5AD0A

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
269
structure length
269
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
total genus 55
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ad0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ad0A01
3WS6A 2HJFA 1L0QA 2A74B 1QKZH 1MRDH 4KAQL 4OQ1A 3D2UA 3VXQA 2XKSA 3LV3A 2DQIL 3FN3A 4YHML 3FTGA 1FJ1B 1JWMA 2BZDA 1K8IB 4X4YA 2AJYH 4AENB 3QULB 2UY7A 4NBZB 5BZDB 5SX4H 1FORL 2BVPA 5C0AA 3IXAB 1OLLA 3RUGB 5I1CL 2IFFL 2FD6L 3RWJA 1YYMH 3VI4E 2YPLE 5K33A 4PJBB 3LDBB 4ZFZB 4RFOH 3UBXI 5DD5H 3EJYC 4P59L 4GMTH 3AAZB 3FQNB 5FOJA 5FGCE 5GZND 4YXKH 1KFAH 3SDYL 1UQSA 4QKXB 2BFVH 5JORB 3DVNB 4GUPB 1IFHL 4FFZH 4Y5YA 2B5IC 5D1XB 1YQ2A 2LV4A 2BSTA 3W39A 3OJDA 2IEPA 3BMVA 4M00A 4PR5A 4MGXA 1LO5B 4M02A 4BQCA 5TDNA 4AEEA 4DGYL 1L0YA 4TVPE 3DUUA 1C8PA 4RNRA 4BM7A 4F3FA 1KUMA 1ZVSA 4NQDB 4G7VL 3MLVL 5JPNA 2ZCLH 2A9ML 4PRAB 1SVCP 4XMLL 4K8RL 5CLTA 5KS9F 4UV4L 4N8VB 5JA9A 1NDGA 3TCLB 4JFYB 3L3DA 2NMSA 1NC2B 1Q9KA 3C6LD 3SKNB 2W65B 3QWRA 1BJ1J 4P5TA 1GGYA 1T03H 4Y2DB 4IOFD 1JV5A 3T8XB 3OKOA 3W81A 3ZTJG 3QR2A 2ZUWA 3B5HA 1U8PA 4YR6B 2NX5E 5EO9A 1OAQL 4P9HL 3D0LB 4QWWC 3P73B 4OLZH 1F00I 3K2MC 3BGFC 4X99A 5CHNA 4PGJA 4F58L 2E7LE 4C58B 4S1SL 3RWEA 4TULL 3DLQR 4DGIL 2BC4A 3MGOA 2AQ1A 3D39B 3F7VB 4JFDD 3WFCL 4ORZC 4OZHF 4OCYL 1ZA6A 4M7ZC 5GGTL 1K4DB 3EJZD 4K7FB 3BH9B 1HHGA 3IFPA 1MCNA 2MHAA 4F7EA 4LLVA 3ULUH 4P5MA 1F3JA 4M6MH 3RVWC 3WO4B 2PO6D 4ZTOL 3LKSA 3EBAA 4A6YH 4QHMA 1JHKL 3PWPD 1J05B 4ERSH 3DVFA 4D8PA 3CU7A 4Q6IC 5F7HA 4S1RH 1CXLA 5AZEL 5TE4L 1ONQA 1LE5A 3U4EB 3O4LE 1NBQA 1KIPA 4WUKH 3VFMA 4BQBA 2EDRA 1NMAL 2LVEA 1TZIA 3ROOA 2XZCL 2C3HA 5MI0B 1LEIA 1XF5A 3P4LA 3N1MC 4OZ4B 4JY4B 4DKDC 4Y5VA 3SPVB 3STLB 5EIIA 2VKXA 5GGTA 4R6UA 2QL1A 3P0VL 1S7SA 1H0DA 3KYOB 2UV3A 1MRFL 3QHZH 4Q0XL 4Z6AT 4HS8H 1BBDH 5DD6B 5E5RB 2DMCA 1FO0B 4GRWH 4ZDHB 4Y5XA 1QSEB 1CGYA 4XNQB 4QXUH 4FFWC 1FGNH 4WI7A 3SE9H 1Z3GH 3WYRA 1IL1A 3UCRA 3WS3B 4OLXL 3FB5A 3QJFA 4LLMB 2AK4D 3QUMB 3MJ9L 4CNIA 3QUZC 3LZFH 2BNRD 3ARGB 3QNYA 3FN0L 1UWXH 2VQUA 5HGDB 2P1YA 3MRKB 1IC1A 3QDJB 4YWGL 2QLVB 2OS7A 3QIWC 5HYQB 3OXRB 5DJ0A 1X5ZA 3B3IB 1XIWA 3GGWB 1BD2D 1HE7A 2V7HA 2P8MA 3ESUF 3MJ7A 5DEFA 4XBPB 4X6BA 3WSQH 2J4WH 2JB5H 4EDWH 1XF4A 1A4JA 5ALCH 3LN4A 5AZ2H 1XGYL 4MA8L 1D5MA 2IGFH 1LE9B 1D5BB 2R4RH 4ODWB 1A1NB 1UJ3C 3CSYA 5IM7A 1VB9A 4YDJA 1GIGL 1AD9B 4YDVB 2VAAA 2NY4B 25C8H 4OCWH 1MNUL 4XVUC 1E6OH 1FZKB 3MJ9A 2K7QA 1RK0A 5D5MB 4YHIB 3W0WB 3S36H 4GQ9L 1T5WB 5B3JF 4F9PA 5I2IB 2ZOLA 3BZFA 1KXVC 4MHHI 3QUXA 4JFDE 2Q8BH 4ZXBC 3B43A 4I48A 2D0GA 2X1XR 4OIIL 2A0LD 4FQ1L 1DFBH 5TE7H 3ARSA 1Q9WA 5CBEB 5C09D 2HT2C 2GFBB 3D3VD 3BDYH 3G6JA 4PREA 2A38A 5HGBA 2ESVB 3QB7C 4NJAH 3QQ4B 2ZG1A 4HLZG 5E00A 1A7NL 3M07A 3PWPE 2XZAH 4K3DL 2FLRT 2YXMA 1ZHKA 1MWAL 2E6JA 3TIDB 5F6HI 4HFWA 5C9JA 3KPLB 2BX5A 3M1BB 2EH7L 1WFNA 3GO1L 3RIAK 4RGND 5DEGB 3L5HA 3QIBD 5MEPA 5D70H 4EEEA 3CH8A 3B8YA 5KAQG 4KY1H 4F57L 3RIAF 1FFPA 3JWOH 3P0YL 3IU4H 1PG7L 2CRIA 1Z0MA 2H1PH 2Q7YA 4R2GD 3SKUD 4NN7C 1KB9K 3SDAB 1IKFH 3MO1B 4G3YH 4IRZH 4KUZL 1RZKC 3QEQB 2VLRA 4GW5B 3SKOB 3LSOA 1K8IA 2ZUXA 5D7LB 3VFVB 1AGEB 1S7UA 1EHLL 4XTRC 3QULA 2KQNA 3RDTC 5BZDA 1BGXL 4TOYL 4LVNB 2ID5A 5MEQB 4Z7VE 1MWAA 3IF1A 2VIRB 2A6JB 1RIUL 3OAZK 3AXLB 3ULSB 4ZPVB 3TWCL 2ZCHH 5JXEA 4PJBA 3HE7D 1WF5A 4HEPG 4ELKA 2BNRE 3G5ZA 4ZFZA 3IETA 4PRBA 3MOAH 1RHFA 5L6YH 2CQVA 4G9FD 3HE6C 1KPRB 1JZ6A 1KC5L 3KPSA 1GOHA 1BJ8A 3L3KA 5HYSB 4GUPA 5K9OA 1BD2E 4WEMB 3W2DL 5L88H 1FZJB 2BVEA 3NN8B 4S2SA 4CL7A 4OLYL 3NA9L 2R0ZH 3L5JA 2R8SH 4J4PA 1JK8B 4Y4HB 5D1QA 2B2XL 4C4KT 3S3PA 1A2YB 1MOEA 2XWBB 4Y4FC 4OGXH 4NSKB 3B9VA 4IS6B 5F7DA 2XN9A 1LEGB 1AO7B 4LU5L 5DGRA 3WHXA 3I02A 5M7QA 4NKMA 1RY7B 4PRAA 1VGEL 4I0KA 4PS4L 4N8VA 4N0UA 4Q97A 1MH5B 1H5BC 3FHQA 3IDXL 3QWOA 4PB0L 1IC4L 4M7KL 2ZKHH 1ZT7B 4LEOB 4WW2C 1KV3A 1JYNA 3R06A 4ZFOB 3TZVA 4LCIL 3ZE2F 2M26A 3CFDB 5EZLA 5C09E 3ULVE 4QNPF 5I19H 1RSFA 1HH9B 1ZHNB 4HJJL 5TGBA 1WWBX 3NABH 1NEZB 5IOPA 1D9KB 1VESA 4UUJB 3MCLL 1P9MC 2VB5A 4Z0BH 5B39G 4G8FB 1V5JA 1MY7A 4IRSB 4FABL 2VO5A 4RGNE 5LGJA 4K7FA 4YPGB 5FO9B 4UT9H 3KPRE 2YC1B 1AI1L 2X1PA 4AM0A 5CEZD 3NMEA 5I1KH 4OLUH 4L4TD 3O4OC 2DYPD 1IJ9A 3HMXH 3OQ3B 1J05A 4XBGB 5HYFA 1OAZH 5E9DA 2DWDA 5SWSB 1CYGA 1G9MC 4QOKA 1YPZF 4I3RH 2AS5M 1HYSC 2CUHA 4RAUB 2VLMD 4M1DL 3C5ZA 4ZNEA 3MRQB 3FO0H 3JXAA 4U7MA 1I8IB 3UZVB 1FNGB 5I75B 4MWFA 4LCYB 5IB2B 1DQDL 1KELL 3H3BC 2DM4A 3MRDB 4YNYB 1DLHA 1ND0A 5E2TL 1NCBL 2Z8SA 3ARED 1HOCB 3F6IA 1WEJL 1KJ3L 1RPQA 5J11C 4JKKA 4ODXB 3VFPB 3EOTL 2YXFA 1FO0A 5E2JA 4G9FE 5GZOC 1LO0H 4EDXB 5T1KD 1QSEA 1VHPA 2YD3A 4A6YB 4F37F 4MAUH 4N0FA 4FG6D 4U7KA 3QRFM 3BSZL 2JIXB 5MENA 2H8PA 4S11A 1E4JA 4LLMA 3IU3B 4XCFL 2O5XL 3PDGA 3G6AA 1TQBB 2IPKB 1DUYB 3GIVB 3TBTB 4PRHA 1A22B 3OWEA 3ARDB 3V4VH 5LXGL 4U05A 2DKUA 1EHAA 5E08H 1SVZA 4G8EA 3QI9C 4HGWB 4J7RA 5CSBA 4ODHL 5JW4Q 3B3IA 3HPJA 4LKCA 4BKLB 5HSFA 3Q2CA 2FJGB 4XBPA 4K3HA 1FZOB 3DO3A 4PJIA 5JQHC 3MPCA 4GRWB 3M17B 4N68A 3KLHC 1JF5A 1QOKA 1LO3L 3GHEL 1MIML 4JEGB 4WENB 5E7FA 1D5BA 4ODWA 4GKZA 1ZV5A 2HAZA 2R2HA 4YDVA 4FQCH 1BLNB 1BVLB 1BFVH 3D69B 5GGQL 4N9OB 2YD5A 3U0TB 4HIXH 4H1LG 3KJ6L 3W0WA 3BP5B 1OGTA 1NLDH 3H3PL 1OQOA 3PUCA 1T5WA 4JY5H 5I2IA 1Y6NR 3L7EA 5K9KA 1CXHA 3GI8H 4JB9L 1UADC 4XP4L 2NY5L 4K55A 3Q6FA 1YEIL 2Z31D 5HHNB 5CBEA 5LG1A 2GFBA 3TVMB 4LASH 3EFDH 1IRAY 1TENA 1CFTB 3HC4H 2XT1B 4MJIB 5CEZE 3SQOH 4L4TE 1N2RA 3QQ4A 4U4BA 2WIIB 4MJ5A 4XHJC 4R4BA 3BRFA 4ZQKA 4ZUWB 1ZGLB 2OJEA 2E7HA 3Q5YA 3S6CA 3TIDA 3MRMB 3JV4B 3KPLA 2BRQA 1WFOA 2AQ2A 3M1BA 3TPUE 3DSFL 2VLME 3FRUB 3U46B 4FMKA 2DQJH 4GKNB 2K7PA 3RU8L 4NHCH 1MIEH 5DDHB 4NN5B 1ORQB 3VFTB 4DVBB 3ARPA 1QNZH 1S7QA 4K9EL 1AJ7H 4KPHL 3QRGH 3C09C 5EO0B 2E9IA 5E8PA 2GSGB 3MO1A 1QKZL 4FXLA 4PJ8B 3OAUL 1MRDL 1FNAA 2EXWC 4UBDC 5I16B 4ONGH 1UXSA 2HJKA 4BZYA 1X4YA 4EI6B 3ARYA 4Y4KC 1AGEA 2Z35A 4GG6B 5EFIB 5DJDB 3L5WB 1SEBB 2YBRB 4F33B 2VIRA 2A6JA 3ULSA 3LN5B 3AXLA 5C0BB 3T77A 2FB4H 1ZT4A 4M8QA 4L4VD 3WN5B 1TZGL 3ZLQC 2HFTA 3P3YA 5ERWB 3T0EB 4PJAF 4TPRL 2P5EB 4GS7B 5MHSD 3WUWG 1W0WB 1GRWA 4JCMA 2ILLA 1LDPH 1MCHA 2XWTB 4N1CA 4LPWA 3GB7A 2NZ9D 4CU8A 5HYSA 1CFVH 1WAAA 1DL7L 3QIUD 1FZJA 3NN8A 5C1MB 1KIQA 2AXFB 4BH7A 5ISZB 1U8IB 5IWLC 3HN3A 3HA0A 5EU6D 4EN3C 1HILB 3S37H 3SGDI 4HKJB 4APQB 4WO4B 1XFPA 4FZEH 4JGUA 4PJDE 5C0JB 2X4PB 3MOBL 1A2YA 1L7IH 5TQ2H 2XWBA 3BE1H 5TDPA 1T6VN 3IJHB 1MQKH 5DJ8A 1B6UA 1EO8H 4P3CL 4L3CA 2V17L 1P4IL 4X7CC 3RL1B 2VDPH 3AS3A 5A3ID 4PP8C 3OV6A 1DQJB 5JTWA 3UC0L 3H9ZA 3BHBB 4M9OA 4GRLC 2ZZUT 2XZQH 1DVFC 4NZUH 2JTDA 5E03A 2GUOA 2DM7A 1R3LB 4PP1D 4LEOA 1F6LL 4R7NB 4GXVH 3SE8H 1A6UL 4MNGE 3TYFA 4DEPC 1KPUA 1TJHH 4JO4H 2O61B 3CDGA 3D0VA 1S9XB 1BEYL 3BRDA 2FBOJ 1CDGA 5EZJB 3RWDB 4OTXH 1ZHNA 2XXMB 3MREB 1OGAE 3TV3H 4GOSA 3HUJB 1HXYA 2V2WA 3GSWB 2FX8L 1QBLH 4ODTH 3QZWG 2A83A 3BZEB 1G6VK 3LS5H 4X7SH 1TMCA 5TQ0H 4I3SL 5F7WC 4ZNCD 5GZNC 4IRSA 3HRZA 5JOFA 3FKUS 5FO9A 4NFDA 4PGEB 4PRID 1MCSA 3ROLA 4BQ9A 5BV7H 3K74B 4W4OC 4XH2B 3RX7A 4WGWB 4A6YL 5I76B 1A3QA 2VE6A 3MGAA 4ERSL 4IOIA 3A0OA 2YD8A 2J8HA 3FT4B 43C9B 5SWSA 2D0FA 1F90L 4JM2D 4KVNL 2PUQT 3IGAB 3TH4T 3U0WL 4DN4L 1JGLL 5GIRA 3QG7H 3RVVD 1IT9H 2X4SB 5I17B 1I8IA 2F58L 1FNGA 3AM8C 4NM4L 1UM4L 4I5BA 2AQ3A 5IB2A 5DQDH 5I1EH 5CBAB 3CFJB 1RUMH 3WD5L 3MRDA 5DD3H 4YNYA 3C6LC 4L4VE 4S0TD 4KUCD 4W70A 2MQ3A 1B4JH 4ODXA 2YK1L 3V6ZB 1UA6H 4A6YA 4HC1L 4UV7H 5IVOA 3UZQA 2J5LB 3CD4A 3SE9L 1Z3GL 2JIXA 4OFYA 1R5IB 1QRND 3TA3D 5EU6E 4CU6A 2EDWA 4DAGL 1FLTX 3QPXL 4X4MA 2HJLA 2IPKA 3LZFL 2IH3B 3P77A 3IDYC 3OB0K 1JIBA 1KCUH 1CVRA 4HUVB 4OM1L 4NT6A 3ZE1E 4HS3A 3B9KA 4IEFB 4BKLA 1N26A 1QFWH 3LEXA 1I1AD 4XP9H 3NFPB 4LAQL 2Z8RA 3WSQL 2F74B 5CEXB 4X6DF 1D5XA 4CDGC 2Q76B 5C0RL 3U7WH 5D2NC 4OKDA 2R4RL 1JZ8A 4MS8D 4MJ6A 4HC1A 4EI5B 5DK2B 4M6AA 1TJIH 4JZJB 4QGYA 2DDQL 25C8L 4OCWL 7CGTA 4PV9B 1JWSB 3D69A 1M4KA 1FNLA 4Z7OF 3T1FA 3U0TA 3WNLA 4M43L 4P4KB 2LU3A 3HTLX 3U36A 2R69H 4YGVA 4OF3A 4DFIA 3T3ME 2LTQC 5A16A 4Z7UF 1NLBH 4F7CB 2B1AH 1P4LA 4FQXA 1MFBH 3LOWA 1HDMA 5DSCA 5HHNA 4PRIE 3VFWB 3VJ6B 5HVHB 5EA0H 5KZCB 1O0VA 4JQVA 1K6QH 5F8QC 5JXAH 4NBYB 1CFTA 5TJWK 3HCVA 1TCMA 3O0RH 1Y6KR 4X7DC 2WIIA 3BDBA 1KEGL 3D18B 1UT9A 2XZAL 2OZ4L 4I2XB 5KN5B 1DBKH 2WP3T 1U58A 3ARBB 3VWJB 1GZQB 4NZTL 4Y19D 3P4NB 1J86A 4QTIL 3N1QC 2G5BB 4U2ZA 1DBML 3O9WB 3PG2A 15C8H 4Z95H 3BW9B 4K94H 5FYKD 4AT6B 2KUTA 5I6XB 4WDIB 4DTGL 3H3KA 5IP4A 5EORH 5DLMH 5DDHA 4DVBA 1I85A 1SJHB 2A6DA 1KT2B 4NKQB 4JDZB 3QWQB 1ADQL 3O6FB 3MUJA 5B8CC 2GSGA 5I1HH 3P11H 4G3YL 4PJ8A 3RZCC 1H15B 1OAXH 2G75B 2YUXA 5I16A 5DTFB 1EZVX 2ICWB 1FYTD 4MNHA 4HBCH 3BOVA 2D31B 2Z0BA 4MZ3A 1EO5A 2YRLA 1SEQL 3V4UL 4J8RB 3BO8B 4GG6A 2OZ4A 4LP5A 1XGUB 4JVPA 4LLAA 5EFIA 3A6BH 3L5WA 3FL7A 3OR7B 2QQQA 1QRNE 5F9OH 3EAKA 5C0BA 2VXVH 4EXPX 1OB1A 4LSPH 1AY1L 4M48L 3CSBA 2AI0H 3Q1SL 1LWRA 3T0EA 5IIEA 4M7LH 4OGZA 2PETA 1IGCH 4NQTA 3PGDB 5TF1H 2AJXH 2NY2D 2APWA 3IXTA 5KS9B 1E4WL 4DW2L 2AJVL 2VZ1A 2YD9A 1ADQA 5JNYA 2ITCB 4XWOC 4K7PH 1I9IL 5CJXA 2Z4QB 1V7MH 2Y4SA 3C60B 5J12B 3VDCA 1G9NC 4HKJA 4YHOH 4WO4A 4APQA 5CP7B 5GGUB 2X4PA 4RWHA 2FO4B 4NO0B 1J88A 5D7IE 5DXWA 1C5BH 4LP4A 1YN6B 3RWFB 4LPTA 3FFDB 4XVJH 2PCPA 3ARTA 3BX7C 3MODH 1EVUA 1UVQB 3AB0C 1LMKA 5F7FA 3ZDZF 1E6JH 1V7NH 1JPGB 2FHCA 5GSVB 3VFUB 1AD0B 1RAMA 1HIML 5DT1L 2NY3C 1A6ZB 3PQYB 2LFGA 3OGOE 4WW1B 1CZ8H 4R7NA 1N59A 1OCWH 4U3XA 4P2RE 4WFHD 2C26A 5FO7A 5HD8D 1LO2L 3QH3B 4NGHH 3QEGH 4NWTH 4XI5C 5I19L 4DZ8B 5IESL 4YDLC 1Q0XL 3E3QA 4RA3A 3NABL 3VFGL 4HZLA 1RZJC 1KCSH 3MV9D 1PX3A 1P4BL 1ZMYA 3HE7C 5GGVY 5DUPH 3TYGL 2B7DT 4UIMB 1FCCA 5HHMA 2RR3A 4BFIB 4Z0BL 3BZEA 1C5CL 4I77L 5IB5B 2BHUA 2G60H 2WAHA 1V3LA 3GBLA 2NX5B 3VWKC 1G7JB 1A7PH 3MFGB 3MV7D 5AAWA 5BRZD 5FYKE 1NCWH 1HZHL 3CZJA 4R97C 1SYVB 3GMMB 4PRPB 3CSPA 3M8OL 5I1KL 2EYSA 1M05B 4OLUL 1G6RH 1YN7A 5I76A 2X1WL 5GSRB 5IMMB 1QP1A 3GIZH 3CNKA 4J6RH 3H9HB 3FT4A 4LFHG 3CVIH 4HZAA 3RTQC 1VADA 2EDLA 3TFKA 2X4TA 1FYTE 2ZP0T 5C6WH 3OZ9H 3UEZA 4M61B 3TN0A 2XA8L 4YUEH 5I17A 5DYOA 2WY3A 1QPPA 4K07A 4QRSB 4XNYL 5C92A 5FKPB 1A0QL 1T0MB 5C0GA 5SV4A 3X3GH 1Z5LA 1G7HB 4FFVD 3GSQB 2K9UA 1JGVL 4WFGD 3U4BL 1U6AH 3IRZA 4MCYB 3C08H 5C08A 4UQ2A 4KU1A 3QO1B 1F4AA 1FPTL 4IM8A 5BV7B 1OT2A 5DC4B 3V6ZA 3DXAD 2QR0B 2AK1H 5E8DH 1CFQB 2DQHH 3GNML 2R1YB 4Y16B 1R5IA 3VXSB 3WIHL 4PP2A 3DWTA 1L7TL 1HH6B 4HCRL 1QVOA 3U30C 3T09A 4LEXL 1N7ML 4C59B 4PLKD 2P5WB 2IH3A 1HHHA 4CN6A 1YMMA 4HUVA 1A9BA 2V6HA 5FK9A 4I3GA 1R5WB 1GCFA 5F93C 2P47B 3BPNC 4TUJB 4JFHD 2XXCB 4DVRH 2C4XA 5C07E 2XTJC 5CJ5A 4QO1A 3NFPA 2F54B 3IRPX 2I07B 4D0DA 3I6KA 4GSDH 4RMQA 1GVIA 4G6KL 2Q76A 5EU3A 3WEXA 4X80H 1FLRH 4XPFL 1S5IH 4HXAL 1KCVL 5EB9A 4MLIA 2J1KA 5A40E 3S96B 3RX5A 3WIHA 1T21A 4RMRA 4HCRA 1X5AA 4FQCL 1KTDA 4LSUH 3BP7A 4PV9A 3MV9E 1F2XK 5IQ9A 5IFHH 4V1DA 3TESA 3LH2H 3VXMB 5J57B 3G5XB 4R96B 2VDMH 3GMLB 4P4KA 4P9MH 2QSTA 4NO5B 5IHZB 3HFML 1RZFH 4OI8A 5F7KC 3OF6A 1GAFL 1WBZB 2BJMH 2HN7B 3U83A 1Z0NA 4HK3N 4J3WA 4HWUA 1U8QA 5DO2D 4TSBH 3VJ6A 2WBJD 4IMLA 5BRZE 3LEYL 3ZDYF 2MCPH 5FYLH 5IEHA 4ZOEA 3HS0B 3N1GC 4CMMB 1U8KA 3BZDA 1FNSL 3SQOL 4IRJD 3V0VA 4K8RC 4GG8A 4HPYH 3TJHD 5FM8A 2WSKA 2R0WH 3F8UB 3MBEC 3GMQB 2E9JA 1AP2B 1ZGLM 1NL0L 1GZQA 4XCCH 4ZUUB 1R3KB 3P4NA 5C0DB 1AIFA 1TFHA 2DQJL 2G5BA 2BMKB 2VH5L 3DI2B 2EDFA 4NHUA 3B2UD 3O9WA 3INUL 2VLKB 4WDIA 3JVGC 3VH8A 4P57B 4PJ7B 4RX4A 4JDZA 1OW0A 2FHFA 3O6FA 2J7LA 4NQCA 4WFGE 3WKML 4G5ZL 5CZKA 4R3SA 5F6IB 4NKDB 2W1NA 1H15A 2G75A 5GJSL 4BSWB 4E42B 5T33H 1PKQE 1BIIA 2ICWA 1I7TB 3VW3L 4N8CH 2QQKH 4NZRH 4D9LH 5L8LB 2R4SH 3BO8A 1YZZA 1XGUA 2QKIB 1S7RB 4J3XA 4XAWL 1MCPH 3PIQA 5DJAB 4NNPH 4K7PY 1U91B 5LGHH 3MRHB 4LHUB 2CLVB 3V6OE 5KVEH 2EIEA 4HUMB 2ICWJ 5I74B 4DQOH 4LRNL 3OG6B 4QXGH 3L3JA 4I0PA 1PVHA 3PGDA 5DZLA 1BF2A 3SDDD 3U0PB 4MQXD 4KKAC 3U9UB 2HMID 5KS9A 4ZUSB 1BVKA 4HUWB 2ITCA 5FXCH 1S7WB 4JFEA 1RQ5A 3NACH 1CFSB 2Z4QA 3J8F7 2VZOA 2UUDK 4NQUA 4N8VG 4EKXA 2DLHA 3B5GA 1CF8H 2FO4A 5TQ2L 5DVLA 1F4XH 3CFBB 3TNMB 3MYZA 4JFZH 4PY8J 3RWFA 3SKMB 2XG4A 2Y7QB 3FFDA 3UJIL 1WIPA 4NRXB 1VEMA 5J0BA 1WC7B 3VG0L 4JO3H 1MVUB 5B38B 5EPMA 1MFAH 4OZHA 5INCB 1AD0A 1CLZL 2VDOH 4NZUL 4MXQD 2XQYG 4LCCB 4M6NL 1T20A 2VLJA 4I18C 3ARFD 5F7MC 2OSLB 1QSFD 3JV6A 3K2UL 1U93A 4LCWA 4TSCH 4BYHA 1DBAL 4PLJD 4HXBH 2XYCA 3IB4A 1IEBB 3CCHA 4X6CF 1NSNL 3KPPB 4XC3H 4F9PC 1I4FB 1R0AH 4DCQB 3QUXC 2MJWA 4DZ8A 4KJYA 3WUZA 2VN7A 1IGFH 1UM5H 4J3VA 4HDIA 3DX7A 2Q1EA 4ODTL 4UIMA 4OZGE 3E6FB 3NPSB 1DSFH 5DVKA 3WFBL 1QACA 2YD4A 4TN9A 2YEZB 5IB5A 1XR8B 4MVBD 5EZOH 1G7JA 4Z76A 4LHQB 1W72L 4PJEB 1I1FA 4AG4L 5BXFB 2DIJA 3QIUC 3TGXA 1FAKT 2EDOA 1RIHH 2OM5A 3MACL 1QYGL 4PRPA 5BV7L 4XVTL 3QDHA 5ANMB 4Z77B 3LIZL 1NKOA 2A9NL 5GGVL 2N56A 4IDJH 1H8NA 3LRGA 1CDCA 4G8GB 4HEME 1A4KB 2PXYA 1FVDA 3O45A 2JB6B 1ZVYA 4LNRB 3KPRB 3BGMA 3H9HA 1IBGH 4IHOB 3QFJD 3QP3A 2I60H 2ED7A 2WZPD 3EYSL 2ADJA 1F58L 4DGVL 5H8DA 3LRSA 4ZAKA 4UMGA 2F8OA 4XP1H 4XZUB 5SWQA 2VDRL 4QRSA 3X3FL 5FKPA 4ZSOB 3NOIA 1XGTA 1G7HA 3AY4A 1W72A 2AAVA 1BFSA 3MRJB 5EOCH 4KROB 2HKFH 1RUAL 1LD9A 4WY7H 3QUYC 1KBGL 1G6RB 3PHQB 1P7KB 1FSKB 1EJOL 4UV7L 5GS2D 3K7UA 1CFQA 2R23A 4X7TB 2R1YA 3SO3B 4HKZA 1HH6A 3Q6GH 3D85B 3PL6D 3JWDH 5KSAA 4JO2L 5D7JB 4NC1E 2DBLH 1HNFA 1Y0LB 2P5WA 4WWKD 1MRCH 1A6VH 3WXWH 4U6VL 5JW3H 2V2TB 4LSVH 4P2OD 3WIIH 5BVPH 1J7VR 1U3HB 3DOSA 2KQMA 3RX8A 5D1QC 5IHUH 4HPOH 5E6IB 4QRUB 1RUQH 5TFSL 4WFFD 1MJ8H 4FFYL 1ZLUK 1Y18A 2PYEA 1U9KA 4JHWH 3FB8B 5KSVB 1BHGA 2WP3O 4N5EC 2DLTA 4KRPB 3DX6B 3UAJD 2OJZH 3WIFA 3W9DB 2VAJA 4HFUH 1MCOH 4ETQB 1K8DA 2W9DH 1NC4A 4JAMA 4JR9L 5I18H 1NBVL 1GJIA 1S3KH 3RVVC 4X98B 2AJ3B 3OKNA 3BH8A 1NFIB 1A3RL 1NFKA 3S96A 5JOEA 1J1PL 3BQUD 2GJ6D 5D2LE 3TZVC 1MHHA 4D3CH 4GXUN 5IMLB 1WT5A 1IVLA 2B1AL 3WNMA 3N85H 3WKNA 4D0CB 1MFBL 3KJ4B 3QDMA 1RZKH 3ARVA 4H8WL 3KPTA 4G6AD 1YEFL 2XKNB 5JXAL 2O93L 3HS0A 5C2UB 3I50L 5BVJA 4JREB 5EU4A 2CO6B 4M6OL 4TSAH 1DQLH 5IKCB 3O0RL 1NCCH 3VMNA 3QEUA 5SX5K 3OR6B 1EERB 5HVGB 5GS0D 3EYOA 1PJ9A 1MJJA 2R2BB 1RJYA 3QG6A 3GMQA 3DGGB 3QFJE 1JRHH 4XP6H 4MMZC 1KYOK 2BVUA 4U6HA 1R3KA 3RWCA 4HJ0C 5C0DA 2OTWB 3ZHLA 4L8DB 4L9DA 1QO3B 3O6LH 4X5LA 5E2VL 4TVSa 4Z7VF 2IMNA 4P57A 2BY0A 3BWAB 4HQQH 4KQ3L 4NO3B 3TPUB 3C5ZC 3KVQA 1KB9J 2X05A 4KMLB 4ODVH 1JNLH 4CAGA 1ORSB 1EGJL 3NIDE 5ICZA 3NCBB 4BSWA 1ZS8B 2BVYA 6FABH 3UYRL 3HZMB 1RZIA 1FH5H 1QR1B 5DFVC 3QFDB 3I3DA 2HA1A 1CIUA 2QKIA 2FATH 4CDHA 1C12B 5HYSG 3NVQA 5FHBH 5DJAA 2MTPA 3MA9H 4P46A 4XPTL 1UWGL 2BNUB 4WFED 3UTTD 3D87B 2EO1A 4YHLL 1BFTA 2AI0L 4YGAB 5FAAA 4OBSA 5FF6A 2DD8L 4ONHB 1FE8H 2EKJA 1L9NA 4DN3H 2IFGA 3VGAC 1F97A 3KXFA 2AJXL 2Q7NA 2Z92B 2B5IB 2ZJSH 4JANB 2P24B 4K7PL 1M7IB 1EGJA 2GSIA 3SN6N 1PLGL 2VWEC 5IV2B 2WUCL 2PN5A 1FDLH 1I9JL 5KSBE 5IW1A 3O3BB 5EBLB 1MFDH 3MLXH 4S10A 3CK0L 1PZ5A 1G1CA 4U0QB 2G9HB 4PJ5D 1S7VB 2W9EH 3TO4A 5H94A 2Y9RT 5HJ3B 3CFBA 4D9QD 5ABDE 5HHOE 1E27B 1BOGB 4YK4C 1ZLVK 2CJUL 4LARH 3SKMA 1JNHB 1BQHA 4NRXA 3GMPB 2GJ6E 3CXDH 1WC7A 4JM4H 1MVUA 5B38A 1DANT 2EC8A 5CJBA 1E6JL 4EOWH 1G7PA 1NEZG 5F70A 5INCA 4O2FA 4OQTH 4XWGL 4LCCA 5IR1B 2OSLA 5F7EL 1UKQA 1G9MH 1PFCA 1PX4A 1PQZB 2GAZB 1X4XA 2EE2A 4KI5C 4NWTL 3QEGL 3KPPA 5L8KB 4Z8FL 4DOHB 1CXIA 5BS0A 3V5HA 2D7NA 2FX7L 3BGFB 4MCZB 4OCRH 2UY6A 1JNNL 1KG0A 2DMKA 4BH8B 3T4AB 1EJ6A 3OSKA 4JCLA 1YPZA 4M7ZB 3OKLA 5DK3A 2NY0D 2YEZA 3SJVE 2G60L 5B22A 1WV7T 3MJ8B 1S9YA 1J0IA 2YRZA 1CE1L 2AXHA 4X0KA 3HZVB 2GTWB 3WV0A 3G5YA 4PBWD 3FRPA 5EN2B 5C0IA 2ZOKB 3I9GL 1GGCH 3PHOB 3ALWA 3ZO0A 4U1KB 4JHZA 3IDUA 4Q6IB 4G8GA 5IB3A 3RKPA 1NGQH 2JB6A 4M5YL 4I9WD 2DWEB 3OMZA 4KHTL 3HPLA 4WHDA 1UCBL 2HRPL 3THML 3AU1B 4FHBD 2RFXB 2NY5C 4M1GH 3GI9L 5ILTL 1HCVA 4QYOA 2P46B 4XZUA 5FECB 2BY2A 4MQSB 1CGSH 4XVSH 5FM4A 4LFHD 5EH1A 8FABA 4OT1L 3X3GL 4KJWD 1J8HA 4ZSOA 4WFEE 4AQ1B 4HWNA 5D93C 1QBMH 5EG6C 4K23H 4NKIH 1C16B 5HD8C 5FUZH 4RIRB 3FQUA 5JIPA 3RHWK 5FUOH 2A77H 3C6SA 2NLJB 1DLFL 2C4FU 4KDWA 1IAIH 1PEWA 2AGJL 4QRPB 2J88H 5GRUH 5JHDD 3IAGC 1AKJD 4QXWA 3VFNA 1IM3B 3RHWF 5I1IH 2IQAA 3QUZB 3D85A 3QQ3B 3DUHA 3SBWA 4K9EC 3CVHL 1NGWA 2PTVA 1Y0LA 4JLRB 3QIWB 3S35X 2QSCH 4UDUB 3FJTA 4S1QH 5HXMA 2W92A 3UTSA 5C8JB 4YX2L 4NYLB 4AEFA 5F1KC 1TNMA 3IJSB 1MF2L 3TM6A 5E6IA 3DUSA 4QRUA 1MJUH 3FB8A 3DROB 2NXZC 4Z7UB 2VR4A 4PJ9A 2Y23A 3W9DA 4ETQA 5EWIH 1UJ3B 4HV8B 4NP4L 1A8JH 3HI6H 5FO8B 4UDTB 4X80L 4PB9L 4YDKL 2VXQH 3VXUB 1S5IL 3ZYIA 2DTMH 2AJ3A 3UO1H 4KK6D 1MJ7L 1NFIA 5DF0A 2DQEH 3ECBB 3NZHH 4KTEH 3RWGB 5JHLL 2AV7B 3CVHA 4UOJA 5J6GB 3V4PL 4WUUB 4ZXBB 5SWZD 5IMLA 2DQCH 3ZT5A 4XX1G 4BUHA 4OCSL 1K9TA 4X6FB 4JVUA 5KVGH 3FFCD 4WCYH 1W8OA 2EH8H 3QXUA 1NCUA 2DQFA 2FL5A 4JY6A 2VZTA 5H35B 2HH0H 3TIEB 1GHFL 1CICA 1KTLA 1T6WA 3GSNH 1YEDB 4U6XB 1OWRM 4XPBH 1IKNA 3EDFA 2R2BA 4FZ8H 4PLOB 5ICXA 2W07A 1N5AA 4I9WE 3DGGA 2IPUG 4H0HB 5KOVC 5GHWL 4U3CA 3LY6A 2EICA 4J1UB 4P23C 4BQ8A 4OD3H 3RL2A 3DVIA 2X2YA 4L8DA 1MEXL 2KH2B 3BKYL 4AMKH 2F53A 2CKBL 2ZSVB 1HWGB 3MBXH 5DS8A 3FCTB 4NN7B 2C3GA 3BWAA 3NH7H 4KDVA 3WNOA 3U1SL 4PJAA 5CSZA 1KENH 1ED3B 3CMOL 1DEDA 5HHPB 2IG2L 5HI3C 5IHBA 3C2SA 1ORSA 2IH1B 3JUZA 1ZLSH 5LKNA 1ZWIB 3RDTB 2H3NB 4Z0XA 3PE9A 3HZMA 3FMGH 5E8NB 1QR1A 3O6KH 2V5MA 3HLAA 5HYEA 5A2LH 2R4SL 2JJTC 5JHDE 1NAML 2EDEA 1P7HL 4FQIH 5DJXB 1FCGA 3CZFB 3WFHB 2BNUA 4WJ5B 4PJDF 3DMMD 2OTUA 1JUFA 1A14L 3HE6B 3ZKMC 3RAJH 1T1WA 2GI7A 5ACZA 2X10A 2WBJC 2Y6SC 1Z9LA 4W81A 2CKBA 2DI9A 2CGRH 5HYIA 1FC1A 4MD0B 1F5WA 5D1XD 2Z92A 4EZMA 1ES0B 3L3HB 4IRJC 3MOQA 4UQ3B 5LAXA 1FNEB 4JANA 2P24A 4J4PD 5J1TC 1M7IA 4PJHB 3NACL 3CH1A 5DK0A 4Y4FB 4F7MB 4FXKB 3O3BA 3B9KC 1BQLL 2G9HA 1S7VA 3E8UH 3CDCA 4ODSH 4NQDD 4OB5L 4JFZL 3B2UC 1NGZB 2QEJA 3C9NB 1BOGA 1NAMA 4OI9A 1CDBA 3PP3H 1H3UA 1H5BB 5DWUH 1MFAL 4P2QB 3MMEA 1NC2D 2C1PB 3MRBA 4WW2B 5FM5O 3CGTA 5IR1A 4Y2DD 5IB1B 3BPLC 3JSSA 1R3IH 3BYTA 3G6JE 4H0IA 1VFMA 4HUUB 2GAZA 1PQZA 3FFCE 3Q5OA 5JDSB 2IANA 3WDJA 2CR6A 1XGRB 3DV6A 3GUTB 1R0AL 1A6PA 4NKOB 4RRPG 1EXUA 1G7LA 3KDMB 4MCZA 1QFOA 1QSVA 1FRGH 4FQXC 4HKXA 4P2RB 5T1MB 3D39D 3LKOA 3RA7L 2VC2H 1Q9OB 1B0GA 1HHKB 4JQVC 1TPXC 4PBVC 1NFDF 1Q0YL 2BVOB 5I1AB 1NBYB 1CU4L 1FL5A 4MQXC 3WFEH 3F65A 5DZOA 2HMIC 5HY9B 1HXMB 4LMQI 3AMKA 2NY6C 5ETUA 2ORBH 4OCXL 5ESAB 3RNKB 1IGYB 1RIHL 3UTQB 1S7XA 2HFEB 5E8OB 4HSQA 4ZFGH 3O4OB 1OSZA 3HI5H 5T5FH 5GJTH 2QV2A 2C7UB 4Z7WB 3NCJH 2OLDA 4MA1C 1DBJH 3S97C 5IFAH 1IAKB 4YE4H 1I85C 1VPOL 4OV5A 4XPAL 1TETH 2RFXA 4BELD 5L9DL 1OP3K 5L2KB 3EO1B 4I8DA 3RUGE 3X12B 1OAYH 3EYQC 4PJBE 3RP1A 3QT2A 2DQTH 3MRFB 4UT7H 5FM5M 5J11B 2H45A 4LPXA 3PGFH 4N1HB 2ADGA 3G9AB 1CTOA 1C16A 1YMHB 1KTRL 3SCMC 1OL0A 1BMGA 3KLDA 4KKCC 3FB6B 4OLWH 3ZE1F 1M7DB 5GGSB 1FAIH 2DTSA 2F5BH 3AS1A 1J1XL 4X6DA 3QO0B 5DD0H 3MLSL 3LEVH 1GGIL 5DD1L 5D72H 5EDXA 3TLRA 3ARGD 2V2XB 2D4DA 3SDXF 3JWDL 4Z9KB 4P4RA 5D71L 3QDJD 5F3HA 1HINH 2XN9E 3DYOA 4NQDE 3B2VH 4UDUA 3QI9B 4XNUH 2OR7A 3WIIL 3PWNB 2YR3A 4W68A 4YHPB 5C8JA 1I1CA 3C2AH 4MDIB 3RY4A 4NYLA 1A21A 4WO4C 1R24A 3IJSA 1I7UB 3DYMA 4PJXB 1RUQL 2OI9A 4XP5L 1OY3B 2I9TB 4Z7UA 3SE4A 2OJZL 3LHPH 3GDBA 3VXPA 2W9DL 3L5XL 2B0SL 4TTDD 1CD1B 2VZUA 1AR1C 5ID0B 2NY4D 3VXUA 1YEHL 3MV8D 5IT2L 3DURA 3A6CH 4B41A 3RKDC 3W0WD 2RQ8A 4JFFB 1MPAH 3VXTB 2AV7A 1UWEH 5ADPL 3D39E 5J6GA 1OD7A 4KC3B 4MA7H 4R4FL 4WUUA 2AKRB 3KYKL 3S4SB 4ESKA 4DZBB 1JZ7A 4CKVX 2NXYC 4JM2F 5T3XL 3NCFB 3MA7B 1OTUD 5I8OH 4X6FA 4RSVA 2ESVD 5KVMC 1F3DH 1QA9B 4M7JH 4YIQB 1U8MA 3P30H 3BRGC 2YMXL 4MNQD 5ALBL 2P8LA 3TIEA 1RUPL 1GGBH 4TSAL 2X89D 3MC0A 1KF9B 4U6XA 5B4MD 4KUCF 5CP3A 4J23A 2ZUUA 3R4DA 4X5XB 1IM9A 3O8XA 3L1OH 3IFNL 1OT1A 1KSRA 5FCUH 4OLEA 5EU7C 1ZSDB 3TFKC 2V7NB 3SDAD 1YYLH 3C09B 2ERJC 4U33A 4I4WB 3CJJA 2B1HH 5HHPA 1IILE 2H9GA 3TN0C 2NW3B 3QEQD 2B4CL 1JNLL 5HDOA 2XKUA 5D7LD 5EO1B 1G9NH 1QSEE 4Y4KB 4X7FC 1CXKA 3MLUH 1FL3B 3MZGB 2Q8AL 1H3PH 32C2A 6FABL 2DJUA 1CT8A 5FYJH 3GSNB 1A1MA 3BD4A 3MLWH 4EJ1C 2D0HA 4HWBL 5C9KA 2CUIA 1UZ6E 2ZSWA 3S9DB 4U6YA 3VD7A 4FQLL 1MREL 5GRYA 3VRJB 1A6TB 1PKQB 4PRHE 5DJXA 2NYYD 4QY8B 3CZFA 4JPIA 5HGGS 3QDJE 5T1LA 1IQWH 5BOZG 4YHNB 5FA3B 1EUUA 3HE6A 1UKTA 2RJMA 2CSPA 5D7IF 3UPRA 2CLZB 4OUOA 2LABA 2GT9B 3IFLH 1ES0A 1U8NB 1J5OH 4EN3B 1FNEA 3ZTNL 1J8KA 1MCQA 4Y4HD 1KB5L 2CK2A 1RZJH 3MGTB 5K9QG 3KYAA 4Y4FA 4F7MA 3QQ9D 2QSQA 1E4XH 3ILPA 3MJGX 3BN9C 4X6CB 1I8KB 2FYYB 4YHKL 4HWBA 1AO7D 3OKKA 4GAGH 4KJPC 2VKWA 1NGZA 3C9NA 1KIRA 1OPGL 3MCKB 4ENED 3W0WE 1Q72L 4GRLB 5I1DA 3HG1D 3EUUA 2Y07H 2ED8A 1DVFB 1T5XB 2EZ0D 2L7UA 4EOWL 5A2KH 3GBNH 2C1PA 5CINH 1HI6A 5F7NC 1ZKAA 5HI4C 1XEDA 1D5ZB 5DRNA 5T3ZD 1KLGB 5IB1A 5D7SH 3QBTB 3UPAA 3PV7A 5BO1L 4HUUA 5LQBL 1HHIB 3D9AL 1YEKH 3QDGA 2QHRH 5C0EA 1XGRA 3GUTA 1D9KD 3I3EA 4G8IB 4NKOA 3LB6D 1CL7L 2C3WA 3OJMB 4FS0A 4UT6H 5I1JH 4B53A 1Q9OA 4JPKH 4MQ7B 1G7QB 1HHKA 3O6ML 5ITBL 1NBYA 2L4OA 4PGCB 5KAQF 5D8JL 5LCVH 2AV1A 5CUSL 1JTTA 5HY9A 4L3EA 4KK5D 4NQEA 4WHCA 4YC2C 4O9HL 1G0XA 1QLFB 1I7ZB 3L6FB 4NUGH 2D9QB 4G6FB 3BN3B 4O02H 4RZCB 1CN4A 2I9LA 1CE6A 2C7UA 4GW1B 3QEQE 2CXGA 1OAUH 4ZYKB 1TCRB 5JR1L 5D7LE 1I1YB 3HC3H 1IMHC 3STBA 2E8ZA 2VNCA 3QXAA 4NM8H 5J1SC 2P8PA 3STZB 4G6JH 2X4UA 1VACB 4JG1L 4KAQH 4YPJA 3VXNA 2WNGA 4YHMH 1F4YH 2X7LB 4HX1B 1BX2A 3C6LB 2ARJQ 1VCAA 1FORH 4NCDA 3EGSB 4U1MA 3ULUD 5JLZB 4RWYL 2R9HD 2IALB 5DUBA 1CL7I 5I1CH 2K1MA 3KYMA 2IFFH 2FD6H 2IPTL 2W0KA 3EHBD 2JK5B 3WLWC 1M7DA 3GJFK 4P59H 4HMCA 4CMHC 1FV1B 1U0QA 1EFXA 1PKOA 3H0TB 4F80A 5FGRA 3VCLB 2F8XC 3QO0A 5D6CB 2FJFB 2X4QB 3SDYH 1ODAA 4I0PC 2FHBA 3MXVL 4CBPA 1FFOA 4XNXL 1IFHH 2V2XA 3IDYB 1ZA3A 3ARDD 1DBBL 3IAPA 2ADIB 2VZVA 5F88B 3IJYA 3L7FB 4HGKC 3OKYA 4GT7A 3DBXB 1AO7E 1K3ZA 2A6KB 4PG2A 5I1GH 1U8HB 1ZT1B 4S1QL 4MJ4A 4U31A 3PWNA 3V79C 4DK6A 4MDIA 1YC8A 3LQAL 4DGYH 5J1AB 3F7RA 1PEZA 1QLEL 4RA0C 4CVXB 2HTKD 4LLWB 2P4AB 4G7VH 3MLVH 2I9TA 2KZ1B 2OP4L 5IBUB 1U95B 5D2NB 3FB7B 4XMLH 4K8RH 4UV4H 2NR6C 1CD1A 5EU5B 2DTML 1BECA 2Y72A 1NUGA 2EE6A 4OGAC 2OL3L 1Q9LB 3TCXA 1JGUL 2CRZA 1Z6JT 4KTEL 1HKLL 1T2QL 1WIOA 1A7RL 2PKDA 1YDPB 2LTQB 2NZIA 2AKRA 1OAQH 2VITA 3S4SA 3REWA 3CU1A 1HHJA 2ZNXA 4WTXA 4F58H 5H2BB 4TULH 2J8UB 5IG7A 3TVMD 5D6DA 4DGIH 4TVPL 4MJID 4WCYL 5HPMB 4OCYH 6CGTA 5GGTH 4KFZC 5A2IH 2AK4B 5F7YC 2HH0L 4CGTA 4CADB 2FJHB 4GBXD 5SWSE 4AEHL 1P7QB 4MXWL 2EEBA 4OUUB 2F19H 5E6YA 4ZTOH 3FQWA 2OL3A 4LLUB 5AZEH 5TE4H 3MR9B 1T04B 3GSVB 2PXYC 2X40A 1NMAH 2RAMA 2N4IA 3UTZB 2XZCH 2FH6A 4TRPH 5B8CB 2VXTL 3EOYG 3QXDA 5ID1B 3RZCB 2L7JA 5JW5B 1MVFA 4ZAKC 5HYJB 4LHUG 3SDCC 3D25B 5DRXA 1YEGL 5IB4A 2OK0L 1A3LL 4XRCA 3P0VH 2FCBA 3R8QA 1FL3A 1MRFH 4Q0XH 3U6RB 1MI5A 3P9WB 3GSNA 3V6BR 3FMGL 3CPLB 2KKQA 3AY4C 5I9QC 1XF2A 1U8LA 4NQXB 5C0BD 2UWEF 3DO7A 2HG5B 3WFDL 4X4ME 5K9QI 1X5GA 3GMOB 1FN4B 4YFDB 4BZ2L 1X4ZA 2P5ED 1WCQA 4RDQG 5HVWA 4OLXH 3D3VB 5FA3A 1AHWA 5DHVH 2RB8A 4GRMB 1RK1B 5GGRY 2CDEA 5IBTL 4NNXA 4XNMB 5KSAC 2GT9A 2E7LA 3IKCA 1BZ7B 5ISZD 4YWGH 1D3CA 1U8NA 2ZG2A 3T0VA 4M62L 4EN3A 3PDOB 3CC5B 1KACB 4G80A 4MAYA 5DJCB 3V5DB 4EUPH 5B38G 2BVTA 1BQSA 2Q87A 2BERA 4O00A 1X7QB 3O11B 4S1DD 4X6CA 2VISB 3E8UL 4CVWA 2HT3C 1MCFA 3OKEB 1XGYH 3AB0B 3UP1A 4MA8H 4ZOAA 1QRKA 5GISL 4ONFL 4N1EA 1DVFA 1EEZB 5DWUL 3MZTA 2NY3B 5DR5L 1GIGH 4S0SD 5HHOB 4OZGF 1INDL 1KLGA 1A6WL 2HFFB 4GQ9H 2QSVA 4U1NB 1U8JB 4MJIE 2EDDA 3CLEL 3I84A 4YDLB 3RWIA 4OIIH 1VFOA 4FQ1H 1WT5C 1FG2B 3HE7B 3TBVB 3FRPG 3RNQA 4XX1E 4LF3A 1T1XB 4NPYB 4KWUA 3DMMC 5DMYA 3OAYH 2UYLB 2F5AL 5GGRB 4MQ7A 1G7QA 3VWKB 4JFXA 2DI7A 4POZD 1MWAH 4R97B 1S5HA 4UIKH 2HLAB 3E6HB 3GO1H 4OKVB 1I9RL 1I7ZA 5TE6L 5CKGA 2X44D 3S34L 3HI1B 5IEKB 1FYHB 2W9LA 4JRYB 3RTQB 2E8YA 4F57H 3P0YH 5J6HA 1I1YA 2VDKL 5C0CB 1UEMA 4OGYL 3SOBL 4GG6E 3STZA 1AQKL 1QHOA 3CDFA 3D2UB 3VXQB 4KUZH 1VACA 3LV3B 3OGCA 5E99L 4H8WC 4JRWA 4F8TA 5C0BE 1JWMB 1JWUA 4X4YB 4ONOA 1EHLH 3C6LA 2DQTL 3T0EE 1XCTB 1RMFL 3H8NA 1DN0B 4TOYH 2P5EE 2CIIA 5FOBB 1LGVA 5C7XL 5C0AB 5JLZA 1RIUH 2E7BA 5C0NC 3TWCH 1N64H 4G59A 3L3GB 4QRQA 1TVHA 1XZ0B 4OLWL 4P46C 5I66B 3R0MA 5ADOL 5J13C 3K8KA 1FV1A 3H0TA 2P43B 3VCLA 5ENWA 3U30B 4JFDA 1KC5H 2FJFA 2YRPA 4ZS6D 4HUXB 1A5FL 5KTEL 2CDFA 4URTB 4FFEX 2R2EA 3L95A 4PTUB 3H7BB 5HGHA 3L7FA 4N0RA 3OJDB 3FO1B 1LK2B 4OLYH 3BD3A 3NA9H 1ZT1A 3BPNB 4UU9A 2OX5A 1QFWI 2AJZB 35C8L 4XNUL 4LSDA 2EE3A 5TDNB 3PWPA 2XTJB 1X5XA 3TO4C 4WTWA 5J1AA 5D2LF 2G5RA 2XACC 4RNRB 4F3FB 3I75A 1ZVSB 4G42A 5JPNB 3F7YA 4LU5H 2VTFA 3LHPL 5EC1A 4LVOC 4KH2A 1VGEH 3FB7A 4PS4H 4EI5D 4CW1B 5H37H 5JO5B 3IDXH 2C3VA 4PB0H 1IC4H 1BBJA 2J3SA 3E3QE 1NDGB 4M7KH 3L3DB 4Q9QL 1Q9KB 1IAIM 3HUJE 5IQ7L 2X4OA 2SEBB 1T3FA 4OIBA 4LCIH 5JW4M 4P4KD 2UZYB 3QSKB 1UWEL 4NWUL 2FX9L 4B7LA 3MRIB 3OF6D 1U8PB 1YDPA 3ZDXE 4HJJH 3VGBA 1MCCA 2ICCA 1A9EA 5CHNB 3MCLH 1EAJA 3RWEB 2M1KA 1WZLA 3BT2H 2R2CA 2J8UA 2C3XA 4A2LA 2BC4B 5KZCD 5I8OL 4Z7VA 5F3BA 1LVEA 1JGDB 5F89B 4FABH 1Z9MA 4KKNA 2QQLL 2AK4A 3Q0HA 4MSWB 3VXRD 1RULL 5J8OA 1JVKA 2FJHA 1NCTA 2MHAB 1AI1H 4QF1B 1F45A 3MBEB 4WGVB 5DURB 3ARBD 5E2UH 4OUUA 3VWJD 3B9EA 5AYUH 3LKSB 1ZOXA 1FFRA 1AC6A 4QHMB 4OFIA 3O9WD 4JKMA 4NNYB 2ED9A 1BD2A 4HBQA 4WI8A 1A7BA 1ONQB 2FNBA 2W60A 4LCUB 3SHSA 1T04A 2GY5A 2H2PC 2YA0A 1KIPB 3VFMB 1TZIB 1SY6L 3ZHKA 4M1DH 3ROOB 3O6FD 4OLVL 1LEIB 1XF5B 5IFJA 5C08E 3C5SA 2CH8A 5B21A 5IW3A 5JW5A 5HYJA 1DQDH 5EIIB 3D25A 43CAA 1NBZA 5DUMH 4PGDB 5E2TH 1NCBH 4ZODA 5MEOB 4E0RA 3U6RA 4HGMA 1KJ3H 3EOTH 2HT4D 1RVFL 3MNVB 1S78D 2HG5A 1F11A 5F9DC 3GMOA 1PW3A 1F3DJ 1EX0A 1S8DA 5CKAA 5MP6L 1A02N 3BSZH 1IL1B 4FQHB 5HHQB 1YMME 3RVTD 3PXJA 3FB5B 3D3VA 1OTUC 3QJFB 4R4ND 4YQXL 1XAUA 4XCFH 2RGSA 2O5XH 3BP6A 2YPLD 4QHKJ 3MRPB 5EZIL 1SY6A 1RK1A 2UVEA 4QHKI 3QNYB 4XNMA 3UYOD 5LXGH 1GL4B 3PWJB 2W0LA 2X9XA 3C60D 3FT3B 1AE6L 3PDOA 5DJ0B 4JFOA 4ODHH 5CILL 3V5DA 4NO0D 2DOCA 1RU9L 2P8MB 1IC7L 2OYPA 3QIBA 3MJ7B 4LOUD 1U8OB 1JPST 2FEDC 3AMLA 1OF2B 5I8KL 4LDEB 1JTPA 2FSEB 5HDBE 3OKEA 1LO3H 3GHEH 1MIMH 4LSQH 1D5MB 3KPOB 4PJ9C 1JI2A 3O3DA 3EOAA 1G84A 3RVXD 3CSYB 4NJ9L 3PQYD 4JZNB 3H6JA 4YDJB 1NFDB 2DB8A 2VAAB 4FA8A 3WMSA 4I18B 5DHVB 1YY9C 4NFBA 3HNTL 3RIFF 5GGQH 5DRZA 4HIIB 4GLRH 1EH9A 3KJ6H 2ZUTA 1E28A 3H3PH 1FHGA 2D7OA 1V3KA 3BUTA 4U1NA 2ZOLB 3VRIB 3QUXB 1UB5A 3DETD 2DIBA 4JB9H 4EUPB 4IJ3C 4XP4H 2NY5H 1WFUA 4I2XE 3HE7A 1YEIH 1Q9WB 5IVXF 1RJZB 1T1XA 5HGBB 1GC1L 2UYLA 5I1JL 5GGRA 2NX5D 4JPVL 1FL6B 3VWKA 5E00B 2XWJB 3V6FB 2GJZA 1CICC 5LCVL 1ETZA 3QIUB 1ZHKB 3FZUD 4HFWB 5CEYB 5C9JB 3I6LE 5I73C 2HLAA 2DRUA 3B9DA 3DSFH 4WI4A 2P48B 4X9FA 3SGDH 5C2BL 5MEPB 4M1CD 4TUOB 2C9AA 4O02L 4H26A 4L5FL 4QT5A 3DHMA 3S3SA 1FFPB 3PWUA 3P9LB 4K9EH 4KPHH 5C0CA 3RY5A 4G6JL 4U3HA 2I24N 4EXKA 3OAUH 1CD9B 3UBXA 2VLRB 3O4LD 3CFEA 4KI1A 1F4YL 3LSOB 5CEZL 2VQ1A 4ODUA 1S7UB 3ARWA 3IVKB 2QADC 1UACL 1T0PB 1XCTA 5FUCE 4N0CD 1DN0A 3J7HA 3PV6A 5ICYA 1MWAB 5FOBA 3IF1B 3QUYB 2IAMC 1TVBB 1UH3A 1PSKL 5KS9E 1NANH 3UTOA 3HHRB 1TZGH 3L3GA 4ELKB 3G5ZB 3EJJX 1XZ0A 2P45B 3IETB 4N0YH 3GMNA 4TPRH 3U7YH 5I66A 4PRBB 4JFEE 4Y16D 2EXYC 3VXSD 2Y06H 3KPSB 5FHAL 3CX5K 4HUXA 1LNUA 3L3KB 2A6IA 5K9OB 2P5WD 1DL7H 4LIQH 4K3JL 4PTUA 4S2SB 3H7BA 3VA2C 1OSPL 3BJ91 1ITBB 2BY1A 2FZ3A 1J87A 1LK2A 3FO1A 4KK5C 5I1GL 3L9RA 2KPNA 5D1QB 2AJZA 2XIDA 3MOBH 4L4TA 1UC6A 2DYPA 1KCRH 2F54D 4P3CH 3PQYE 5F7DB 2XN9B 4QHLB 2V17H 1NJ9B 1P4IH 3EOBB 1NAKL 3BUYA 3W9EB 3WHXB 3I02B 1T7ZA 4NKMB 1MUJB 3UC0H 4NIKB 4N0UB 4CW1A 5JO5A 1BAFH 3QWOB 3JZ7A 4UILH 3CFIC 3HAEA 3EW3B 3RY6A 3R06B 1A6UH 5F7UA 3NTCL 1DQQA 2Q86A 3TZVB 2SEBA 1INQB 3VXMD 2CLRB 3AREA 5EZLB 1BEYH 3FQTA 3ZE0F 3MRIA 5TGBB 1YNTA 5IOPB 1EEQA 3ILQC 3RVUD 4LGSB 5T1KA 2LAGB 2JJUA 4HAGA 2FX8H 1AFVL 4ZD3L 2LE9A 4PRPE 3IDMA 4I3SH 3MCG1 1JGDA 4X5WA 5F89A 5LGJB 4MSWA 3O3EA 1T4KA 2AVGA 5L7XL 1R3JB 4IOSD 1ZLWK 4AM0B 4KHXL 4QF1A 3MBEA 3QXVA 5D4QA 2F19L 2DICA 3W11D 1EAPA 2D4FA 3N9GL 4NNYA 1F6FB 2VLKD 2DWDB 3ARRA 5E9DB 1AXIB 3MRCB 4LCUA 5IJVA 4QOKB 3JVGA 1F90H 1JHTA 4XGZA 4KVNH 3LAFA 3U0WH 4PJFB 3C5ZB 4DN4H 5CFHA 1KGCD 1JGLH 4PJDA 3VU2A 4YBLC 1EHNA 4TRPL 3P0GB 4E5XB 2F58H 3QJHB 4NM4H 4MWFB 1UM4H 1DR9A 1M6OB 2JJWA 1RZGA 5DFWH 4QCIA 5CCKL 3WD5H 5AWNH 1DLHB 1ND0B 3GSOB 4GJTB 4PGDA 1KTKE 2X70B 4JDTL 1CDYA 5MEOA 5CIPH 4G7YL 3VXOA 3VXSE 1LK3L 2YK1H 3AS0A 3MNVA 4XCEB 4LHUD 3BKCL 4X9GA 3L5IA 3UROR 1WITA 5CD3A 5DMKB 2VABB 2P5WE 4N0FB 4M5ZL 1IGML 1JPSL 1JPTL 4HC1H 4WI3A 2Z31A 2HKHL 4FQHA 5HHQA 5MENB 2H8PB 3VGAB 4Z7NF 4JQIL 4JN2A 3QPQD 4DAGH 3QPXH 4XMPL 1BQUA 3MRPA 1T89A 3G6AB 4O4YL 4FQ2H 1WSST 4PRHB 2PYEE 4IIQC 1WJ3A 2F54E 2EC9U 3PWJA 2ITDA 4G8EB 1CQKA 4OM1H 1FBIL 2J12B 3FT3A 3ZKNC 3HPJB 4LKCB 4H5SA 2A1WH 4Y19B 3T2PA 5FDWA 5JDJA 1IGTA 1P69B 2YSSB 1U8OA 4LAQH 4YK4B 1OF2A 1J12A 1YQVH 4DUWA 2OI9C 4PJIB 2FSEA 1ZANL 5ESQB 3SE4C 3KPOA 1CDUA 5C0RH 3T0DA 3VXME 2JCCF 4GKZB 4HF5H 2R2HB 4JZNA 3LPWA 3T2NH 1NFDA 2DDQH 1MFCL 4I18A 2P7TB 5DHVA 1H3XA 1AGDB 4HIIA 3JWDC 1OTTD 1OGTB 2YUVA 4M43H 3RGVC 1KN4L 2CK0L 3VRIA 3EYVB 3L7EB 1VSCA 4KV5F 5K9KB 1T66D 4EUPA 1TZHA 4EVNB 3Q6FB 2PW2A 4L4VA 2BY3A 3C8DA 1CG9B 1F8TH 3ULVD 3N06B 3QHFL 2VXSH 1RJZA 3U9PH 1CI5A 1MHPL 2VDLL 1JMXA 5ACMA 4O5LH 2WUBL 5AD0A 1IAOA 2H2SD 1FL6A 1N2RB 5E4IA 1OP5K 4MJ5B 2XWJA 3V6FA 4L1DA 4R4BB 1KEGH 2GY7B 2OZ4H 4ZQKB 1UXWA 4PJGF 5F6HJ 3QIUA 2VLKE 4U0RC 2JLLA 2APBA 2G2RA 2OJEB 5CEYA 4PJ7E 1WWCA 2VL4A 1S9KC 4UIKL 4NZTH 5EU6A 3RUGF 3S37X 2GCYB 3GEWB 4QTIH 4G8GD 1DBMH 1KGCE 4HIEB 3KPRD 3O8XC 4TUOA 3V7MA 4C83B 3TPKA 4DTGH 4MB4A 3FONB 4R8WL 1S7QB 5IJKA 3P9LA 1KXQE 1ADQH 1IE5A 4XMKL 5E8PB 5MERA 1Q8MA 3JTSA 3OG4B 2BSRB 1UXSB 2HJKB 4WRLA 3SDXA 2DLEA 5GRJH 3A6OA 3IVKA 2Z35B 5D93B 4JE4B 1SEQH 5TPWL 3V4UH 3MLYH 1PD6A 2EDTA 3KXFE 3HC0B 3QUYA 1TVBA 3T77B 5JZ7C 1A7QL 1ZT4B 1N64L 3EFFA 3LKPA 4M8QB 2MPAL 1AY1H 4M48H 3Q1SH 1F3RB 2AEQL 5DI8B 5GS1A 3ZSSA 2W0FB 4PG9A 1MY5A 2EDYA 2X4NB 3GB7B 5D7JD 4Z5RA 1OHQA 1E4WH 4DW2H 5E4EC 2AJVH 4QNPE 5IMOA 3VG9C 5J89A 3S35H 1CFNA 4OF8A 2XQYK 4ZMAT 1KIQB 4PRIA 4BA8A 4BH7B 1I9IH 1DZBA 1U3HD 2B4CC 2FR4A 2GEEA 3W2DH 3MRLA 4NQSA 4ZO7A 5FV2A 2YZ1A 1T7VA 2E5EA 1FQ9C 4HT1L 5TDPB 5DJ8B 3ZHDA 1FGVL 2AJUL 3NZ8B 4L3CB 4N5EA 2NXZB 4XT1C 1PDKA 2IBZX 4QHLA 1NJ9A 3EOBA 3W9EA 4JM2A 1N0XL 1MUJA 5DMGD 3ARZA 4JZOB 4HULB 3S4SG 4B0MM 1S7TA 1X5FA 1HIMH 2GUOB 5DT1H 1J18A 3P9MA 2ATPA 5LBSH 3TYFB 1KPUB 4AL8L 1INQA 2CLRA 2UZIL 1LO2H 2ZPKL 3CDGB 3D0VB 1G0DA 4YZFF 4RAHA 5KBNC 4AK1A 3DX8A 5IESH 2FO1A 1Q0XH 3G6DL 2GIYA 3VFGH 4AH2B 2MOVA 1HXYB 3KR3H 5AEAA 4FNLL 1P4BH 2V2WB 4PJEE 4LPCA 3TYGH 2A83B 3BT2L 2BVQB 4R26H 5DHYA 1TMCB 4QTHB 4XNZC 1C5CH 1YY8A 4I77H 4L3AA 5ANME 1UB6A 1QRNA 3TA3A 3HRZB 4PJCF 5DFTA 5JOFB 1G1YA 4G8GE 1RFDL 5FFLA 1R3JA 1HZHH 5CGYD 4GW4A 3ROLB 4HKBA 1X6LA 5E2UL 3M8OH 5AYUL 2VDQL 2V5TA 4Y88A 4NQVB 1N6QL 4P23B 3VMPA 2VE6B 2YWYA 4IOIB 2WWMD 2V5RA 2UWEB 3HB3C 1I1AA 3MRCA 1CVSC 2V9TA 1J0HA 1UZ6F 4HH9A 4ZSOE 4WV1C 4ACPA 4MZ2A 1FIGL 1GZPB 3QNXB 4PJFA 3TP4A 4LSRH 5GIRB 2XA8H 1QUNA 4E5XA 4MS8A 2D7TL 4RMSA 3QJHA 3VDAA 5D7IA 5FYLD 4I5BB 4XNYH 4FMFA 1A0QH 3PABB 1M6OA 5DUML 1P6AB 3GSOA 1JGVH 2X70A 2EDXA 3U4BH 1I3VA 2H6PA 2R56L 1OD9A 2XY1A 5FYKL 5KG9B 4UINL 3B83A 1JF1A 1FPTH 4LPVA 2FEEL 4XCEA 3EJYD 5DMKA 3OL2A 4YH6A 5IHLB 2VABA 2AEWA 2GK0A 5F9JA 3PWLB 1RJCA 1I7RA 3GNMH 5E1HB 2WBJB 4JRXB 3WIHH 1J9CT 1L7TH 4HCRH 2NY1C 4XPHL 1MLBA 3BWUC 4DFHA 4LEXH 2HJLB 1N7MH 3P77B 4IRJB 5D5MF 2CIKA 3U2SA 1UENA 2Y1VA 4NT6B 4J3UA 4PG2C 4HS3B 3B9KB 2GITA 4Y19A 3LEXB 2YSSA 5CIPB 4LL9A 4PYHA 2Q3ZA 3T3PF 4AIZB 5FYJU 1D5XB 1UEYA 12E8L 5DGQA 3TBYA 3VI3F 4G6KH 5ESQA 1N3NB 4LSQL 4X6EA 4LKXB 2I26N 5I0DA 4DKFL 1XGPA 1TLKA 4MJ6B 4XPFH 4HXAH 5CWSA 1KCVH 2E3VA 1PYWB 1CGUA 2VR9A 2P7TA 4DJMA 1EBAA 3BPLB 1AGDA 1FYTA 2EYTA 2BSSB 4YBQC 3T1FB 2HTLC 2FEEI 3U36B 2E9BA 1AXTL 4QWWD 1P2CB 4YGVB 3EYVA 3HFMH 1GAFH 5KVFL 1GGUA 5A16B 2OMNA 2R0LL 3GFUA 1P4LB 4FQXB 1TVDA 4L9LA 1HDMB 4EVNA 5DSCB 1CG9A 3LQAC 1N8ZB 3LEYH 5D6DC 1TPXB 4WI2A 1VEPA 1NGYA 3HCVB 1FNSH 1OGAD 4P3DA 4PRNA 1U2HA 1YJDC 2NY6B 4HMEA 3K46A 4PRDB 1U58B 1HEZA 1NL0H 5K93A 1GOFA 2GCYA 2VH5H 4HIEA 4MA1B 4HWZA 1JN6B 1NUFA 3INUH 3LRHA 4C83A 2R29H 5FYLE 3VDBA 3FONA 4ZO9A 4PPTA 5JMRA 2RHEA 2A6DB 1EO7A 1BM3L 5E2WL 1CLYL 2DI8A 2VR5A 4FQJH 2P42B 3MLRH 3WKMH 3ZYOA 4G5ZH 4NCC1 3RVXC 2A73B 1JYVA 5GJSH 1QQDA 1NDMB 2BSRA 3DTXA 5D1ZC 3GJFA 4MNHB 3WE6A 3VW3H 1L0XA 1QSFB 4NC2B 3FAXA 3MV01 4CVZA 1QFUH 1SYSA 2XNAA 4XAWH 1MHEA 5E8EB 3SCMB 3HC0A 1F13A 1RHHB 3G5VB 4FFWD 3CMGA 1OB1B 3KHOA 2O5YL 2DKMA 4QRPD 1MCIA 3H9SB 1HYRC 4N0YL 3U7YL 3CSGA 5IIEB 2HVKA 5DI8A 4LRNH 5E56A 2W0FA 2Y06L 3QUZD 1AHWC 3PGCA 2X4NA 3IXTB 3F6LA 5E5MA 4R0LA 5JNYB 3DV4B 4OM0L 4LIQL 3QIWD 4FOMA 4U1GC 5JOPD 2E7LC 3MV7A 5IBUG 3AC0A 5BRZA 2VRAA 4J3OC 5B39A 4Z7QE 4MAYC 4BZ1L 4HAFA 4K71C 2CR3A 2W59A 1KCRL 4ALAH 3NZ8A 2PCPB 3UJIH 4PDCE 3VG0H 3CX2A 4ZO6A 3MJ6A 4JZOA 4DWHA 4XVUD 1TITA 1CLZH 1BAFL 4DOHE 4UILL 4M6NH 3BYYA 2XPGB 5F72S 1N59B 1L4IA 3K2UH 2BRRL 1DBAH 5FO7B 4GAYA 4WUUD 4ZXBD 1NSNH 3AS2A 5GQBA 1IQDB 1MCDA 1OVZA 2FIKB 4QGTA 2NXYB 4XB7A 4HZLB 2HT2D 4PY7A 4AH2A 1ZGLP 7FABL 3DXAA 2ENYA 2N7BA 1ZHBB 5HHMB 2BVQA 5C6TL 5AG9A 3WFBH 4QTHA 1U2CA 3MUZ1 1MAKA 2XQBL 4NCC2 4ZFFB 1W72H 4AG4H 1TTUA 3MACH 3NAAL 3ULUF 1QYGH 1RZ7L 2E6QA 2EYSB 4XVTH 1A1OA 3UJJL 3LIZH 2A9NH 1YN7B 4NQVA 5GGVH 4HD9A 5E1AA 4OZIF 4P23A 2FDBP 3EO0A 4LLQA 3EKCA 2UWEA 1HK6A 1VADB 1LO4L 1RUKH 2X4TB 2ERJB 3EYSH 4OJFL 1F58H 4YLQT 4DGVH 1GZPA 3QNXA 5JPMA 4TQEL 3TN0B 5DYOB 2VDRH 4PBXA 5EC2A 4FQQA 4V3DB 2M8XA 4XTRD 3X3FH 4RAVA 3PABA 5C0GB 3RDTD 1Z5LB 5AWNL 1G7MB 1U3ZA 5I15L 4QRPE 5HHXL 3REVA 3LD8C 4IOFC 2JJTA 1RUAH 5C08B 5KG9A 4UQ2B 3MRRA 3IDGA 1KBGH 5T5NF 4GRWF 1KCGC 1P84J 1X44A 1X5LA 3D1MC 4UNVA 1EJOH 3HE6D 1D6VL 4UOW1 3PWLA 5JOPE 2EKSA 4H1LA 2WBJA 1UWXK 4HIHB 4JRXA 4PP2B 1QVOB 4Z7OE 2I27N 2F9BT 1L9MA 2DN7A 4JO2H 1WZ1L 4JN1L 4FQ2L 3EJZC 4IRJA 5J3HD 1D5IL 4RGOL 3LS4L 1HHHB 3UMTA 4U6VH 1OP5H 4Z7UE 3TJHA 4OZGA 1YMMB 1A9BB 5FK9B 4Z78A 3T0AA 3KS0J 2COQA 5INDA 2PO6C 1VGKA 1UH4A 2A1WL 4UTAL 3VXUE 2X5PA 5TFSH 4FFYH 5CIPA 2PTTA 1YQVL 1TTGA 4AIZA 1A64A 4D0DB 3EYFB 3I6KB 1NGPL 2Z91B 5EU3B 1N3NA 3WEXB 4JR9H 5IVXB 4LKXA 1NBVH 4UNUA 4HF5L 4PFEA 3FQRA 4WUUE 4P2QD 1WBYB 1JI1A 2NTSP 4UZGA 1A3RH 4ISVA 3T2NL 1PYWA 1T21B 3I6GA 4H88H 1KTDB 1J1PH 3BP7B 2PNDA 5D7KD 1LHZA 5IQ9B 4V1DB 5AAMA 2BSSA 1C08A 3K4ZA 2YD7A 1H9VA 3EO9L 1SM3L 2IPUK 2P44B 1LEKB 1P2CA 3VGEA 5BCAA 1T7WA 1LP9B 4HLJA 5F97E 3RI5K 3ORJA 4HK0A 3MROB 4FXGA 4P2RD 3UTTB 3OAZH 1IGJA 1U8QB 1YUHA 4H8WH 3VRLE 4WU5B 1F8TL 4IMLB 1U3YA 1YEFH 1N8ZA 4F15C 2VXSL 5BMFH 3U9PL 5IEHB 1VERA 3RI5F 3I50H 1U8KB 4O5LL 3SDDA 4AEIL 3KWWA 4M6OH 4BUGA 1KJ2H 3NCCB 1XR9A 3V0VB 3MUGA 3QAZC 3UDWA 1XGQB 4GG8B 4Q74A 4YC2B 1VENA 1ZHLA 4YFEA 1K4CA 4PRDA 4JJ5B 2MWCA 5T3XE 1AIFB 2EEAA 4NHUB 4PJ5B 1NQBA 4AYFA 5DJZA 1JN6A 4XPGL 4L8BA 2E6PA 1HYSD 1LQSR 5E2VH 3VH8B 1T1ZA 1R3HB 3IYLW 4C4KO 4P3WA 4KQ3H 5KSUA 3QNZA 5L2KD 1WFTA 2WM0A 4NQCB 4R3SB 1EGJH 2D7PA 2A73A 2KL6A 1CFBA 2D7MA 4MXQA 1NDMA 4RISL 1BIIB 5GRJL 3ARFA 3BEVA 2Z8WC 3UYRH 2PYFA 1QSFA 1QPXA 3MLYL 5GZOD 1CBVL 3PIQB 5E8EA 3SCMA 4U49A 1RHHA 3G5VA 4XPTH 1UWGH 2NNAA 2YKLL 4YHLH 2A0LC 2N1KA 1BOYA 3EDJA 4CMHB 5D2LA 3H9SA 2DD8H 1NCDL 4PJHE 2HFGL 3ULVC 3L3JB 3GSUB 4I0PB 1MCWW 3C8KA 4KVCL 3WDHA 4MVBA 1BVKB 3QCVL 3PF2A 3DV4A 3S35L 1MFNA 3QI9D 1NCNA 4JFEB 4ELMF 1PLGH 2WUCH 1MFEL 1I9JH 3ESVF 3QZWA 4M93C 4L8SC 3CK0H 3HUJF 4YAQA 4H0GA 3ZMRA 4RGNC 1B2WL 5BOPA 4HS6A 3TBSA 3QIBC 4P2QE 3KLHD 4CVUA 2CJUH 1DQML 5HI5D 2VXUL 2W91A 1N4XL 3QFJA 5HTSA 3ZDXF 2R0KL 5D7KE 3TEUA 1EVTC 4QRRB 4R2GC 3SGEI 5EPMB 1MSPA 5C07D 4X9IA 3QDGE 4OZHB 3U82B 3NIGE 5TH2A 4XWGH 1T20B 2VLJB 2XPGA 1T22B 4JFFD 5GRVK 4OD1L 5LBSL 3NIFF 3JV6B 1U93B 5I8EB 4LCWB 5F7EH 4E9LA 5EOQL 4MJ2A 2EYRB 5EUOF 1GXEA 3CCHB 1J1OL 4Z8FH 1IQDA 5GRZA 2WW8A 4KJYB 2FX7H 2WINB 3PNWA 2FIKA 2OR9L 2IMMA 5CZXD 1JNNH 2EDBA 3KR3L 4JPWL 4KGLA 4NQEE 4HDIB 3DX7B 3ME0A 1ZHBA 1PY9A 4R26L 4XHJD 2DM2A 3KPNA 2DQDL 2O5ZL 3S8WA 1F42A 3PL6A 3WBDA 4Z76B 3GK8H 1CE1H 4Z7WE 4AY0A 4MQTB 4ZFFA 1I1FB 4HW6A 4WWKA 3I9GH 4P2OA 4NRZB 3X17A 5IK3B 4JKPL 5L2KE 5JQ6L 1X9QA 1FVDB 2PXYB 3O45B 4YHZL 4NOBA 4LSTL 3BGMB 4M5YH 3SGKA 3NBNA 5K59F 4Q9CA 4KHTH 5FB8B 2NY7L 1UCBH 2HRPH 3THMH 4UTBL 1YEEL 2ADJB 2DL9A 2LU7A 2WV3A 1OARH 4U1SB 2EXWD 4UBDD 1RV6X 3LRSB 4LSRL 4XB8A 3GI9H 1EPFA 3U7AA 5ILTH 4ZAKB 3NCYS 3SDCB 5GS0L 5SWQB 4Y4KD 1IEAB 4V2BA 2MMXA 3CFCL 1GC1C 4OT1H 1XGTB 1G7MA 1YEJL 1NCAL 1T0NA 5I9QB 1W72B 4O58L 5C86A 4C54A 1LD9B 5FGSA 4YDIH 5SWZB 4OIAA 5D9SB 3K4AA 4YFLI 4RFNC 3NFSL 3MLZL 4QLRA 2DLFH 1DLFH 4E41B 2AGJH 4F9LA 2R23B 4OF0A 4Q7DA 4HIHA 3E2HA 4NRYB 4HKZB 1H3GA 4KXZI 5KSAB 5HDBF 3F7QA 5EOTA 3CVHH 1ACYL 1VFAA 4PJXE 3K81A 3RJQB 1CR9L 3LKRB 4MHHG 1ERNA 3UJTL 1EBPA 3DRQB 3BXNB 5CGYC 2XRAL 2R15A 1CXEA 4YX2H 3GRWL 4JFPA 2VZ3A 1CDHA 1MQ8A 1MF2H 4D9RD 4YO0A 1Y18B 2PYEB 4G6ML 5DJ2B 1EFQA 3WIFB 1AGFB 4GFTB 3EYFA 4JFFE 1K8DB 4GRLD 1X5JA 1NC4B 4JAMB 1DVFD 2Z91A 4WHTA 4NP4H 1FFNA 5IVXA 4PB9H 4N90D 4YDKH 1HKFA 3MRGB 4EUPG 1WBYA 3OKNB 3ZT7A 2QTEA 3BH8B 2R39A 1MJ7H 1X5IA 5HDQH 5IVZA 4TUKL 3NFNA 3RY6C 3FT2B 1JHLL 4FTVB 5B3NA 4O2CB 5JHLH 3DNKA 4PJGB 5F1IB 1MHHB 3V4PH 3AREC 4K2UL 3IS0X 3PJSB 1RI8A 4O2EB 2ICEA 3EIFA 3QDAA 1IAMA 1LEKA 3S3JA 4Q9RL 2R1XA 1LP9A 3GRWA 1AGCA 3MROA 1RIVH 3UTTA 3QDMB 4OCSH 3DMMB 3D5OF 2DL2A 4FG6C 4WU5A 2CUMA 3EDDA 5CD5D 1SBSL 1TXKA 5F71A 5BVJB 1BFOB 1GHFH 5EU4B 5T3ZH 2CRMA 3QEUB 3RJDA 4JG0H 3LKQA 1KOAA 1XGQA 3EYOB 4JFQA 4L29A 1MJJB 3D6GA 1RJYB 4Z18A 3QG6B 1I8LA 1KJVB 4JJ5A 2DLIA 4G6FD 3FQXB 3BKJL 1NEUA 5GHWH 4U6HB 1I3GL 3RWCB 3RPIB 2CDGA 4PJ5A 4ODBD 3DARA 1MEXH 1MELA 3BKYH 4OAWA 5C3TA 3O2WL 2R29L 2CKBH 1QBAA 3MNZA 1MI5E 2ZG3A 1R3HA 1IZKA 1EA9C 3U1SH 1Q94A 2C5DC 3VI4F 3CMOH 3GM0A 3FO9A 2IG2H 4R90L 4FQJL 3MLRL 4XCNA 2OTPA 3GMRA 2R1WA 5ICZB 2DQUL 4DKEL 3ZZ1A 2RCSL 1JTOA 1RZIB 1KJ2B 4Y1AB 2D2OA 3V52L 2Q3AA 4JGMA 1QFUL 1B4RA 2BSED 3OKMA 4Q6YA 1NAMH 3HNVL 4M4PA 3QISA 1A6AB 4UAOC 3QXTA 4P46B 2WMPA 2NPLX 5DHXB 5J13B 2AEPL 5FF6B 2QHLA 3F58L 1A14H 2Z31C 3OX8B 3GSUA 3OPZL 1S9VA 2ARJA 3CLFL 3KXFB 4OV6F 2E9WA 3CX5J 2OCFD 1T89C 4X6CE 2XG5A 4D9RE 2GSIB 3O2VH 2LU4A 2MKWA 2VJXA 5IW1B 4KZDL 3I3BA 5GPRA 1PZ5B 3SKJL 3TO4B 1BQLH 5FEBA 4KTDL 4ORGB 4G43B 4H25A 5H94B 4N90E 2YPKB 3TC9A 4CU7A 4OB5H 3WXVL 4ALAL 4LVOB 1BQHB 1JF6A 4KZEH 1NGXA 4QRRA 4LDOB 1G7PB 2MQ0A 3DIFA 1ZE3C 3LKNA 4NUJB 3W5MA 4O2FB 4L8CB 4PJCB 1JJUA 1T22A 2JJVA 1FVEA 5I8EA 3O3AB 3DHJA 3X11B 4OZFH 2EYRA 3GZKA 5BS0B 3FHAA 3V5HB 4EBQL 2WINA 1KG0B 1C1EH 5H37G 1Z9OA 4GMSL 5CMAA 5EIVA 2ADFL 3RA7H 1YPZB 2V5YA 3OKLB 5F96L 5JHDA 1AKJA 1Q0YH 1CU4H 1INEL 3BAEL 4B7IA 5DA4A 1S9YB 2NZ9C 1P7QD 4X0KB 2JELH 4DUXA 4OCXH 1WCBA 1YA5A 5F9WC 3TJEL 3G5YB 3UX9B 2APVA 5C0IB 3H2WA 3OXSA 3EDKA 3OB0H 4OBRA 1BPVA 4NRZA 2BCKA 5IK3A 2AW2A 2DLGA 5IB3B 1WTGT 3VFRA 3QCTL 3WNKA 3HPLB 5FB8A 1RUKL 1VPOH 4XPAH 5E5UB 1N6UA 4XXDB 5IJKC 5A3IC 3RZCD 5L9DH 3DPBA 4U1SA 5HYJD 4D0BA 3TH2T 4QYOB 3V5KB 1NKRA 5DA0B 3SDCA 3MUY1 1QEWB 1MCKA 4OI7A 3MV8B 4MX7A 1IEAA 4ZS7L 8FABB 1CGVA 4LVHC 1J8HB 4PP1C 2IWGA 4J3TA 4RQQB 1JPFA 2IADB 2NW2A 3RWHA 3RBGA 3E0GA 3FQUB 5SWZA 5D9SA 1D6EB 2YPVL 3C6SB 3IFOA 4JHAL 4Y0GA 5CSGA 1KEML 1X5KA 4E41A 1RURH 3VD3A 4YXLH 1J1XH 5GS1C 3MLSH 3FFCA 1GGIH 5DD1H 3VFNB 5JIKA 2IQAB 3OJVC 4NRYA 4MNQB 1G7IA 2JCCA 4XWOD 1SJXA 5D71H 1NGWB 3LKRA 3DRQA 3BXNA 5D2NE 3UTSB 5L2JA 5FYJD 4NN6B 5GS3A 3DUSB 2BOCB 4XP5H 5DJ2A 1AR2A 1BZ9B 4ZOCA 5LWYL 2XFXA 4PJ9B 1AGFA 5F1SA 2BDNL 1JE6A 2A74A 3L5XH 4JM2C 2B0SH 3EYUL 2NY3D 5KVDL 1YEHH 3MRGA 5CP3H 5HHOD 2ZCKH 1FJ1A 4V3EB 5IT2H 1ZXQA 4H88L 2YWZA 1MAML 2YHGA 4AENA 3FT2A 4FTVA 4O2CA 2J8UE 4PJGA 5F1IA 4XI5D 3CVHB 2VDNH 5ADPH 5GRXG 4X9HA 2Y36L 3PJSA 4R4FH 3IXAA 4O2EA 3KYKH 3RUGA 2AK4E 3ARQA 4IJ3B 3GM8A 4PJ7F 2WANA 3AROA 5T3XH 4GO6B 5BJTB 3DMMA 3AAZA 3FQNA 1PAMA 5BMFL 3VWKD 3B4NA 2DQFB 2FL5B 4JY6B 2YMXH 4KRMB 1M7XA 5ALBH 3VGDA 3TT1L 5JORA 3DVNA 1RUPH 3TA3C 1BFOA 1CICB 1KTLB 1KJ2L 5D1XA 2OXGA 5IROA 3BISA 3GKWH 1JZ4A 5J3HC 3TT3L 5ICXB 5I73B 1N5AB 2WQRA 3HMWH 3SJVD 1KJVA 1LO5A 3FQXA 3RPIA 3IFNH 3BZ4B 4JRYD 3RL2B 3RTQD 5HYJE 2J6EL 1I1AC 1YNKL 4NQDA 4P5KB 1O7SA 2F53B 5C0CD 3T08A 2I5YH 5DS8B 5IGXL 3BI9X 3K3QA 1J11A 4PJAB 5CSZB 3D2UD 2GK2A 3HG1B 2X9WA 2B4CH 5AG8A 3ALXA 4MS8C 1C7SA 3TCLA 4JFYA 1NC2A 1JFQL 2QADB 3SKNA 2W65A 4RDQF 4KK8D 2Q8AH 3AUVA 3A67L 4Z0XB 4Y2DA 1KJ2A 4Y1AA 3T8XA 2VERN 3HLAB 3D3VE 5C0AD 4HWBH 4WHYH 2IAMB 3CXHK 5T1DL 5HPOA 4OFKA 4FQLH 4YR6A 1MREH 3T2QA 1A6AA 3JTTB 2CMRL 3D0LA 3P73A 3OTTA 4WWID 2EEDA 2OTUB 2YS4A 1JUFB 3D39A 1XMWA 3F7VA 5GXBB 1T1WB 2J6EA 5ACZB 3OX8A 3MSPA 1T80A 2CKBB 3GBML 5ELIA 1FNFA 1K4DA 1OP9A 2XZZA 3BH9A 4BFBD 5FYJE 4LQFL 4MB5A 1FO0L 5LAXB 1JMZA 3ZTNH 1KB5H 1C7TA 4QEGA 3CH1B 5DK0B 2XTJD 1XT5A 1Z9SA 4LPYA 3R8BB 4YHKH 5I30L