 5DVMA 5ACZA 3QSKB 3QIWB 2I5YH 4N8CL 4PS4H 1PZ5A 5GSRB 2W60A 3QUML 4D0CB 2X4TA 3TVMB 5BVJA 2YD8A 4FFVC 2XYCA 2EDJA 3PG2A 1U8MA 2A1WL 3X11A 3DURA 4XVTL 2DWDB 1BZ9A 5KVEH 1WBYA 3SGJC 2NW3B 4CVXA 2P5WD 5E2WL 3CMGA 4HK3N 4PR5A 4ODVH 3UCRA 1DANT 1HILA 3WNOA 1YN6B 3EUUA 1AQKL 4NKIH 4AENB 2OP4H 4EI5A 2OZ4A 3X12B 5I8OH 2C26A 4HWEL 4E41B 4FG6C 1HK6A 3H8NA 3UTZA 4JZOB 2JIXD 4NUGL 2AS5M 2Y7QA 3AMKA 2B39A 1VPOL 3VD9A 2LQRA 2XN9D 4BFIB 3JV0A 1DBMH 3OGCB 5IHZA 1FO0A 4IHOA 2HVJB 4H1LB 5CSGA 1MH5B 1TVBA 4ZO7A 3UAJD 3DROA 4DOHE 2VLJB 2FJFB 4Q9QH 3RBSA 7FABL 3IJYA 3RA7L 1X5IA 4GKNB 1Z9MA 4X5LA 1HDMA 3IDMB 3WNNA 1TJIH 4OZGA 5HPMA 5HYJB 2ZOLA 3W11C 3ECBB 4L4JA 3RGVD 2X40A 5T3ZE 3H9YA 2YD6A 3SKOA 4PJ7A 2OTPA 1JPSL 4GXUM 2EH8L 4LARL 1UKTA 3WIIL 1BVLA 4Y5VA 3BPCA 4HKZA 1IVLA 1P7KB 5TE6H 4R97B 5IFHL 3GUTA 2BY2A 4WJ5A 1KELL 4PV8A 4OFYA 1FORH 3NPSC 1A02N 3TP4A 1EGJH 2QQKL 1Q0YH 4MWFB 3BKJH 1DQQB 2V17L 3MX0A 4OUOA 3Q6GL 5HHVL 4QKXB 3K7UA 4N0RA 1XR8A 3H9HB 5IK3A 3SJVB 2VLRE 3ARBB 2VWEE 3L3GA 1FDLH 1TMCA 5BXFB 2AJXL 4JFYA 5DQJB 4HPYH 5FIEA 3RWCA 3ALWA 5L2KA 5I1HH 3QG6A 5J12B 1AGFA 4PTTA 3DRQB 3NBNA 5FUZL 5GQBA 4Z76B 2V7NB 3RAJL 3U0TA 3GSRA 4F9PC 5FYKE 1I8KA 4NRXB 1P4BL 1XF2B 3JTSA 1FL6A 1SMOA 4ACPA 2EIBA 5EO0B 3FB6A 1F58L 4Q6YA 4NKDB 3VFPA 2GITA 4ZXBB 3MV8A 4WW2F 3VRIB 2VQUA 4UNTA 1VFAA 3EDDA 3QCTL 5H37G 5F3HA 1DCLA 3TFKA 5A3IC 1S78C 4QXUH 1F6LL 4L9LA 1JGEB 3HUJA 2VKWA 4JLRB 4CJ1A 2A6JA 5T5NG 2AQ1A 4U3CA 3S37H 5EOCH 1VKXB 4K3DL 2NXZC 1KLFA 5T5NF 4MNHB 4R2GD 3STZB 4LPCA 3L7EB 4UI2A 5I9QB 1WC7B 5ALCH 2KDGA 1J8HE 2WINA 3W0WD 5B38G 5CD3A 1BM3H 3FB8B 3ZTNL 3QDJE 4Y5XC 3IT8D 1CLCA 1UWXK 1YYLH 2BRRH 2R9HD 5DJCA 4N90D 1YDPA 3M1BA 4PRDB 5ICYA 4PB0H 4Z95L 3S9DB 2ZUUA 1ZLUH 5ETUB 4KV5E 4NHCH 5BS0E 3TA3B 1HH9A 4I2XA 4NQCB 4ZFOB 2FNBA 3UJIH 3TO4D 1FLRH 2FR4A 3QWRD 3GSQA 5HHMA 1DZBA 4UBDC 3TGXA 3Q6FB 2NTFB 1JHTA 2H32A 4KKLD 4NSKA 5E94B 3HG1B 4PD4J 4XP5H 1WWWX 5TGBB 3H6JA 1NL0L 3B9KC 4PJ9B 5JHDE 2F74A 4UDTA 4NN6C 3IF1A 5ACLA 5IIEB 3VFGH 3QHFL 1J05B 3CLFL 5GGSB 1AKJB 4LLAA 1YQ2A 4KRLB 1WF5A 2BCKB 3RBGA 4HUWA 5IQ9A 4X6FB 5ID0B 3V4UL 5BV7L 5D6DC 3F7RA 3SDCD 1IM3A 1IEHA 2BHUA 2XKNA 1OAQH 3MNWA 4RMRA 4OM1L 3REWB 2NY2C 3MCG1 3S36X 3CX5J 2HKFL 3H3KA 4OGXL 3LN4B 2QV2A 3QDMA 3FN0L 4XAKE 1IQDA 4GG6F 4M4RA 2PTTB 3LZFH 3THMH 5C09A 5C71A 3F12A 1BPVA 4QHMA 1ZA3B 3MFGB 4KGLA 4FQ1H 2WBWB 2CUIA 3IDGB 1M1SA 4LQFL 4Y4HC 5T3XH 5IBLD 3GB7B 2EKSB 4JRWA 4PRBA 1XGUB 5TDOA 2FX8L 1N3NA 2J8HA 3JVGC 5GRJH 4HUXB 5CMAB 3VDCA 4EDXB 4KRMB 1LQVA 1ND0B 3MV9D 4ELMB 4OLWH 3E1F1 2J4WH 1HEZB 5DD1H 5GGUB 4XT1C 4V3DB 4WW1A 4QXTB 1HHGA 4WCYH 2GJJA 3C5ZB 3RY6A 2NX5B 1LK3L 4NQEB 2EXWD 4U7KA 1K8IB 1V7MH 1P6FA 3NN8A 3O45A 5EN2A 5DZNA 3WLBA 1G7QB 3V8OA 4E9LA 3O6FD 4PJFE 3IRPX 2X4SA 3DTXB 5IW1A 3MLWH 3NCJL 2Z35B 3VFMB 1ZLWH 1C5BH 3O3BB 4JFDD 1A2YB 1N5AA 3S97C 5MENB 2VLKE 4HHAA 1ZTXH 1DP0A 3IJSA 4PJAE 4G9DA 1FC1A 2QBWA 4NJ9H 4X5XB 3F6LA 5C0CD 1JGDB 4APQC 1NDGB 3IAPA 3S96A 4YDKH 5JW4Q 3KYMA 4HXBL 4MJ5A 5K9KA 4G9FA 2R69H 1E6JH 3PNWA 5IGXH 4S0TD 3PDOA 5I1KL 3P11L 4AH2B 1N26A 2V5YA 1FFQA 4XX1E 2IAMC 5D5MB 1BBDL 4GMTL 4AK1A 2CPCA 1LP9F 1G6RH 4JHAH 3BE1L 3OXSA 1QFOA 3NFPB 1G1YA 1AR1C 5D1ZB 5IJVA 4HQQH 4MB5A 5GS0H 4EKXA 2DMKA 1WQVT 2WWKO 5ISZD 3EOBA 1YN7A 3STLA 1JF6A 4MAYD 2OR9H 3ZMRA 1VB9A 1MCPL 4ZQKB 4S1DC 1UB6A 1LO3L 1G1CA 5EU4B 5JLZA 5HI5C 1N59B 5JR1L 3CXHJ 2CRIA 4JR9H 3CAFA 1RU9H 4JFHD 2QR0A 1MHPL 1ZHKA 3BKCL 3MRGB 1EO5A 4E42A 4XTRC 1HHIB 4H0GA 5HHOD 4ZNEE 3UC0L 4DJMA 1I1AC 1ED3A 1T2QH 1F4WL 1BQSA 5TFSL 5BJTB 4ZYKA 4LLDA 2X70B 1EXUA 1B0GB 3GO1L 3U0WL 5F7YC 5BZWA 4XVSH 3T0XA 3U2SB 2DYPB 1MCNA 2F53B 4P5KB 3MV7E 1NC2A 5E1HB 1YEGH 4EI5D 4PUBH 3DUHA 4HC1L 4P5TA 4M48H 1BQHB 4JQVC 1IEBB 4GRMA 2DDQH 4D0BB 3BW9A 3PIQA 3HB3C 5DF0A 2HFFA 4WI5A 4QRQA 5J11C 3BQUC 5J1SC 3L5HA 5E6ZA 4IMLA 2P44B 5I8EA 5HYSA 4UTBH 5D7LA 1EGJA 4PTUA 3QIWC 1IGTA 4HGWB 2ITDB 3U7AA 5I73B 1KLUB 1C5CH 2VAAA 3GMPB 3TVMC 5I19L 2NMSA 5IB3A 3QRGH 3OB8A 5CILH 4S1QH 1OAUH 1W72A 1QEWA 2FD6H 4HCRH 4XRCB 1WFTA 4ETQB 3SKUD 2HTLD 3B9DA 3O6KH 4KAQH 4HS6A 3OPZH 3MRNB 4Y16A 5E5MB 3O3EB 4I9WE 3TCXA 5CUSH 3JTTA 3HZYB 1KN4L 4NP4H 4XCNA 5DJ8B 2W65B 3Q48A 1P7HL 2E8ZA 4K9EL 3VFTB 4J6RH 2Q87A 3LVEA 3F7VB 3RKDC 5GJTL 3DX7B 3GMNB 4DKEH 4PREA 2CUMA 3B2UC 3IRZA 4G3YH 3ZZ1A 5GZNC 3WUWB 2XA8H 4OFYD 5CJBA 4U1NA 1L0XA 3SOBL 3BJLA 1QZ1A 2CLRA 4QRRB 2XXCB 2Z8VC 5MERA 3IDNB 4C56E 1NGPH 4GBXB 3DVGB 4P3DA 1ORSB 3S35L 4KVCL 4FOMA 1QLEH 2AXFB 4G59A 5JW3L 1JBJA 1MI5B 2VDPH 1DEEA 4UUJA 4FA8A 4JJHA 5L2KD 5H37H 1VPOH 1A6AB 1AQDB 1DDHB 3WBDA 4EQ2A 5EBLA 4CN1A 2WSKA 2DL9A 2HRPH 1VGKB 1BQUA 3KXFE 5C0AD 1X3DA 4TSAL 3WDJA 4R97C 4BH8B 4POZD 3QDAA 4PRIE 1S9WB 1TJGH 3RNQA 2HJFB 4NM4L 4Y4KB 4ZUSA 1MJ8H 4IDJH 3F7YA 3H9ZA 2Y6SC 3KYNA 3MV8D 1DQJB 4J2XA 3BEWA 3HNSH 4Z0BH 4JKLA 3DI2B 1CIUA 4EUPG 3LQMA 4FMFA 5FM8A 3TFKD 3RVTD 4Z77B 1PBYA 4H25B 4JFXA 3MRIB 3S7GA 2R4SH 1ZT4A 2B4CC 1X5YA 5D8JH 5ALBH 2EDXA 4YK4B 1G7IB 4Y19B 2D7PA 4HUMB 3ULUC 5CCKL 5J12C 4KQ4H 3CMOH 3GSNH 2B2XH 2F8XC 5IQ7L 4X6DE 2I07B 4MNGE 2D7TH 3W9EA 2Z91B 3DPBA 2V17H 2L0DA 5FCUH 2PF6A 4Z7VB 3QZWA 3V6ZB 5HHVH 1H3GA 3AC0A 4F37K 3O3UN 5JPMA 1UKQA 4NRYA 5FYJL 4OV5B 3QWOB 2AEQL 1MREL 5CZVL 1XCTA 4ZXBC 1BX2A 4GKSA 3PWUB 4PJBE 4X8JB 2VOTA 2F8VA 1X5HA 2G5RA 1R5IA 1FL5B 1NLBH 5FUZH 2XZZA 2DKMA 1EERB 5CD5D 2VR5A 1LE9B 2H2PD 4UT7L 4OGYL 5HHMD 2BJML 4MXVE 3T09A 5EB9A 3RWIA 1AGDA 3VRJA 1NANI 4XH2B 4MDJA 5JHLL 3OR6B 1ZGLM 4TTDC 4KV5F 1XZ0A 2ZSWA 1UYWL 1IJ9A 3B9AA 3KDMA 1A7BA 1TITA 4GW4B 4JFPA 5KSVB 4MVBC 4WHCA 3GK8L 1YEKL 5F89B 5I1DA 1JTPA 5I9QC 3QP3A 4XCFH 3V79C 3BVNA 4WTZA 4OCYH 1OGTA 4PJ5E 1QLRA 4DZ8A 3SKMA 3MJ9L 1CD0A 4F7PB 5IVXA 1MHHB 2P48B 4R26L 3QDGA 3L95B 4NN5B 2R1WB 3OKKB 5TPWH 2ILLA 1FYHB 1OAZH 4GUPB 3ZLQC 4BUHA 1XCQA 3QDMD 5I17A 1CE6A 3TA3C 3D69A 5DA0B 1JV5B 2AK4E 4UB0L 4HGKC 4RIRA 1CLOL 4X6CB 5C09D 4R8WH 2QHLA 3D25A 3HMWL 1FN4B 3O4LB 3T65B 1P69B 1JZ6A 5IB1A 3T04D 1S7RB 1TCRB 3ZTNH 4NRZB 5CEZL 4PJ9C 1QNZH 5C6TL 1D5ZA 5ICXB 2FHBA 2X4RA 4ONGH 4JPWL 2VXVL 4J8RB 5GRWA 2YA2A 3JTCA 1ULVA 4Q74A 1BIIB 2BC4B 4P9HC 2H6PA 4XVJL 1G6RA 4XNMA 1TZIB 3WXWL 1Y18A 4O02H 1J86A 3BESR 3MLYH 4PIRF 1OCWH 5DJZA 2GJ6A 1K4DA 1EHXA 1MPAL 5F7MC 4XP4H 3WL9B 1D5BB 3GMRA 5C3LD 1QVOA 1I7TB 3QHFH 3BIAX 3CLFH 4U7MA 1SVCP 3DXAA 3FQXB 2MFNA 4Z9KB 5AUMB 5EIIA 5DK0B 4LASH 3FOMB 2I25N 5H2BB 4TYUA 4WI3A 5DRNB 3CFBB 1P9MC 1CFTB 4X7TA 2YD7A 1DUZB 2Y36L 4PJFF 1CK0L 2Y06L 1BD2E 4PJGA 4ONHA 5JUEH 1ZOXA 2M2DA 4YDVB 1K4CB 1CWVA 4HFUL 4QT5A 3VA6A 5HYQA 2PUQT 1D5IH 1YEEL 1EJ6A 4G9FD 3FQNB 4W6XB 1SJVA 4Z7UA 1IGYA 1SJHB 2AJZB 2B1HL 4PJAF 1KACB 4JANA 1MSPA 1H5BA 1RIVH 4JM2F 1NMBL 3MLVH 3GSOA 4MJ2A 4LRNL 3C5ZC 1HINL 1Q9OA 5LBSH 1OGAA 2EIDA 1IGMH 3MBXH 1I9EA 3PHQA 5L7XL 5TQ0H 4P48A 1S7QA 3A0OA 4JDZB 1KPUA 4XX1G 4KTYA 5CJQH 4JRXE 4B50A 3LEYH 2EC9U 3GNML 1ZT1B 4L29A 2ICWI 4R4BB 1K5NB 2V5RA 2HA1A 1EV2E 4X5WB 3KWWB 4X9BA 5DK2B 5A2JH 1KEGH 1L7IH 1N6QL 5JQHC 3ULVE 1CGUA 2BRQA 4ZPVB 3GDBA 1GGYA 5D1QA 5E6IB 2XI9A 4JFZL 4AQ1B 5JO5B 3ZKMD 4QCIB 3MRCB 4ZAKA 3OAYH 4K94H 5H94A 2QL1A 3UTSB 4OCNC 4HKBB 1KIRB 2OTWA 2YUVA 1LE5B 3W82A 1PSKL 4GJTB 4NUJB 2NY7H 4JPIB 3HLAA 1PG7L 3DV6A 5E2TH 5DC0A 3E2HA 3MLZL 5D1ZC 1RZGB 1NC2D 4JKPH 3BO8B 3VDBA 3NCYS 1NEUA 4P5TD 1BFSA 2ED9A 4F58L 1UH2A 3KYOA 4HXBH 4JHWH 2YMXL 2FB4L 2ARJB 1U93B 4ODUB 4MCYB 1F5WA 2CD0A 1FYTD 3V52H 4CVZA 4PV9B 4MCZA 3RVWC 4BFBD 3ARUA 2HFGL 4JG0L 1BBDH 3L3OB 5D7LD 2Y5TB 3MRBA 2E7LA 2E8YA 3EO9L 4YHIB 5T3ZH 2LVEA 1G0XA 2XV6B 3Q5YA 2P45B 2ZPKH 4U3HA 1I3UA 3S5LG 5EORH 3QQ4B 4PGCB 4LNRB 3HHRB 1U3HA 4KXZH 2O61A 4JRYA 5ADPH 3PWLB 2HJKA 4Y16D 3V0VB 3FT3A 4MNQE 1DQML 1Y6NR 3ZDXE 3BKCH 3H42L 2FIKA 3ZSSA 2F5BH 1L4IA 4KHTL 4HJ0D 3NIGE 1I3GL 1NBZA 4FS0A 4KK9C 4KK5D 4LPUA 3DVNA 2X1OA 2A9NH 4EXKA 4NHUE 4H0HB 5TFSH 4ZDHB 4DGIH 1WZ1L 3VXTA 5C0BB 1EZVX 1LO5A 1BJMA 1MRDL 4G6JL 5INDB 1UJ3A 4Q9CA 2YN3A 4M02A 4MA3A 3LS4H 5I73C 5C6WH 4D9RD 3I50L 4JM4H 1EO7A 2ICWA 4BFGA 1NMAH 4WDIA 3GMMB 3LPWA 5HY9A 4WNQB 3EGSA 2BNRA 4CMHB 3GSNA 3CZJA 3ES6A 3MRHB 3FMGL 4RMWA 4KPHH 3MLXL 4R7NB 1N64H 5EFIA 1FNGB 4XNXL 4JKMA 1FAKT 2M8XA 4KROB 1CXLA 1DE4A 4PY8J 3HCVB 3OJDA 4X7EC 1U6AL 5E6YA 1ZEAH 1KB9K 3D3VA 2EDWA 3NFNA 4U1JB 4PJXE 3ILQC 1QLFB 3T77A 1NBVH 4RSVA 4KI1A 4C55A 2UZYB 2DICA 3FB5B 4AYFA 3LRHA 1KN4H 1G9NC 3L6FA 3BRGC 4Y4FB 1XEDA 4GBXC 2KH2B 1YEFL 5D70H 3BH9A 3GBNL 4ZOBA 5GJTH 2P5EB 3PXJA 1U9KA 2G2RA 3KVQA 2PYEE 5C7XH 3MGTB 5F9JA 1J1OL 5MEOA 1A1OA 5C08E 1F6AA 2FATH 5CP7B 3TPUE 2VH5H 4WHTB 3T0EA 5C0GB 3PWNA 3SOBH 5LGHH 4F57H 2V2TB 4JB9L 3I9GH 1GC1H 3DUSB 5FECA 4WFED 5HVGB 2EE9A 5ILTL 4CW1B 2BVQB 4K2UL 4X6DF 2UY6A 4Y7MA 4Y4KC 5FYJU 5HGDA 1D3CA 3CXDH 2EDDA 3WO3B 1S7TB 5IW3A 4AY0A 2A2QT 1TVHB 3PUCA 4K3EH 4XPFH 5M7QA 2F54B 3OR7B 1URLA 1KCUL 5T3XD 4R90H 1D5XB 3IFOB 4YK4C 1A9BA 5FA4A 5LAXA 3LAFA 4RA0C 4XP6L 4PJBF 4YHKL 1P5VA 2ESVD 4WRLA 2DQDL 4ZMAT 5DJ6B 4RBPK 1SJXA 4NM4H 4M6OL 3RGVC 5DUBA 4MXVF 2AEWA 3EO1A 1HOCA 1M7IA 1QSFE 1YA5A 3LPFA 2EKJA 4J4PC 2J6EH 4Z7NE 1KGCE 2WUCL 4GSDL 1FVDB 4QOKA 4ZTOL 4OLZH 2GFBA 4G8FB 3KLSA 4YWGH 5T5FL 5C0AB 4PY8I 1NGWB 1INDH 4CADA 5CCKH 3QEQA 1OW0C 3WXVH 4Z7QE 1Y6MR 1EX0A 43C9A 3TNNB 1CLYH 4ZODA 5IQ7H 5C0DB 5BW7A 1IBGL 1U58B 3JBG7 3G5XB 2GAZA 5FYJH 2P8LA 2A77H 5D6CB 2AEQH 4OCMC 3UXFA 5GJSL 2ADGA 1PW3A 3RWFA 2UWEB 3WO4B 1BVZA 1OQOA 4ZFGL 4DAGL 4HV8A 3VW3L 4OFDA 5GISL 1MVUA 1QR1B 1P84K 3CD4A 2ZSVA 3V0AC 3QHTC 4MQTB 4LRIC 4OGYH 1CFSB 2MHAB 4U33A 3QUYA 4TUOB 1M05A 3WN5B 3WJLC 4NN5C 3Q3GA 1OOAA 3V5HA 3B3IB 1R6VA 4NT6B 2GJ6D 3JZ7A 3GHBH 3MGAA 4MA8L 1VADB 2FH8A 3DXAD 2ENYA 3KPNB 5KAQF 4N0UE 2DQGL 3LKPB 1V3LA 4ORGB 3C9NA 3JWNC 5CWSB 4HIJB 1INEH 3EDJA 4JKWA 1T3FB 1LO0H 5D7SL 4RRPA 3I85A 1JNNL 2MKWA 1MRFL 4TOYL 3RDTA 2VKXA 3INUL 2W1NA 1IC4H 3NIFE 5DMKB 4KJYA 4ELKA 5KS9E 1I7ZA 3QFJB 3MLSL 4P3CL 4PRHE 4BFEA 5EOQL 3SKNB 4UB0H 1KB5L 4G7YL 1HXMA 4I48A 5EZJB 4YO0B 2NNAA 1X6NA 3UTTB 5BO1H 4H8WC 1JTOA 3HMWH 3K46A 3LS5L 3KPPA 1OGAD 2G60H 3HC0B 3IXAA 4YFLI 4XPBH 3FFCB 5B3NA 3PWVA 4LHUB 1REIA 4NZJA 1F8TH 3W9DB 5LGKA 4JPWH 4F8QA 3RWEB 3CC5A 3C6LA 4FQIH 5JPNB 1GXEA 1AGCA 1OTSD 4HMCA 5GIRB 5HD8D 1BBJB 3L3HA 2Y07L 1NDMB 4KKCC 1EEUA 1YNKL 2MTPA 2CKBH 5IMLA 2GCYA 1DL7L 1KJ3L 4OZFG 3ARGA 2EZ0D 5D1QD 5GS3A 3LKRB 4RCAA 5IEHB 3KPSB 3MRMA 4G8IB 4ZAKD 3UP1A 1UWGL 1H15B 3L7FB 4DVBB 2HWZH 3ULVF 4G6ML 5I18H 5IG7A 4O00A 4ORZC 3A6BH 2H2SC 3G04B 5TDPB 1X5AA 2PO6A 5KVMC 1CD1B 4LL9A 2EYSA 4M8QB 1CS6A 1FLTX 3ULSB 4HFUH 5DURD 5HYJE 5F1NB 2CIIA 1JZ8A 1T89C 2P1YA 3FQWB 1YEEH 4FFZL 1GGCH 5D2NE 4IM8A 3TBSA 4NIKB 4HZAA 2XWJB 4MJ4A 1JPFB 2YSSB 3UJTH 3DSFL 2YXFA 4LRNH 3QUKB 5ANMB 1IC5L 3QG7L 4HC1A 5E6IC 1AC0A 3P73B 5IBLC 5L7XH 3MLUH 3EBAA 3TJHA 1XGQB 4YXLH 4DCQB 3ZHDA 4J1UA 2YOCA 4OM0H 1N5YH 2XZQL 4LFHD 4DZBB 2A73B 4OCRL 1U3HD 5SWQB 4JRYD 1A22B 4GAYB 2L7JA 2W59A 4LLMB 3OKOB 5B4MD 4JFFE 5DD0L 1I1YB 4ONOA 3BKYL 3SE4C 4KJPD 4DK6A 4L5FH 3VXOB 1JPST 1J9CT 5FGBC 1HSAA 1KBGH 4U7SA 2GTWB 2YD9A 4ZTPH 2O5YH 4JPKL 4FFYL 5C0RL 2XG4A 3F6IA 1RQ5A 4LCCA 4H5SB 3RWJA 2JTDA 4LLYA 3ZDXF 5DJAA 2WQ8A 2G9HB 3DV4B 4OCWH 4NC2B 2HTKD 5HGAA 3NIGF 1X7QA 2PCPA 3MLZH 3QAZB 4HMDA 3MREB 1SYSB 4KI5C 3C2SA 5HHXL 2VE6B 1DQDH 3OKLB 1KIPA 2YBRA 2BNRD 4GS7B 4DW2L 2HG5A 1DJSA 3PGFL 3N9GL 5JXAL 1A4JB 3MRFB 3WUZA 1GOGA 3IXTB 2DQEL 4FABL 1FZKA 1RUQL 1T1ZA 2W9DL 1MCOH 1MAKA 2DD8H 4EIZC 1NUFA 1ZK9A 3D3VD 1PEZA 1XF4B 2UYLB 4G6KL 1MWAL 4U6XB 4YR6B 2CKNA 4XP9L 3GI8L 4RISL 3IAQA 4G7VL 2C3GA 4QGTA 2FBOJ 3HPLA 3NA4A 4L8BA 2QSCH 4OFKA 4FQHA 2A9ML 3U4EA 4PJXF 2ADJA 1I3GH 2WW8A 3HZVB 2OSLA 4CMHC 3T4YA 1WZ1H 3HE7B 1YMMA 5FB8A 1TQBB 5IHBA 3IB4A 4HX1B 1WTLA 12E8L 4WY7H 3S36H 3DHMA 1AFVH 4X9IA 3T0ED 1NJ9A 4KROC 1A5FH 1PGRB 3EYOA 3WV0A 2J6EA 5FCSH 1VGEL 2VL5B 4XGZB 1WFOA 3HE6B 1WIPA 5F7UA 2HMID 3SDXB 3LKNA 5E8OB 5IB5A 4F33B 1W0VB 5KSBB 1NFDA 3FMGH 3CU1A 2ADFH 2VLLB 2Q8BL 2BNUB 4XBEH 3PP3H 4OD2B 4HUUA 4Y4FC 3GHEH 3P0GB 5B8CA 1HHHA 2ORBL 2RAMA 3QEUA 3AB0B 1T0MB 3W5MA 4HJJH 4YAQA 4H26B 2MQ0A 5I16A 3FZUD 3VXNA 1T4KB 1OTUD 5DQ9B 3TZVA 5GRYA 1H8SA 1T7ZA 1TNNA 2HTLC 1JFQH 1JMZA 4BQ6A 4MSWB 2J3SA 5DYOB 1OP3H 4PGDA 5FKPB 3MR9A 4TVPE 4JY6B 1F3DJ 1RUPH 3D85A 1N7ML 3GJEB 3IJHB 4J3TA 3MROB 1TTGA 1QSEA 2HKHL 2X4OA 3GBNH 4HDIA 3VFRB 3KLHC 4QOKD 5IKCA 1T0PB 2VDML 3BP6B 4MJIA 1K6QH 1ZS8A 1J1OH 1MY5A 3QEQD 1BP3B 4GKOA 4IRZL 1JWSB 2NY3D 2OI9A 4OBSA 3E3QA 4Z7NF 4L4VE 3MRLB 3SY0A 2BSRB 1MUJA 4JB9H 5DQDH 5FOBB 4K7PL 5DEZA 4MZ3A 3H3PL 4Z7QF 2XZCH 2VITB 5CIPH 3T8XA 4P23A 1IGJA 4K2UH 4K7FB 4PJDA 4CNIA 3U0PA 1Q0XL 5AD0A 1FNAA 2VRAA 1Z0NA 4PJCB 3V4PH 5EZLB 3P2TA 4IBLT 2HT2D 3B43A 3GFUA 5FKAA 4XP1H 5IBTH 3DETD 1DUYA 4I3SL 2FJHB 3BX7C 4OFVA 5ERWB 1MFCL 4LLUA 3TESA 1S9VA 2BNQB 3QUYD 3VXSA 4F3FA 4NWUH 5DK3A 1DLFL 5E9DE 3NACH 1DEDA 1AIFB 3DX9A 4XP6H 4D2NA 4F7MA 4YHKH 1YMME 2DQDH 3D39B 5GSVB 1C12A 1A6PA 4LSQL 3MLPA 3TNMA 3PV6A 4E5XA 3O2WH 4PLJC 4JN1L 3IETA 1ROWA 4Q7DA 2CKBA 1CGTA 1MFDL 1WIOA 4MB3A 1QFUH 3WE6B 1JYWA 3MUGB 3G08B 1Z0MA 1KT2B 3RDTD 3WO4C 3LEXA 1FNSL 5SX5K 4OLXH 4JG1L 2BY1A 5D9SA 3NH7L 2PW2A 4PGBB 4B0MM 4CU6A 4P2RA 4XMLL 1F3JB 4HT1L 3WN5C 1CL7H 1H3UA 1YECL 3NIFF 5KS9F 5IWLA 1JHKH 4MD0A 1Q1JH 1NSNL 3MNZB 2BVOA 1V7NL 3Q0HA 3LQZB 1GHFH 4UILL 2CJUL 3H0TA 4YBQD 5IBUB 4DAGH 1BMGA 3CZFB 1B2WH 3EYFB 4HIEB 3MJ8B 1AO7A 2Q3ZA 3NCYP 3OX8A 3MLRL 2FLRT 5E70A 6FABH 5F1IB 2NW2B 2DI8A 4WFHD 1BZ7B 2BVTA 3ARGD 3FFDB 4OLEA 1RZFL 3QJHB 4UINL 2XRAH 2VQTA 1P4LA 4JDTL 3GZKA 1MFBL 4KKAD 5FHAL 3TBVB 1NC4A 2ZCLH 2FO4A 3GMQB 3T1FA 1P2CB 3BN9C 4JGMA 1QQDB 4IS6B 5SV3A 1WISA 3L3DB 2PO6D 2Y5EA 2D0HA 1PEWA 2X41A 3NFSL 3UYOD 3OWEA 5JQ6L 3SE3C 2XKUA 3BIKA 4AQOA 2MQ3A 5M94B 5A16B 4LBEA 2PN5A 3U4BL 4PG9B 1FCGA 1L7TH 4XPHL 3RRQA 4KKNA 2G5BB 3VXSE 5DZLA 3L9RB 2HRLA 1BAFH 4TVSa 3S88H 5E08L 3CK0L 4OB5H 1A14L 3HTLX 3DIFA 5DRZB 3TJHD 5LXGL 4KJQC 4MD4A 3EYUL 4ZFOL 5KSUA 2ZG2A 4Z5RA 2EDRA 1HHKB 1SY6H 5MEPB 2V2WA 3UO1L 4CUCA 5AZEL 2AJ3A 3H9SE 4WUUD 2HFTA 2BSTA 2YEZB 3V6FB 4XXDB 4YHZL 1Z9LA 1E28A 3EYSL 3QXDB 3VE0B 2C5DC 3RZCA 1JI1A 43CAB 3UMTA 5EU7C 1S7WA 5JTWA 5L9DL 1MLBB 1BOYA 4X7CC 4QRPA 2BVPB 3HR5B 4DGYL 5IHUH 1FFNA 1NGXB 2BHZA 2LU4A 3QEGH 4L8DB 4P9HL 4DVRL 5FO7A 4OQTH 3T0DA 3ZL4L 2SEBB 2I9TA 3FONB 4PG2C 3QCVH 2V5SA 1ZGLB 4AZ8A 4Z6AT 1LEKB 2Z31A 3ET9F 1KCRH 2GK0B 5D4QA 3IGAB 1T66D 2YPLB 3GM8A 2Z4QA 1ZVSB 1A3LL 4TNWF 1MIML 4GQPH 2DKUA 2VXSH 3BUTA 1RHHA 1EFXB 3CFDB 4S0SD 3U36B 1NCCL 4QHKI 2BOCA 4IEFB 3DX6A 5A1AA 4TUKH 3HS0B 1XGRB 4Y1AE 4PLKD 4UOW0 3Q5OA 5DD6A 3VH8G 2DQFB 4F2MA 3CH1B 4OIIH 4PJ8A 1XGTA 4GRLB 4XC1L 5FO9B 5JHDD 3ZYIA 2AJUL 4NO0B 2I26N 1ZAGA 2PW1A 2VDNL 5DUPH 2ENSA 4M6NH 4N8VA 4NM8H 5CEYB 1SM3H 3QAZC 3BMWA 3GJFH 5TF1L 1T7XA 4CN4A 3CPLA 3EDEA 5E4EB 2DOCA 1I3RB 3VWKA 4WW2B 2P8MA 3I6LD 4V1DB 2OK0L 1KTLA 5C0RH 5JOFB 4FQQB 4K7PY 1T1WB 2JCCB 5IESL 2DM3A 1NCUA 2D0GA 2NLJB 3I2CL 1HKLL 3RTQA 3H3BC 4Z18A 4RFOL 3Q1SL 5HGHB 1XIWA 3EOTH 5JXEA 1RPQA 1CBVL 5KANI 3QHZH 2X42A 3CSYA 4LEXH 5FF6A 1BFVH 4CU7A 4TUJB 3CDCA 4I5BB 3C08L 2XTJB 1JRHH 1FV1B 4XB7A 3VXMB 3WSQH 4DW2H 3ZDYE 5B38B 4JQIH 4KMLB 1KEMH 1KJVB 5EZIL 1FFPA 2V6HA 1RUQH 3PWPB 1DN0A 2W9DH 1YPZE 5FYJD 5CIPA 4A6YH 4C58B 5J1AB 4P5MA 4PRPE 3HE7C 4RFEB 1TQBC 3IFLL 1MWAH 1ZSDB 4R0LB 3TZVD 3SGJA 1C7SA 1HWGB 1E4JA 3OHXB 5DC4B 3X3FL 3WDIA 1S9YB 4BQ8A 5JA8B 4NQDE 4QHLB 4OKDA 1EHLH 3D85D 2A9MH 2RCSL 4DTGL 3HE6C 1CR9H 4L3EB 2OJEA 2XXMB 5AYUL 1G0YR 1QSED 1MFEH 1F4YL 3D87B 2FJGA 3OAUL 2PTUA 3O3DB 4MJID 5SWZB 4L8CB 4NQUA 1MF2H 2NCMA 2DWEA 1GAFH 2QKIB 4O2CA 4P2CG 2ZKHH 4X98A 1I8IB 3ZKND 5I74B 1U8OB 4MGXA 3C87A 4XCYB 1M7XA 4GG6B 4MA1B 3AB0C 3IU4L 4G43B 4FQ2L 1I7UA 1A3RL 2OTUA 5DSCA 1OT2A 2KQMA 2GKIA 4P23D 5CINL 4P46B 4LCWA 4UIKL 2ED8A 1LDSA 4C83A 4NNYA 2WUBL 4M8VA 1LK2B 5J6HA 4G6FB 3JWDH 5CEZD 2R0KL 4JKKA 3WFHA 3VXUB 1M4KA 3UROR 4GG8A 3L1OH 4JFEB 4YGVB 3TC9A 1J0YA 4TSBL 1TDQA 5DT1L 4XZUB 4L3AA 1E4XH 3C5JA 3F65A 5E8NB 4M5YH 4X7SL 4ODSL 5IMMA 2X2YA 1XR9B 1N7MH 3FT2A 3SGDH 2DQUH 1UM5L 2GTZA 3RJDA 5F7DB 3QEHB 4G80A 4Z7OE 1CZ8L 1XFPA 3V0WL 5DZOA 5HI3D 3DBXA 3FT4A 1KB9J 4PJEE 1YY9C 4F8TA 3BZEA 4KUCF 4OSUH 1FNEB 4L4TE 3NZ8B 32C2A 2FRGP 2X4PB 3PHOA 4UT6H 4P2RD 2NZ9C 4F9PA 4POYA 4PDCE 1VACB 1PKQE 2IQAA 3BH8A 2BDNH 3K0WA 4FTVB 1FJ1B 2DQIH 1LP9B 3A6CH 4LVNB 4JO1L 1KB5A 3LB6D 2BFVL 4NFBA 1ZANL 2ZG1A 2WMPA 1AO7D 4ENEC 4H1LH 5I1GL 4ODBD 2B1AL 5FA3B 1MJJA 5JA9A 4XVUD 5BRZD 2JB5H 4GXUN 3FRUA 3KPRA 4N0FA 3PQYA 1U8QA 1OAXL 3RX8A 1ZKAA 4JCMA 2KZWA 4M7LL 4LIQE 4F7EB 4XC3H 1NC4D 4LF3B 3HAEG 3PP4H 3VXQB 4GAGH 4ZSOB 3OKMB 5T1LB 3VGEA 4Y5XA 3QPXL 3G6JE 3O6ML 5T1KB 4X4XA 1FE8H 1QA9A 4LAQH 1TENA 4LCWE 1SEQH 1NBYB 5EU5A 3LD8B 5EPMB 3T2QA 5L2JA 4NKMA 4LCYA 4OZ4B 2W07A 5E1AB 3TPKA 1RULL 4R96B 1J18A 4HT1H 4LLQB 5KVDH 4M5ZH 5L88L 3MA9H 5TDNB 3B9KA 3BISA 1X5FA 1V7NH 2B4CH 5KBNC 3X3GH 1RUKH 1F4AA 4EI6B 3VCLA 3GSVA 3ULUH 3KXFD 3K8LA 4XNUH 4LSUH 1MHEB 3S4SA 5EO1B 3VG0H 4ZUUA 3LQAC 2E7CA 4XCEB 5D6DA 4WHYG 4PLOB 4HIHA 1KG0B 3SKJH 5C0ND 1GZPB 5C07E 1ZHLA 2JB6A 3F58L 1FGNL 3G5ZA 3P77B 4JFOB 5GS0C 3B6SB 1U8HB 3U7YL 5A2IH 4QF1B 4GT7A 2AEPH 4U6HA 3ARXA 4XBPA 1Z5LB 4DOHB 2D4FA 4A2MA 4JDTH 3I6KA 4KZDL 5J3HD 1MFBH 2ZUQB 4EZMA 2J8UA 1BLNB 4OCSH 4OZIE 4QRPD 4M1DH 2FZ3B 2H1PH 2F58L 4NCDA 4KFZC 5KJRL 2DQHL 2R29H 2APFA 1KPVB 1FBIL 3GJFA 5KN5B 4MDIA 4XPGH 2GSIB 4MB4A 3MMEA 4Y4HA 1QKZH 4RGND 2Z31D 4FXGA 4KQ3L 1RURL 2W0FB 3JVGA 4NZUL 2ZCKH 1DQLH 1M7DA 1I8MB 4HAFA 4JY4A 3MLTB 1IAOA 5ABDE 3EFDL 5I15L 4N5EC 4XPHH 1Q9LA 1CG9B 1IILE 4WU7B 5BMFH 5IMKA 1IAIL 2HN7A 3BGMB 1IEAB 4MQ7A 5FYLH 3PQYE 1KCLA 3L3IB 2VLRB 4O51B 1CXEA 4PJ8D 5C3TA 3T3ME 3TBWA 1CDYA 4LCUB 4DN4L 1OTSC 5HD8C 4O4YL 3HPJB 4H8WL 1A1MA 2CIKB 2JELH 3P9LA 4ODXB 3I6GA 4NFCA 5KZCD 3EYSH 4BZ1H 3VG9B 4NNPH 1MCCA 3GBML 4A6YA 5SWSE 4APQA 4M1CC 3VWKD 2GUOB 1TETL 1MWAA 1EIBA 1RFDH 3RUGA 4EVNA 3GSXA 3LRSA 4FZEH 2HFEA 4UAOB 4MA7L 3UJJL 3ISWA 4EUPB 1B0RB 2D7MA 4OT1H 2IAMA 2IH1A 3RTQD 2EE2A 4DVRH 1AXIB 2QQLL 1XIWD 5DRXB 4N8PA 5JXED 3IS1X 2EYRA 5EWIL 4PGJA 3BYTA 3G5YB 1J1PH 2A0LD 1JWMA 5DJDB 3CIQA 3L5WA 2Q86A 4GRLC 3CSPA 3VXRE 1G7JB 2FL5A 3U46B 2E9WA 4I0PB 3TYGL 3MFFA 5MP6H 1KV3A 2DB8A 2ZCHL 4LNVA 4BZ2H 3QFDB 4LSPL 5E4EC 3CNKA 4TVPH 3UZVB 4WW2C 5BOZG 1J8HB 1I1AA 4IDLA 5DTFB 4FFVD 3BD5A 4BSWA 2OM5A 3BT2L 3QUZB 3ZDYF 2FYYB 3IJYB 1AGEA 3QDJB 1U8LB 2XPGB 4HPOH 3BSZL 4K71C 3MRJA 3O2VL 5MEQA 5HPMB 5BS0B 5IEKA 4G8EB 1AGBB 2IGFL 1YPZF 5JIHA 3FOLB 1I3VA 5ESAA 4K3GA 2FECI 4GKZA 4JQVA 3SE8L 4FG6D 1LO2L 1BJ1H 3REVB 4MHHI 3BQUA 5IR1B 2XTJC 15C8L 1GGBH 1YNLL 4QYOA 4NJAL 8FABB 3EZJB 4WI9A 5IESH 1R3LA 2VC2H 5JOPD 1R3JB 4WJ5B 3QIWA 4RFOH 4AT6B 5GSRA 3UBXG 1JZ2A 4ERSL 1KCKA 3CVIH 3NZHH 3TVMA 5F21B 1A7OH 1EEZB 5C9JB 3AXLB 3VFNB 2DWDA 3D9AH 3P9WB 4TULL 4R0LC 4YH6A 1WAAE 5DMYA 1TMCB 4MQXC 4YDIL 2ZUYA 2NW3A 3VFUB 5IFJB 4HWZB 4MMZC 3OG6B 5ICZB 3W11D 5I66B 1L8JA 1YN6A 4AENA 4D3CH 2VXQL 2IPTH 1MHCB 2BP3A 4PTTB 3X12A 3KPMB 2IMNA 2H8PB 4E41A 5MHSD 5HDQL 4JZOA 1MAML 4LSRL 2YK1H 5IT2H 2VDRL 5EUKB 5EULV 5ADOL 4BFIA 2L4OA 3X3FH 2HVJA 1WT5C 4H1LA 5I74C 1JE6A 1MH5A 3C60A 4MA1C 2VLJA 2FJFA 4P9ML 1J5OH 3EOAB 4GKNA 4YPGB 1W2KT 2YD5A 2HH0L 3IDMA 4P46C 3ARPA 2O5XH 4IRSB 1RZIB 2YUZA 1LEGB 2B20A 3V6OE 4LSVL 2IBGA 4PJFB 2VNCA 4RWHA 4HKJB 5I0DA 4Z7OF 4HH8A 3IU4H 1RJCA 4PJEF 4QNPE 2VLKB 2MMXA 3ABZA 4FQ2H 4PJAB 2D31B 1P7KA 3EYQC 1GIGH 1XT5A 4JM2B 1B3JA 4MXQC 3K4ZA 4P2OB 2GI7A 4ZPTB 1BGXH 1YQVL 4ZS6C 1KIUA 4MWFA 3G5VB 2HLFD 1YUHB 5CGYC 1QRND 3H9HA 2FR4B 4NO2B 1S78D 2OZ4L 1VEOA 2IWGA 2O5ZH 3BMVA 4NSKB 5DQJA 3EZ8A 3KPRD 1E4WH 1DBKL 1J1XH 3DRQA 4NCC1 4KMQA 2AJVH 5J1TC 2YXMA 4Z76A 3I3EA 3HC4H 2CR3A 1KUMA 2V7NA 1JPTL 1UC6A 3W2DL 3QO1B 1JGUL 4NRXA 4PBVC 1XF2A 1X4XA 3JUYA 4NN7B 2R0ZL 4LVNC 4NKDA 3CLEL 4ZXBA 3IDYB 5ESQB 3VRIA 3TM6A 3MXWH 5CJOH 1DQTA 1U8IB 2HLAB 5HHPB 5DD3L 4BSJA 3BAEL 1G9NH 1YEIH 4UBDD 3OKDA 4I4WB 4QHMB 4P2QE 3G6JF 3AFLA 3EJZC 1JGEA 3PV7A 4U6YB 2E7MA 4JLRA 5KVFL 3MV7B 4KDTC 2YPVL 3AUVA 2EDNA 4M6MH 2VZ3A 1VKXA 3JWOL 4BA8A 3B9VA 2BVUA 3BP7B 1IKNC 4MNHA 4N9GB 3STZA 4MVBA 4RNRB 3L7EA 1RJYB 4JO1H 4YIQA 1WC7A 3HI5H 3M8OH 3FB8A 2FBJL 3MRKB 3S5LB 2YKLL 2WIIB 4Y0GA 2NY2D 3KYKH 1DN2A 2C3VB 2F15A 4OF8A 3OGOE 4PRDA 3CVHH 4QXGL 3TA3A 2VJXA 2K9UA 4UZGA 1ZLUK 2OJZL 4NQCA 4ZFOA 3LD8C 5IW1B 4E0RB 4IOIB 5JIPA 3VGDA 4NZDA 3Q6FA 2NTFA 5E94A 1G9ML 3HG1A 1A1NB 3TH4T 1N5AB 2ADIB 5TGBA 1CDGA 3O2DH 1G7PB 4PJ9A 4Y4HD 1PAMA 2C1PB 2BVYA 3P0YL 5IIEA 1C08B 4OZIF 1F2XK 1A7NL 1J05A 5GGSA 1AKJA 3RWHB 2BCKA 5ID0A 4X6FA 3TWCL 1QFHA 2AV1B 2AXHA 3IFPB 4WEBL 3REWA 3LEVL 3LN4A 5EO9B 3RHWF 3DGCR 2YZ8A 2PTTA 3OKNB 5TE7L 4C56B 4GAJH 5CGTA 1KIQB 4XXCC 2ZUQC 1F6FB 1ZA3A 2IG2L 1TZGL 5DA4A 1GSMA 1E6OH 1UXSB 3IDGA 3RWDB 1P9MA 1NLDH 1WTGT 5IVOA 3BP5B 3GB7A 2EKSA 1XGUA 5E2UL 1ZHKB 3T3MF 4APQD 4HUXA 1MELA 5CMAA 2BERA 5DHXB 4EDXA 1JGLH 1XGYH 1G7HB 1ND0A 3TV3H 3KXFB 4ELMA 4IMKC 4YX2H 4HH9A 5KTEH 1K3ZA 5D93B 1F11A 4PRIB 4KY1H 1HEZA 5GGUA 4XPTH 4QXTA 2IAMD 2NX5A 1MJUH 4HWBL 4NQEA 1K8IA 3IVKB 1JZ5A 3KHQA 1AR1D 1OL0A 4UMGA 2DL2A 1G7QA 1NFKA 1RURH 4H88H 4FQCL 3DTXA 4U1MB 1ADQL 1JYXA 3OKYA 1YC7A 2VWEC 2Z35A 4NQTA 3VFMA 3IU3B 2APVA 4G8GE 5EOTB 1ETZB 3FQUB 4ODTL 3MJ7A 4S1SH 1ZLWK 3FHQA 1QBLL 3O3BA 5MENA 2UZIL 5HI5D 3EAKA 5F9DC 4Z8FL 3P9MB 3IDXL 4X6DB 4XNYL 1G7MB 3SQOL 3CH8A 4X5XA 3VG9C 4MNGB 4PTUB 5FO8B 2CRMA 1JGDA 3S4SG 1NDGA 1IAIH 1OAKH 4XTRD 3QH3B 1JMXA 1I1AD 1KXTB 1J11A 4TRPL 5DHVB 1GYAA 1FC2D 4JO3H 4Y89A 1R3HB 4UAOC 5DMGC 1FPTL 5D5MA 1WCQA 4O4YH 3S34L 5I1LB 3NFPA 4PJBB 4NZRL 5D1ZA 4U6VL 1IARB 4XCNB 2BZDA 4YE4L 3GBMH 1W8NA 2W9EH 4JQXC 4BQBA 1MCJA 5ITFB 3U4AA 1LDPL 2KZ1B 2XZAL 3HB3D 4ZQKA 3BQUD 5EU4A 1IM9B 2VXTL 4I0PC 2YS4A 1N59A 2PR4L 3QUXB 5DHYB 2EEBA 4H20H 1MLCA 3GIZL 4MA7H 4LPTA 4TPRH 5DD5L 2KKQA 5I1JH 5AZ2H 3MRGA 1F2QA 4NQXB 4LLWB 1HHIA 3NAAL 4PJ5B 5F1KC 3TVMD 3GI9H 4WV1B 1I9JL 1C1EL 2HT4C 3QUZC 2EDFA 1I7RB 3QULB 5BJTA 1NFIB 4N1HB 3GMLB 2X70A 3SBWC 3E6HB 1B0GA 2IEPA 3KJ6L 1MNUH 2VZUA 4D0DB 1JGVL 4UUJB 2ZOKB 1CFNB 1UVQA 3U2SA 4NZTL 1BOGB 5BQ7B 4I77L 2F53A 3CDGB 1J0ZA 2BK8A 4P5KA 2AK4B 1UWEH 2XFXB 2CMRL 2I5YL 4PS4L 4PLKC 1BQHA 1GC1C 1IEBA 4E41D 4D0BA 1WAAF 1ERNA 1GPOH 3UTPD 2CDFB 3BT2H 2HYMA 3RKPA 1T20B 1UCTA 5KVEL 3B2UD 5GZND 2A83B 4K3HA 3RNQB 3TYFB 5EU6E 4HGWA 2ITDA 4ODVL 1HYSC 7CGTA 3S8WA 4FP8H 4NKIL 1KLUA 5F8QC 1VERA 3GMPA 3KYNB 2ZUXA 2Q6WB 2VLJD 5I8OL 5ESVA 1KCVL 5I71B 5EH1A 5DO2C 4XRCA 4ETQA 2AJYL 4ZO6A 4JO2H 3QA3B 3TBTA 3MRNA 4ODHH 3MRDB 5E5MA 3O3EA 4M43H 2EDQA 5HYJD 1YJDH 5J6GB 1DBML 3HZYA 4NQVB 1CLZH 5DJ8A 2W65A 3AS2A 4Q9RH 1VEPA 3VFTA 2R39A 4Q9QL 1AP2B 4GLRH 3DX7A 1A6WH 5CLWA 3GMNA 4NRYB 1BD2B 3NVQA 3WUWA 1TJIL 4ZUVB 4Q6IB 4M7JH 4UQ3B 4BK5A 4QNPF 1WCBB 2F9BT 4QRRA 1R5IB 3IDNA 4GBXA 1T6VN 3DVGA 1ORSA 1LEIB 3SJVD 3ARBD 3PL6B 2AXFA 2WBKA 3WS6C 5EC1B 3ARTA 2Q20A 1NGYB 1MI5A 4IRSC 1D6VH 1AY1H 1CDUA 3ULUD 5TE6L 4KMTH 2FH6A 2AERT 1A6AA 1AQDA 4DN3H 3VGGA 1FORL 5D7KD 4JRXB 3DECA 3TO2B 3PGDB 4LPXA 1EGJL 4OZFB 1Q0YL 1TCMA 1VGKA 1OGTB 2Z8WC 4M00A 2UUDH 3RIFK 4AIOA 1RJLB 3P4OB 1LO4H 3BIBX 4MZ2A 1DFBH 1BHGA 1FDLL 4JM2C 1V5JA 3KJ4B 3QDGB 2IANE 2OL3B 4HPYL 4P2OC 2HJFA 1IAII 4Y4KA 1UZ8B 5I1HL 2A74B 1FP5A 3ALXA 3G6AB 4ZXBD 1DQJA 1U0QA 3WFEH 4X9FA 5ID1B 2IQ9H 3OXRB 1KENL 1Q94B 4Z77A 1S3KH 4GOSA 4H25A 3MRIA 1G0DA 3SO5A 5IB1B 1B88A 3OJMB 1G7IA 3BZ4B 4Y19A 4TTDD 1MCRA 1NCAH 1H3WM 1UACH 1IE5A 2I07A 1YQVH 1XF3B 3RGVA 4NKOB 3TIDB 3MZTA 3NABH 2Z91A 3WYRA 2COQA 2QSQA 4PPTA 1UM6H 2J5LB 3V6ZA 4Z7VA 5I1CH 4PP1D 2ID5A 4J4PA 4Z7WE 4M1GH 4OV5A 3QWOA 5FOJA 4NN7C 2VDKH 1CU4H 5FYLD 4RZCB 4WO4B 5DJZB 4K23H 1OW0A 3S37L 5EOCL 1KXVC 1DBKH 3IDYC 3TA3D 3PWUA 4X8JA 3RI5F 1FL5A 4NQCD 1OWRM 3I02B 1LE9A 3B5GA 5KSAB 3MV11 5ALCL 1JPTH 1R3KB 4RMVA 1AJ7H 4RA3A 4XH2A 1BM3L 5HHNB 3HG1D 1JGUH 2ARWA 2PXYB 3OR6A 4MNQB 3PHSA 1FNHA 4G42B 4PJ9D 1YYLL 3STBA 2BRRL 4GW4A 4QHUB 5KSVA 4Y2DB 4PB0L 3EDKA 4YXHH 1AKJD 1GCFA 4NHCL 1F4XH 4NHUB 1OSPH 3LMJH 1MFAH 2KUTA 5TJWK 3UJIL 3Q2CA 1FLRL 1JN6B 3T0VA 4LRIA 2X5PA 4F7PA 1MHHA 3VI3E 4PJIE 2MWCA 3L95A 4HLZH 2R1WA 3OKKA 3WJLA 2VSDA 2X89A 5D7IE 4GUPA 4XP5L 2PYFA 3LH2H 4WU5B 5DVNA 3VU2A 2GSGB 5E8PB 2DRUA 4HJGA 5EUOE 5IW6B 2FIRT 4MHHG 1JV5A 3VFGL 3QNZB 4N0CC 3ZE0F 1A7PH 3W81A 2M26A 4X6CA 2P5WE 5DDHB 4MLIA 4B5EA 3RL1B 3O4LA 1FN4A 3T65A 3FN3A 5GHWH 4L29B 1OAQL 4NO3B 1S7RA 1TCRA 5DUMH 4ESKA 4NRZA 2ZG3A 4RGOH 5AYQA 5ICXA 3OAZH 2YC1B 3MZGB 3LZFL 3THML 4GMSH 2XN9E 4OKVB 1JPGB 1BIIA 4PJXB 3SDXF 1S7VB 1TZIA 2V5MA 3OB0H 3C5ZD 1QP1A 3AS0A 3P4LA 2APBA 2NX5D 3HKFA 4NQED 2GYSA 1U3YA 2EYTB 5EZOH 3WL9A 1D5BA 3QUMB 4M9OA 4CKVX 3U9UB 1PKOA 4UDUA 5GRJL 3FQXA 5AUMA 2J1KA 4PRAB 1MOEA 4TQEH 1NUNB 5DK0A 1BFOB 3AU1B 5LWYH 1DVFB 3FOMA 4BKLB 5H2BA 5DRNA 2PYEB 3CFBA 3QWRA 4K3JL 5MEND 1CFTA 2J4WL 5KOVC 2HP4A 5DD1L 1DUZA 5C08B 4WCYL 1CD8A 3TPUB 4F9LC 1TZHB 4YDVA 5IFAH 1NCWH 1V7ML 3EW3B 4QRUA 3MOQA 3FQNA 2HVKB 2VUOA 3MLWL 1SJHA 2AJZA 1D9KB 1OD7A 5D93C 1C5BL 4XBGB 3GKZA 1ZTXL 3GRWH 4N0YH 3P30H 5D1ZD 4NJ9L 3VMNA 2DTMH 5HJ3B 3TEUA 4KK8C 4FN0A 4YDKL 1T03H 4OAWB 1T89A 5CHNB 1ZT1A 4R4BA 1K5NA 2R69L 1E6JL 4K8RC 5IGXL 3DVNB 3KWWA 5DK2A 1AD9A 3LQAL 2CO6B 4GW5B 3RVWD 1ZHBB 4ZPVA 1JZ4A 4JHAL 4HEME 4LGSB 3HFML 3ESUF 4HWBH 5E6IA 4MA3B 4HQQL 1CGYA 5JO5A 1QSFB 5GS0L 4QCIA 3MRCA 1NCBH 2W9LA 4WI4A 4WDIB 3UTSA 3OAYK 1KTKE 2UZXB 2JJWA 4HKBA 1KIRA 3MV9A 2OR9L 5HY9B 4Q2ZB 1LE5A 4NUJA 3QIBB 4JPIA 4DGVH 3PGCB 2DYPD 4JR9L 3E8UH 2F53D 1Q38A 1RU9L 2Q76B 4XNYH 3SQOH 3MXVH 5EFIB 1WWAX 3SE4A 1J87A 3FRPG 1UH3A 4CL7A 5FGBA 2XG5A 3VFWB 1AH1A 1T2QL 1NBQA 2ARJA 4KK9D 1U93A 4NBZB 4ODUA 5CSBA 4MCYA 3D1MC 3QUXC 4PV9A 2QHRH 4I13B 4CMMB 1FPTH 4UV7L 2AXGB 2Y5TA 2ZNWA 4OF0A 4PB9H 4XMKH 4XVSL 3W0WE 1JYVA 4YHIA 3MUJA 4RAVB 1YEGL 4U6VH 4PUBL 4WV1C 3RWGB 1BVKB 1SEBB 4M48L 4MJ6B 4N90E 4HS3B 3QQ4A 2DDQL 4PGCA 4LNRA 1JZ7A 5EG6C 3BH9B 4NWTH 1FH5H 2X1XR 4Y5YA 4RAUB 3PWLA 4UTBL 5IVZB 4OGZA 4RMQA 5GRUH 2D7OA 1FRGH 3ARYA 4AM0B 1YEHH 5B39G 4N0UB 4N5UA 1C5CL 5HDLA 4XWOC 1PLGH 1BQLH 3QRGL 3IAGC 2R23A 5CILL 1I1FB 4S1QL 4ZDHA 1HN1A 1OAUL 4OLYH 1A0QH 1L0YA 3X14B 3ILQD 3KJ6H 5C0BA 4HCRL 5CSZB 5INDA 2J8OA 3O6KL 2CK2A 1MFNA 4KAQL 3OPZL 4OCXH 3BGAA 5KS9B 1WBXB 1R5VB 2DAVA 5CUSL 4PRHB 4NP4L 5GRXG 2CMRH 4QRRD 3QIUB 3O0RL 5I71C 4GBXD 1WZMA 3VFOB 5C0IB 3DVFA 5HHOA 3GMMA 2D03H 1CDIA 4J6RL 2DBJA 2E3VA 4WNQA 3U9PH 1MI5D 5I1IH 2Q1EA 3MCKB 3GBLA 3MRHA 4DKEL 1U2CA 1RJZB 4R7NA 4G3YL 1MEXH 1FNGA 1YY8B 2L7UA 2XA8L 3LY6A 1SBSH 3VD3A 3DX8B 2NY6B 3BPLC 4M7LT 3HCVA 5DUBB 3P40A 2NTSP 1KCVH 1NGPL 3V6BR 2XWTB 4U1JA 1QLEL 2IALB 4X99B 1QLFA 3NCCB 3C2AH 5J89A 2CQVA 2AJYH 2VDPL 4U1SB 4Q6IC 4Y4KD 1NAMH 2VERN 1R3IH 4I8DA 3SCMB 3FB5A 4Y4FA 3OZ9H 1AI1H 4HIIA 3PL6C 2HRPL 1GJIA 3GGWB 3GM0A 4D9QD 4ZFZB 2P5EA 2XWBB 3MGTA 4Y19D 4FQPA 2WZPD 3SGKC 3QRFM 3HI1B 3HZKB 5J06A 1TJGL 1EAPB 1H3PL 5CP7A 1CGSH 5CJXC 4JFDE 1U8KB 1MJ8L 4WHTA 4IDJL 5C0GA 1FSKB 3W39B 3HNSL 4Z0BL 5D2NB 2Z92B 3JSSA 1RIHH 2V2TA 1BECA 2GT9B 3DUSA 2LTQB 1S8DB 4J4PD 5C0CE 3ULVC 4CW1A 1DR9A 1J8KA 2R4SL 3KJ4C 4X4MA 4WFFD 5D8JL 1LD9B 5D72H 5ALBL 3WNMA 3V5HB 4KQ4L 3CMOL 2E9IA 4Q9BA 4OJFH 3GSNL 2B2XL 1ZLVH 1DBAH 1S7TA 3V2AR 2P46B 4Z7WF 2D7TL 1TVHA 3VJ6B 4HIXL 3OR7A 5FCUL 1Z9OA 1S5HB 4ZUTB 1D5XA 4KHXH 3IFOA 1MIEH 4P4KB 3BWAB 5ISZE 1OP5H 4JFFB 4PJHE 1N4XH 2OBGA 5DJ6A 4PY7B 3IDIB 4LCIH 1NCDH 1MCQA 3BOVA 1ZLSH 1NLBL 2J5LC 3N1FC 4JFHE 4M4PA 1KNOB 3OG4B 1KENH 4AEFA 1ZWIB 4XAWL 5DMJB 1KOAA 1FVDA 5HHOE 3WUWG 5IB4B 2QSTA 2V5TA 3FO9B 4G8FA 1RVFH 2X89D 2CK0L 4WO4C 5C0AA 5AAMA 2CDGB 5DJ2B 3X17A 1S7UB 3TNNA 4JY5H 35C8H 5C0DA 4S2SB 5DJXB 3VI3F 2P42B 4XCFL 1NEZG 4PJIF 1XH3B 1AR2A 5KSAC 3O4LD 2HLFC 4OCYL 5D7IF 3C6LB 2VAJA 2PXYC 3VH8B 3G5XA 3WD5H 4UQ2B 3PXHA 2JCCF 5EUOF 3L3HB 5D6CA 4KRPB 4RWYH 5TPWL 3T2NH 1OAZL 4EBQH 2UWEA 4Y2DC 4EDWH 3D2UB 1QR1A 1FFRA 2DS4A 4LSSL 1UB5B 4R8WL 1P1ZB 1CFSA 1M71B 3KYAA 2MHAA 3TBYB 4TUOA 3WN5A 5TE4H 3B3IA 1CCZA 4NT6A 1B6DA 2OMNA 3MQIA 1QNZL 3ZKQD 1VADA 4ZS7L 5L8KB 1S9KC 4ONGL 1U95B 4OZGE 2AQ3A 3KPNA 5IROC 2R4RH 3LSOA 3K2MC 1P5UA 3LKPA 1G9EA 3VGBA 1HQRB 1DTUA 3FTGB 3KNBB 1QUNA 5CWSA 4HIJA 4PJ7E 2VQ1B 1T3FA 1C16B 4HWBA 4KKCD 4O02L 3MLYL 5EA0H 1OCWL 2F19L 1QFWH 25C8H 4ZG1A 5DMKA 3WFCH 1ADQA 2PETA 5LQBH 3QFJA 1I1RA 5GRZA 4XP4L 5AEAA 2DBLH 3SKNA 3GSUB 4OZHA 5JDSB 4XNZB 5EZJA 3O6LH 4YO0A 3UTTA 2DJ4A 3QXVA 4LASL 5E2VH 4R4NC 3LPGA 4O9HH 2H2SD 3L5XH 3HC0A 1IAMA 3FFCA 3MACH 4LHUA 5L6YH 5JUEL 1FVCB 3RPIB 3PE9A 3W9DA 3WJJC 5GGTL 3SE3A 3RWEA 4TNVK 2EXYC 5L2KE 1D5IL 3R06B 4Y8AA 2IBZY 3FN9A 1DVFC 5E99L 5GIRA 2HJLB 1BBJA 1RIVL 1U91B 1UADC 1NDMA 3QQNA 3MGOB 3MLVL 5LBSL 3MCLH 1IGML 5EU3B 2CRYA 5E6ID 3MBXL 5TQ0L 4UIMB 3LKRA 2PCPB 4YGAB 5FM4A 5IEHA 3KPSA 4OFPA 4G8IA 3AREB 1OLLA 1V3KA 1H15A 3L7FA 5CJQL 1D9KC 3LEYL 4DVBA 3UTSD 3KGRA 2EE6A 3MV8E 4J3OC 3GKWL 2EECA 1R5WB 1T83C 4GXVH 4LVEA 3N1QC 3G04A 1TNMA 4K3JH 1KEGL 1L7IL 1SYVB 2PKDA 5FAAA 5I0ZA 4YQXH 2O93L 1CD1A 2VN4A 4QRTB 3DLQR 4M8QA 4POUB 2W91A 3ULSA 3FO0H 4HXAH 4L4VB 4U05A 3RQ3A 3HUJE 1QOKA 1VEMA 2DLFH 1FGVH 1FZKB 3FQWA 4LU5H 2DN7A 1H3VA 4K94L 5DWUH 5INCB 5I76B 2WBJB 1WBZB 2XWJA 1JPFA 2YSSA 3U7WH 4HK0B 3FCTB 3QUKA 2NY7L 4S1RH 5ANMA 2N4IA 5E2TL 3P73A 4PG2A 5ECJE 1EDQA 4JKPL 1XGQA 1ZA6B 4BQCA 1GZQB 4DCQA 4KI5D 4XPAH 4JHWL 2OR8A 1IC7H 4PRNB 4DZBA 1ZE3C 2A73A 5T1MB 3U6RB 5SWQA 2BX5A 5E9DB 3ARDB 3QIBC 5EBWB 2OSLB 3V52L 4I2XE 4IOFC 1TLKA 3LQAH 4GAYA 4UT9H 1YMMB 1YEJH 5HHME 4LLMA 3LN5B 1OT1A 3OKOA 5HHQB 2IADB 1I1YA 2LU3A 3OF6A 1KYOJ 3HFMH 5T3ZL 3GMOB 3VXOA 5D1XB 3M17B 2GTWA 2ZPKL 3V4VH 1RSFA 1QPXA 5EORL 3MOBH 1QACA 3MODH 3WFBH 2B0SH 5C0BD 5F44A 4H5SA 3W5NA 2G9HA 3DV4A 4XWGH 5ADPL 1IQWH 1A7RH 4LSTH 1T5XB 5GXBB 4HEPG 3F5WB 1BEYH 3MREA 1SYSA 2YWZA 1ONQB 3NGBB 2F5BL 3QDME 2VE6A 2GJZB 2FX9H 4B53A 1QFWM 3UZEA 1SVZA 3OKLA 2A9NL 4DGIL 4YAQB 3T4AB 2MCPH 5C09E 3QCUH 2QEJA 4ALAH 1X4ZA 1A4JA 3MRFA 4UV7H 2D4DA 4S11A 3LS4L 3IXTA 4KROD 4BUGA 4JEGB 1N0XH 4JM4L 4FQJL 1JIBA 3JWDC 4OUUB 1NMAL 4DWHA 2EH7H 2CLVB 1XF4A 5DLMH 2UYLA 3E6FA 4U6XA 2EDLA 3UPRB 3S6CA 1FYTA 4W4NA 3HAEB 4KPHL 3O11A 1N64L 4R4FH 2E9JA 2B7DT 4Y4FD 3QIUC 2LAAA 1CD9B 1SBBA 2C7UA 3HZVA 3SE9H 5C0FB 2P5ED 2QADB 1ZEAL 1A9EB 4DKAA 3HE7A 3JUZA 4HX1A 1NBVL 2BOBB 3DMMB 4UTAH 4P4RB 1IGJB 4P49A 3BRFA 1FIGH 2VXUH 3U0PB 2IPUK 3V5KB 2NY6C 1CFBA 2W0PA 5LG1A 1CDBA 4PYHA 2VL5A 4XGZA 3O0RH 3HE6A 4MAUH 5FV1L 1DUYB 5D70L 4PD4K 3AMLA 3DUUB 5E8OA 3VXSB 3KLHD 4F33A 3RL2B 4G9FE 1A3QA 1W0VA 5C7XL 5KSBA 2FX7H 3T3PE 4ZFFB 1YYMH 3SCMC 2VLLA 1UQSB 2BNUA 4F7MB 4JDVB 4OD2A 5JNYB 2FATL 4HF5H 5B3JE 5K9QI 3PP3K 2VH5L 3GSWA 1CGXA 1NQBA 1ORQB 5LGHL 4X4YB 4F57L 2F54D 3O41B 4GRWE 3I9GL 1T0MA 3H9SB 1GC1L 5E00B 1T1XB 4H26A 5I8CB 1T4KA 3FO2A 5DQ9A 5C1MB 4PP2B 1JNJA 4MSWA 1CFVH 4WWKB 5DYOA 3CXDL 1FSKC 5FKPA 4U1IB 3ZHKA 2IFGA 1OP3K 5GGRY 5D2NC 5B22A 4JY6A 2E7BA 3P0VH 4RMSA 3GJEA 3WEXB 2A6KB 3IJHA 2LTQC 4K3EL 3QJFB 4XPFL 4AMKL 1A6UH 4PJHF 3MROA 3VXPB 3VFRA 5FXCH 4XNQB 4R90L 3J8F7 3BP6A 3IYLW 3CVHB 1C7TA 1N2RB 5J9PB 1H3PH 2KBGA 3EYVB 2VTFA 3MRLA 5FGSA 4PLJD 5FOBA 1EUTA 2J6EL 3ARBC 4P4KC 1MCDA 3ELAT 3I75B 5BVPH 2VITA 3KS0H 3QB7C 3D0LB 4OLZL 4U1KB 4K7FA 4Y1AB 3ZT5A 4YWGL 4OF5A 1AE6L 2VISA 1INDL 1FYTE 3R8BB 2DLIA 4PJCA 3WXVL 4WUKH 5EZLA 2C9AA 1CLYL 1MY7A 1LHZA 1OARH 5D7LE 2FJHA 5DRWB 5ERWA 4HIXH 2BNQA 1MCSA 1OF2B 4YJZL 4HMEA 1RY7B 1U8NB 1C5DB 1L6ZA 4KZEL 1AIFA 2A77L 1FZMB 1Q9WB 4YHNB 4AJ0A 3D39A 5FGRA 5GSVA 5DS8B 1T80A 1RUMH 3CDYA 2CUHA 3WDHA 4W6YB 3ZYZA 4XAWH 4OD1H 3WE6A 3MUGA 4KRPC 5IVNA 1S5IH 2QQNL 2CK0H 3G08A 1KT2A 4OZGF 3GHBL 4LVOB 2ESVA 5D71H 3QFJD 2C1OB 3PJSB 3DIFB 5DVLA 4PJ7F 3S3SA 3SO3B 5GZOD 3UTTD 5JW4N 4PGBA 3AS1A 5LVEA 1F3JA 4D9RE 5TF0A 3ZE1E 5E56A 4PP1C 2VSCA 1INEL 1F13A 2BXYA 3BN9D 1TJHH 2B5IB 5CBEB 1LO0L 5FDWB 3FFCD 3MNZA 1OWWA 5C0JB 4FXKB 4LHUD 2ICWJ 3ROLB 1IC4L 4LPVA 5HPOA 2R15A 3CZFA 4KUZH 4LLVA 1YPZB 3I3BA 3RZCB 3EYFA 3MJ8A 1X5KA 3LV3B 4PRPB 4LSSH 4HFWB 4X6BB 4J3WA 5BO1L 1KCSL 1A47A 5F1IA 3RGHA 2NW2A 3TF7C 3WLWC 3BDXA 5E8DH 1BZ7A 2G60L 5FO7B 2NXYB 3FFDA 1Y0LB 4NQDB 4XPBL 5AAWA 4LAJH 3QJHA 5ENWB 2MPAH 3GIVB 3KPSD 4ZS7H 1F8TL 3ZTJG 4KJQD 3TBVA 4Q0XH 2WNGA 3UBXB 4FQIL 1IAKB 3AY4C 3GMQA 3O8XB 5IB2B 1P2CA 4GW1B 1QQDA 3R1GH 1S9XB 2K7QA 3L3DA 4IS6A 2CKBL 3VD4A 1EA9C 2VO5A 3TT3H 1FG2B 1WZKA 2F19H 1SJEB 4XI5C 4NO5B 1DLHB 5A16A 5JORB 3VFVB 2R8SH 1JF1B 2HWZL 4MLSA 4PG9A 1TQCB 4BQ9A 5I18L 5F6IB 3SPVB 1PD6A 4I0KA 3P4MA 2G5BA 3A6BL 4J3SA 3HUJF 3L9RA 4LK4A 1ZT7B 4WFEE 5HDBE 1RD6A 4YUEH 1TIUA 5C92A 1RMFH 4K9EC 4D8PB 1QR4A 3NCBB 3AREC 1VSCA 4G5ZH 5GGTH 1CFQB 4FQXD 1U92B 4JE4B 1HHKA 1GGCL 5E99H 5MEPA 3TT1H 3SDYH 3BDBA 2YEZA 4XXDA 4N5EA 2ATKB 3UJTL 2VLMD 2WP3T 3IKCB 3QXDA 3VE0A 3OF6D 5T3XE 1KFAH 4IIQB 2OMBA 43CAA 3MLUL 1NCNA 2DQJH 2ESVE 4YXLL 1Q8MA 1MLBA 5LGJA 3NCFB 4V3EB 4WGVB 2BVPA 2WBJC 3HR5A 3BZFB 4OM0L 2VZVA 1N5YL 3ARFB 1HXYB 1NGXA 4LMQI 4PJEB 3GKWH 4L8DA 3ME0A 2G75B 3UYPA 2SEBA 3FONA 3KPLB 5IM7A 2R1YB 5IVXE 1ZGLA 1LEKA 3QDGE 5F7EH 2GK0A 4L4TB 3ZT6A 4BH7A 3IGAA 1KN2H 2YPLA 4L5FL 1ZVSA 1KBGL 1DN0B 4ZTPL 2O5YL 5EDXA 3ARDC 4HCRA 3U36A 1EFXA 3CFDA 5TQ2H 4HKXB 1PKQB 2DQCH 2DLEA 5F1OB 3HS0A 4OCWL 1Z3GH 2JJSC 5D1XC 4QTHA 4TSCH 4AG4H 2DQFA 3CH1A 2AK1H 4GRLA 1FZJB 1HWHB 2BSSB 2EDYA 1JWUB 1DQDL 4NO0A 2X1QA 4LKCB 3UYRH 5CEYA 1E4KC 1J0IA 1FAIL 2EDOA 3GJFK 3NGBC 1I3RA 2GJ6E 1R24B 1T1YB 3V95A 4OF6A 4WW2A 1MCOL 2DD8L 4V1DA 5KVGH 5JOFA 4FQQA 3HE7D 1T1WA 3DXAE 2NLJA 4K8RL 3G6JB 5H35B 4ZD3H 3BJ91 5HGHA 2XY1A 3BN3B 4LCWB 2OQJB 2QSCL 4PJGE 1RZJH 4MXWH 3HE6D 2NY1B 1FNLA 1EVTC 4LSDA 5DI8B 4TUJA 4I5BA 2NPLX 1OAYH 1FV1A 3VXMA 5F9WB 4Z7UE 1BFTA 5EBGA 2AV7B 1JF5A 2OX5A 5B21A 4U0QB 4WY7L 1KJVA 3S36L 1AFVL 1A5FL 1OGAE 3PWPA 4OIAA 4FQJH 5FGCE 3H7BB 2QADC 3T3PF 1CTNA 2BY3A 5C07B 5FYKH 5ELIA 1ZSDA 1NGZB 3DMMC 4R0LA 3N50A 3WIFB 5B3JF 3OHXA 1P4IH 5JW5B 5F3BB 1T0NB 2A6IB 4EUPH 2ADFL 4XBEL 4GRWF 4QHLA 5CBAB 4L1HA 4OZIB 1UM4H 3GHEL 4RDQG 4L3EA 5ITBH 1MCIA 4NDMB 4RDQF 2AABH 1HCVA 5DFWH 1UEMA 4HJJL 3O3DA 1PQZB 5K59E 5SWZA 4L8CA 1FL3B 1CVSC 2R1XB 3BH8B 3BGFB 2QKIA 1JFQL 2LAGB 4JZJB 1WT5A 3CFJB 4QRSB 5F9AC 1U8OA 1KJ2B 1CICB 4GG6A 4XCYA 4YNYB 3ZO0A 1IZJA 1RUPL 4G43A 5HBBA 3CU7A 3LKSB 4P46A 1K6QL 1YY9D 4WWKC 1UEYA 4W81A 1N8ZB 3PQYB 1X5GA 1QYGH 1KPRB 2E7LE 1LK2A 2ICES 3FL7A 2BNQD 2KL6A 2NYYC 4L3CB 2NZ9D 3TH2T 1EO8H 1VA9A 4YHPB 5DQDL 5IF0B 1ACYL 5HYSG 2XZCL 4JFEA 4YGVA 2FWOB 1A7QH 1J10A 1U8PB 4KVNL 5I2IB 3QR2A 4XZUA 4QGYA 3D39D 5SWSB 4MXQA 1MCHA 3AAZB 4JRYE 3V4PL 1HHJB 2YA1A 2DM4A 2V9RA 5E8NA 4XP1L 5IBTL 4ENED 1XR9A 2X9YA 4AMKH 4FZ8H 5F7DA 3QEHA 4YPJA 2Q8AH 2E5EA 4NWUL 3HMXH 5DJ0B 3NACL 4MX7B 5F7KC 1F42A 3K8MA 5A40E 2YRLA 2P24B 5CJ5A 1FNEA 3HZMB 1WVZA 3NZ8A 1LILA 2X4PA 3O2WL 1A6VH 3VXRB 3OQ3B 3S4SB 3PWJB 4LKXB 1SQ2N 4LDEB 4GFTB 4KK6C 4X6EB 1QFUL 1VACA 3OKEB 5E2JA 5GGRA 2ITCB 1ZHNB 4FTVA 1FJ1A 3C5SB 1LP9A 1OM3H 2X4QB 1AE6H 1QBMH 2BNRE 1XF1A 5C2BH 4OLXL 2EC8A 4XBPB 3ZE1F 4ODWA 1XAUA 5FA3A 2X09A 4UU9B 1AXSB 4KXZI 1CL7L 1HSBB 1JHKL 4HUKB 3NA9H 3UDWC 3KLAB 1Q1JL 4KZEH 3C6SB 3K4AA 4LVOC 3D3VE 4KDTA 3QI9D 5GGTA 4Y2OA 2AGJH 1NAKL 1EBPA 1ES0B 5JIKA 5J0BA 1GHFL 1IKNA 2CGRH 3K2UL 3NCEB 3SO3C 4HZLB 3CFCH 5LCVH 2AXJA 4U6TA 4F7EA 1B2WL 4ETYA 5F8RC 5AWNH 4JY4B 4LF3A 2WV3A 5EBMB 1JNLH 1IAOB 2AJSH 3OKMA 6FABL 5T1LA 2B5IC 1E27B 4JZNB 4LVHB 2QQNH 2BHYA 5T1KA 1OVZA 5GS0D 1MAJA 5GGVH 5K9JH 2XRAL 2CRZA 1NBYA 4MQ7B 4YHYB 2XA3A 3J7HA 5EIQA 5EPMA 2LU7A 2YN5A 3S35X 1MRCH 2X7LB 4OZ4A 5HGBB 5E1AA 3T0EE