5B39A

Kir3dl1*015 in complex with hla-b*57:01
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Killer cell immunoglobulin-like receptor 3DL1 polymorphism defines distinct hierarchies of HLA class I recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b39A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5b39A01
3MJ9L 4R2GC 3BRFA 1D5IH 3GSUA 3GUTB 3T4YA 1ZGLP 4FXKB 1ZANH 3B6SB 3QNYB 2DQCH 1TVHB 5JW5B 3DVGB 2RHEA 4JQIH 2A77L 2YMXL 1FFRA 2UUDK 3P73B 1BVKA 1DQLL 3VD3A 5D72H 5BVJB 2QSVA 1X3DA 3HR6A 2A6KB 4LLQB 4PJCE 3IDYB 2PYFB 4GFTB 2VDPL 2DQHL 5IESH 5DDHB 1AP2B 3V5KA 4LRNL 1EO7A 1K5NA 3SEPA 5CZKA 1RJLA 3H9SA 4X6CE 1A0QH 3PWUA 3OX8B 4CMMA 1BFVH 1W72A 3PGCA 1LO3L 5HGDB 4IRJB 1KENH 1LE5A 2YKLL 5HYSB 1MAML 1UVQB 4PJ7A 4NZDA 3TVMC 3O3EB 3UC0H 5KANG 15C8H 4EIZC 1U8QB 3QZWB 3JV5A 3HAEA 2A83B 4N0CC 1EERB 5CIPB 4KUZL 4UILH 3MXWL 4JCLA 1BFOA 3FOMA 3WIIH 2BY0A 4R7NA 2D7PA 2VDQH 3SCMA 4J8RB 1T2JA 3QT2A 3QPQD 4LHUG 4YH6A 3BJLA 2EDXA 2YD1A 1BJ8A 5L2KB 1Z2KA 1NMCC 1YNLL 3I2CL 3QWQB 4BH7A 1WC7B 2F54A 3WXWL 4RGNC 4MXVF 5GPRA 5D1ZA 2K7QA 4LCCA 1L9MA 1MWAB 3EHBD 1RK0A 2Z0BA 1IJ9A 1INEL 4O2EB 1KTDA 5C09A 4EI5B 4K7PH 4JCMA 4MAYC 2PCPA 2VLME 1EZVY 4YE4H 5CEZD 3OHXB 5I17A 5DEGA 5DXWA 1PAMA 1VACB 3R0MA 2JB6B 3UP1A 4WI8A 1NFDF 1HSBB 2OR9L 1GGIL 5F9DC 2Q8BL 1DLHB 5D2NB 4PJXE 1GXEA 2HLAB 1V3MA 5DWUH 2IFFL 4YDLB 4TSBL 4JJ5B 2G75A 4KKAD 1NKRA 4JG1L 3G6JE 1Y6NR 2EYTB 1ZVHA 4LLWA 3QUZD 1EJ6A 4APQC 1X9QA 2Y5TB 3HG1B 1TETL 4OCWL 3V6OA 5EN2A 4QF1B 5FUCE 1ZKAA 4JRXE 3A6BL 2VZTA 1X7QB 5E8PA 3FO1B 3MA7A 5HHNB 1R3JB 5KAQF 5MP6L 3U0TA 3MO1A 3QDAA 4OCXL 2J8UB 1PKOA 3U1SH 3K2UL 2DQJH 1K8DB 2I9LA 3MLTA 3V4PH 4LDEB 5F21B 3IT8D 4AMKH 1IGFL 1FDLH 3FFDA 3FB8B 5DK2A 1BHGA 5EU4B 5I71C 4L4TB 1XZ0A 1T7YA 1FNLA 4M7ZB 3FN0H 2BRQA 3GNML 1TZHA 3VD5A 5FOBB 1CFTA 4K94L 5I8EB 3NIFF 1S78D 3RUGA 3D39D 3ZTJH 4JDVB 4F7TA 2EYSB 4L8SA 3CGTA 5D8JH 1G6RH 1QLEL 3C2AL 3CVHL 4U0RB 3PNWB 3H0TA 4QRRB 2R23B 3MV11 3VXQB 2ICWI 5ESAA 2HA1A 1INDH 4L3EE 1DBBL 3LN9A 4WCYL 3ULVD 1JWSB 3BKJH 3MV9A 1LDSA 4BKLB 4WWKB 4JFEE 1N7ML 3LN5A 5E56A 4WW1A 3VFNB 1H3PH 5F70A 4D0CB 3QO1B 5E6ID 5F7FA 5GGRA 5SWZA 1KEGL 2E7HA 5JXAH 1P4IL 2PKDA 3FQTA 2N7AA 2LAAA 1QO3A 2A6IB 3D85D 1GC1L 4G9DB 3ARBD 3ZKQD 1QLRB 5TF1L 4KTDH 2WQRA 1AHWC 2DI7A 2P5EE 5C3LD 4ZUSB 3V4VL 1NCDL 4QOKA 3JUYA 2VUOA 4JRYD 3TA3B 1S7TB 4Z0XB 3B5HA 4OZIB 4X6BB 1GSMA 4XNZC 3VI4F 1WAAE 3TO2A 5AZ2H 3OXSA 5FYJL 4Z7WA 4YDKH 4JM2D 3SDCC 2ESVE 3SKMB 1N6QL 1BX2A 4OF8A 4X6FB 5AWNL 4PBVC 4HS6B 2C7UB 1AE6H 1JI2A 3RVWD 4ZTOH 3JBG7 4F37K 4OLVL 3MLUL 4KK9C 2E27L 3Q1SL 3TPUA 1N26A 1S8DA 3EDKA 2LFGA 4IS6A 4HXBL 2DM4A 3HZYB 1JFMA 4LQFH 5EBWA 2OCFD 4MDIB 3JTCA 4X8JB 1FYTD 1S5HA 3S96B 1AC6A 1LMKA 3GMQA 3IXTB 2CRIA 2IPUG 4E41D 3DX8B 3DXAD 3QWOB 1XFPA 1I4FA 2E7LC 3HTLX 3UTOA 5HI5C 4DEPC 3KXFB 3KWWB 3OL2A 5CZXC 2D7TH 1VFBA 4ZMAT 4HWZB 1RQ5A 5FV2A 4FQHA 3G5YB 1KPVB 5I1LA 3KYMB 1ZHNA 4PTUA 4KRNA 3WIHA 4HT1H 3FOLA 4OV6F 2BFVH 1AGEA 3GSOB 1W0VB 2YPLB 1ZLVH 3K81A 3H9SE 3AB0B 5EUOA 2FSEA 3QHFH 4HZLB 5DS8A 1YZZA 5D7JC 2G5RA 4AIZA 1J8HB 5IEKB 3UAJC 5AAMA 4R90L 2W0PA 4JO3L 2I60H 1I3UA 1TJHH 3BE1H 4OGAD 1B0GA 3K2MC 4PJ7E 1JF1B 4UV7L 3CFCH 2FBJH 5KVDH 1MNUL 4PJ9D 3RVXD 4PGDA 4LSPH 1OGAD 3JWOL 1EO8H 3QWRD 2DLFH 3QFDA 3UJIL 2ZCKH 1JWMA 2GJ6B 1KB5L 4HCRA 4P2YA 4JGJA 4YO0A 2ZP0T 4ZSOB 1VDGA 4NSKB 1P84K 3SDYL 1D5ZB 1EX0A 1LNUB 4OIBA 1RZGA 4BQ8A 4RAUA 3KS0J 1JHTA 1MCQA 1CK0L 4WI7A 2NY4B 4JFQA 1T1YA 2A0LC 4MHHG 3QH3A 4E0RA 2CJUL 3OJMB 3B2UC 2F54E 3UROR 2WWKT 4HWEL 4FTVA 2VLRB 3ILPA 3NGBB 4DN4L 1OB1B 2OLDA 4JO1L 1CFNA 1NAML 3CX2A 3VWKB 8FABB 3VWJD 3QQ9C 5EBLA 4NNXA 5I18H 2H45A 5C09E 1J18A 1OAUL 3EJYC 2F53A 3LQAC 2CD0A 1I1AA 1KFAL 1MH5A 2VXUH 2A73A 3MNWA 5HVWA 2FJHA 4EVNB 5C0RH 4YHLH 5DHYB 4PLNC 4NQCA 3OF6D 4NM8L 5L8JB 3U9PL 4CN6A 1M05B 1CICC 2NTSP 4MA8H 4OZFH 3W9DA 1N5YH 4JG0H 2QQQA 1U91B 4QXTB 3GEWB 2EDDA 1G7LA 3JSSA 1LE9B 4OCLC 1RJYB 1ODAA 5MEQA 4OD3L 3VXMD 4WGVB 3V6OE 5IB4A 1HKLL 4HUVA 4GS7B 4OZHF 2AGJL 3VG9B 4A2LA 1RZ8A 3GMOB 4ZS6D 5IVZB 4WV1B 1KN4L 4XCEB 5JPNB 3FQRB 3CSGA 3MOAL 2CIIA 2FEDD 3FO9B 5D2LB 1MI5E 4XCFH 4LL9A 2NLJB 5T3XD 1H8SA 1PKQB 2HTLD 3O3UN 2H26B 2XXMB 3MGOB 5DUPH 1VPOL 3QIUB 2WLYA 3LVEA 4U1NA 1F4WL 3QIBB 1NBZA 3T0DA 1FZKB 3G5ZA 5JUEL 1T5XA 4K2UH 3MCKB 4XNQA 1TNMA 4UB0H 2IPKA 3VGGA 4P2RA 1I8KA 3LKRB 3UPAA 2QQNH 3VXUA 4FXLA 4U1KA 1TFHA 2EICA 1BZ9A 2FD6L 2AK4E 5LQBL 5T1LD 5LVEA 2LTQB 3RUGE 2VL5B 3P4NB 4NQDB 3STBA 5IIEA 2VRAA 4LOUD 4NRXA 4YUEL 3DRQA 1A6AB 2NZ9C 4ZS7H 2IANA 1XR9B 3KPLA 1G9ML 2VE6B 5LGHH 5JOEA 5SWQB 3EGSB 2XXCB 2X4PB 3ZT7A 2CLZA 4XMKH 4XPTL 3S3JA 1RU9H 4BUHA 7FABL 3ZT5A 3QPQC 1KG0A 1M6OB 4GRLA 4ZOEA 1MVUB 2CIKB 5SWZE 4K8RD 2Z31D 5J6GB 1FQ9C 1KJ2L 2G60L 4RX4D 3P77B 4YNYB 2FLBT 1MREL 1QFUH 3MRGA 1Z0MA 3WFCH 1LEIA 3QUYD 1CIDA 1G7QA 2OTPA 3KPOB 4U6YA 1FAIH 5I74C 2ZCHL 1A7PH 3NOIA 3GB7B 4NO0B 5DD6B 4JFHE 4YX2L 1NUGA 3EFFA 1OAYL 4R4ND 2ZJSH 5DMIL 2NW3B 1LEKA 5SWSD 3H9ZA 4ZXBA 4MSWB 3AM8C 5DC4B 5K9KA 1NCCH 1F3DJ 3X11B 1N2RA 3KJ4C 4Q2ZA 2GY7B 3CLFL 4LCWD 4IEFB 1YMMB 1PBYA 5DT1H 3M1BA 2E7CA 1A9EB 5DRNB 4E42A 4KKAC 1YN7B 4NDMB 1YQVH 1WEJL 1HYRC 4U1MA 2P8PA 3QUZC 4XPHL 4OZGB 4GW4A 1BVLA 3L6FB 1QACA 3QDMB 3V0VB 1YC8A 4M4RA 1QSEA 3DI3B 4RISL 3VXSA 4JKPL 4I1NB 2CMRL 2YK1L 3MOQA 5K9OA 1QUNA 1SJEA 4JPKL 3F8UB 2QQLH 3KYAA 3MRJA 4NGHH 1YYML 4L8BB 4I3RL 1WFTA 2FJFA 5GGRY 5C0CA 2PYEE 3DV6B 1HH9B 3H9HB 4N8VB 4PR5B 2P5WD 3RVTD 1AQDA 4KQ4H 3FONA 3TNMB 4G8FA 2ZUXA 2Y36H 4G43B 1F45A 4S10A 1IFHL 3S36H 5B38G 4LHUA 3BWAA 5F1IA 4XBPB 2EZ0D 5BQ7B 4L4VE 1U41A 1S78C 4PGEA 1Q9LB 3ARGA 3RTQB 3UTQA 2R2BA 5DQJA 2AW2A 3C08L 4RMQA 5GSVA 3RNQB 1WBYA 5IJKA 1U8NA 2WBJA 2WBKA 3PWPD 2EYRB 3QXVA 4H26B 1T4KB 3IJSA 4YGVB 3ULVC 3Q6GH 1A3RL 5B8CB 2YD6A 3C6LA 1CXLA 4PJ5A 1RK1A 3SCMC 1J05B 1KLUB 5E6IC 3PF2A 3U4AA 1UWEL 4ALAH 4UI2A 3BQUA 3IAQA 1NJ9A 5IK3B 1KXQE 5J1TC 3BW9A 3FJTA 3T8XB 5D5MA 1GAFL 3ARBC 5A2KH 2YPKB 5BO1L 4HHAB 4HJJH 3PHQB 3VFGL 4XP4H 2EDQA 5HHMD 1BM3L 2X4UB 4HKZB 5ELIA 3SOBL 1H15A 5IHBA 3GKZA 2QQKL 1HSAA 1I1RA 1ORQA 1EFXD 2VSDA 4AK1A 1E4XH 1L6ZA 2NMSA 5FO8B 5KW9L 5GGSB 4BELD 2NXZB 3EJJX 1TZIB 4JM2C 3SQOH 3E2HC 5GSRB 4MB4A 2C26A 5TE6L 4ZOBA 2VKXA 2XTJD 1MCWM 5GS1B 3RVWC 2P7TA 4HFUL 5HYJB 3PV6B 2VOTA 3OKNA 5TE4H 1HINH 1OTSC 4NQCE 1J1OL 4XC3L 2K1MA 5EZIL 1H3VA 1HQRB 1Q9KA 2NY7H 2B0SL 2CRMA 2HLFC 1BBJB 3FT3B 2ZUVA 1QFWL 2VXSH 3ULUE 1OAZH 4S2SB 1P4BH 4GG6F 3U0PA 3S37L 2ZPKL 4NN5B 4S1QL 3KDMA 3VDBA 1A4JB 1Q38A 4PY8I 4WJ5B 1DBMH 3BVNA 4DK6A 4HBQA 5I1IL 1M71B 3WUWG 1HQ4A 2AEQH 5BV7B 1RY7B 3NIGE 1KYOK 3UBXI 3JTSB 5F9JA 1A6ZA 1DANU 4MA3B 3RY6A 4AEIH 4UU9B 4XPAL 3QBTB 1U8IA 5IFHH 1IEBB 4BSWA 2QR0A 3K7UA 4XBGB 4Q9QH 1IZJA 1VEOA 3HE6B 5IB5A 4DAGH 4LSVL 1ZTXH 3QUMB 3GMPB 2JTDA 3DRTA 4P2RE 1A7QH 3KPQB 5ADPL 2QADD 3VXUE 4PYHA 4FQCL 4OGAC 4M43L 5M94B 4PJ9C 3RVXC 3EFDL 3WJJA 1MOEA 5INDA 1MLBA 1GL4B 4NKDA 1BD2A 4UQ2B 4OZHB 2EDEA 4KKNA 4HLZG 4JE4B 2O93L 1HHIA 3WNMA 3TYGH 2PXYD 2C5DC 1H8OA 3RAJL 3U7YL 1YYLL 3J8F7 3QJFA 1BZ7B 2ORBH 1I1YA 3DBXA 1FP5A 3PWNA 4F7EB 4C4KO 1P7KA 4D9QE 4PJGB 2Q86B 1VKXB 5IF0B 3DX9A 3MODH 3IU3B 4Q9BA 3DO7A 3VWJC 3RNKB 4RRPG 4D94A 3G08A 3IDMB 4P9HC 1MCEA 1HILB 2B1AH 1SMAA 4EIGB 4OGYH 3NZ8A 4PRIB 2NXYB 3WE6A 4HLZH 3FT2A 3DGCR 1NGXA 1D9KD 5ALBL 2ZKHH 5ECJE 3CDGB 3SDXA 4OKVA 4R2GB 1IKNC 1LP9A 4MYWB 4JZJC 4IDJH 5IW6A 4ZFFB 3QIWB 5I1CL 1T04B 1VFOA 1S7QB 2VXTL 2X4QB 3OBAA 1DSFL 4ISVA 4I3SH 2EE2A 4MQ7B 2X44D 3MNVB 1QSEE 2H32A 3V6FA 4X6EB 1ZLUH 5HD8C 1EIBA 1OARH 4KAQH 4ZS6C 3VXSE 4AG4H 3RX8A 4L29A 2YD4A 3GHBL 4ZAKA 1MIEL 5DHXB 3QEQA 2I5YH 2HKHH 5C0CE 3QYCA 3C5SB 4NO5B 5TF0A 1Q8MA 3LZFH 1FJ1B 5BW7A 4LFHD 3FB5A 1IGTB 4RBPH 1K8IB 4OFVA 1AC0A 1MFBH 3OZ9H 3QUKB 4M9OA 4PJFE 4Y7MA 4G8GE 4IIQA 1R24A 3W0WE 2GSGA 4YHML 2OP4H 4N9GA 4P2OB 2ED7A 4HUXB 5I8OH 1PEWA 5DF0A 1T1XA 4ELMF 3V4UL 3QG6B 1UQSB 1HN1A 1U8MB 2B1HL 3ARDD 4YHNB 1QFWI 4LOUC 1UXWA 1XEDA 3F7YB 3CFDB 1MCIA 2NX5A 6FABH 2ADJA 3IDJA 4R96B 4NT6A 1OCWL 4PJ5E 1M7DB 2C1OB 1SEQH 1LEGA 4AENA 3LHPL 5TH2B 4J12A 4K8RC 1XF5B 2DBLH 4L9LA 4M7JL 5IMKA 2VLKE 3PDDA 4YFDB 2AXHA 3MUGB 2XA8L 3C60D 1FE8L 4UDTA 3EDJA 2L7JA 4QGTA 3MA9H 2HH0H 4OD2B 3QUYC 4QRQB 4XWGL 1QQDA 4QXWA 4MAYB 4KRLB 4X8XA 1RUKL 5ID1A 2NTFB 3TIEB 5DJAA 1T1WA 3BHBB 1D6EB 5IVXF 2ARJB 5JA8B 1FL5B 3TZVD 5GZND 5AZEL 4DFHA 4XZUA 2AERT 2JCCB 4XWOD 2ITDB 1MFAH 4R4NC 4MVBA 4MQSB 1IC4L 1LD9B 5D9SA 1JUFA 3BXNA 3VD4A 3GMLA 4G6MH 1MFEH 4EEEA 4NJAL 5E2TH 2R2EA 3KPMA 3MJ8A 1PEZA 2X05A 4WUUA 3QSKB 1DVFB 1K6QH 4YHPA 3SKNB 3OGOE 2OI9B 1MEXL 5GRUL 1MHHB 3MQIA 3O4LB 3B83A 3MRRA 4X7EC 4FQIH 5F71A 5JQ6L 2R1XA 4P4KB 1HEZB 1S7UB 3T3ME 2IG2H 1WZKA 3IDIB 1NEUA 3PABB 3PV7A 4P5KB 4NWTH 4ZTPL 4PGBB 3SDDD 1D5XA 3MLZH 4QHMB 5D96B 5C0JA 3LQAL 5TDPA 4JN1H 1KEMH 3KPNA 3E6HB 2XZCH 4JPWL 2D7MA 2V7NA 4HK3N 5F96L 4ODWB 1C5CL 3B5TA 4LMQI 3RVTC 1MJ8L 1JJUA 4MA1C 4DFIA 1OWWA 1YMHB 2CUMA 3UJJH 3DV4B 5ICZB 3P4OB 2VXQL 2FZ3A 5KSAD 1X5ZA 3U48A 3W9EB 5EPMB 5C0NC 1UCTA 1GGUA 1KJ3H 3MRPB 3O0RL 2FR4A 2C1PA 1EK3A 3VXTA 4TNWF 1R3KA 2HG5A 1MJUH 3MFGB 3EOAB 1KNOA 4AZ8A 4L8DB 4EOWH 1WFNA 1YPZF 3CFEB 3RDTD 5JIKA 1AKJA 3BKYL 1BEYH 1Q9OB 4H88L 3DMMD 4XP1H 3UZVB 5IB1A 5JIHA 3DURB 3CMOH 4JFOB 2VZSA 5FIEA 2BNQA 3EZ8A 5DD3H 5MEOB 3UTTB 1WTLA 3RY4A 1GRWA 3CD4A 1BD2E 3EO0B 2XZZA 3LQZB 4YZFF 2G2RB 4P5MB 4CL7A 4J7RA 2IWGA 4JANA 5F1OB 1WWWX 3VGDA 4ELKA 4RIRB 2HKFL 5IHUH 3CU7A 4QRTB 4K55A 3CU1A 1RZKC 4FQXD 3LB6D 4P46A 1NUNB 3U46A 1NUFA 4YXLL 4QTIH 1Z5LA 5FM5O 2NR6D 1NCUA 4L5FH 5I1JH 1B0RB 2FL5A 2YS4A 4I0CC 3GSNA 1CGXA 4G8EA 5HYSG 1WF5A 5GGQL 2R0KH 1JV5A 4XNZB 5H37G 3R06B 1UM5H 1K4CB 1HIML 3O45B 1A14L 3X3FL 1DL7H 3EYOA 3RIAF 1JNHA 5IGXL 1LDPH 4KRPB 1WFOA 3MROB 3UYRL 1T80A 3WIFB 1MHPH 2FBOJ 4FOMA 1QSFA 3QZWG 2O5YL 4KZDL 1F6AA 1U95A 1ZHBA 5IVNA 4G6FD 4KK6D 4QEGA 4ZNEA 5I8CA 5A3ID 5TQ0L 1RUAL 1S3KL 4MXWL 4XAWH 4MXVE 4WIQA 4OCMC 3QFJB 3ZKMD 5EZJA 3BMWA 1A3QA 5FA4A 4N0UA 3DTXA 3OAYH 2KKQA 4EN3A 4NQUA 5HSFA 3TEUA 4G6KH 3RWIB 2FGWH 1WWCA 5B38A 1BJMA 3BYYA 3LH2H 2VLMD 1NFDE 4MNHA 5H37H 1NDMA 2WIIB 1YEFH 4TN9A 2XI9A 5EU3A 2AS5M 4KU1A 1NGZA 1KBGL 5ESQB 1TJIL 2E8ZA 2BMKB 4F7PA 2AV7B 4QY8A 1DN2A 4Y4KD 1LK2A 3QEQE 1XR8A 4RWYH 3PP4H 1UENA 4DZ8B 2VN7A 2XY2A 5CHNB 3SKJH 3FQWA 3BWUC 1YEJH 5GS0H 4ZPTA 1FFPB 4Y1AE 1NC4D 4LDOB 3AC0A 2NNAB 3JTTA 2AEWA 5HGBA 4V2CB 1X5LA 5IW1B 5KSBA 5LXGL 1WJ3A 4JRXD 1FV1A 4V1DB 5IVOA 5KJRL 2HFFB 3MSPA 3VRJB 4MB5A 4PRPB 43C9B 3EZJB 4N5ED 3CUPA 1OW0C 1CLCA 2AJZA 3IJHA 3LAFA 3LKQA 5HHPB 4JQVC 1CXEA 2A6JB 1M4KA 2JIXB 2WBJC 3L3OA 4YHZH 2VH5H 3F6LA 3TBVB 5ITBL 4M6NL 4TOYL 3PQYD 5DJZB 1XGUA 4G42A 3C6LC 1T21A 3VE0A 2PXYC 3NIFE 4HJGB 5T1KA 2JJTA 5DHVH 2HN7A 1PW3A 3BQUC 4X9IA 1AI1L 5F93C 4UTAL 2FX9L 4X9GA 1T22A 1TZGH 2XZQL 4PJHA 4DVBA 4PLKC 3ETBF 4YFLF 4BQ6A 4WVRA 5HHOA 4KI5D 1GIGH 2CUIA 1BBDH 3TBSA 4OUOA 3DSFL 1QRNA 3OGCB 4E5XA 1HWHB 4LLDA 2G5BA 2FEEL 3PL6B 2AEPL 4N0FB 4QRUB 5F72S 5C08A 5T1MB 1X4XA 3QA3A 4LLYA 3ULVL 2EE3A 3VD9A 2AJUL 2WK2A 4M48L 3VFRA 5ISZD 1UKTA 4YDIH 1GGBH 1X4ZA 2R4SL 4K07A 3S88H 2OR8A 1BLNB 4U0QB 3ET9F 4YHYC 3ES6B 3L3KA 4ZQKB 3RWDB 4KVCL 3GHEL 5F3HA 3FN3A 3V5DB 1BF2A 4WUUE 3ZKND 3BEVA 2ZUUA 5FYJU 2AJXH 3VI4E 4M1GL 2F5BH 4LVHC 3QJHA 4JFPA 1TQBB 1PD6A 3D2UA 1Q0YH 2Q8AH 3PDOB 1P5UA 3QXDB 3H7BA 2J88L 4KHXL 4HK3J 4G5ZL 4WU7B 1JGEA 4XC1L 3WJLA 5ENWB 3P2TA 4LGSB 4WEUD 5DHVB 1FZMA 4IRZH 2X4OB 3GIZH 2XN9A 2OX5A 1I7RB 5H2BA 1J5OH 4NZRH 1U3HB 5EBMA 1OPGH 1L7IL 2AQ3A 3S36X 1EPFA 1Q1JL 5DR5H 1CLOH 1P7QB 4R0LC 1YY9D 2W65A 3NCMA 4JR9H 3C09C 3VFTB 2V17L 5J57B 1JP5A 3QAZB 2Z8VC 4R97C 3MJ9H 5DMJB 1KIQA 3B3IA 4RFOL 1KJVB 3L5WB 1INQB 2HFEB 2R4RL 3GJFA 3HE7D 2FO4A 4HKJA 2Z8RA 3QULB 3JZ7A 1AO7B 2HMID 5D1XA 2A77H 3RGVD 2YMXH 5JXED 4K7FA 1IAKA 1N8ZB 4TYUA 2G9HA 4FG6D 1DQLH 5FKPA 4HUWA 4N8PA 2RR3A 1DQJA 2BNQE 4RRPA 3WNOA 5B3JF 3L95B 1P84J 3WN5B 2VDPH 1S5IH 2DQHH 4FMKA 4OLUH 5KVMC 1ND0A 5DJYB 3S9DB 2P24A 1X6LA 4LKXB 1DUYA 3GO1H 4M62L 2ZUWA 1QR1B 3LDBC 3AU1B 5CJ5A 1OF2A 1LO3H 1U8HA 2V2WA 3O3DB 3BPCA 2YKLH 1YNTA 4X7SL 4YDVB 4ONHA 3C60C 5I74B 3MRLB 1MAMH 4EDXB 5CILH 3U79A 2IFGA 3DUUA 2BVPA 3B5GA 3TCLB 3GSWB 3O8XA 3IDNB 3LN4A 1QSZA 5GZNC 3V5HA 2OTWB 2FX8H 1E6JL 5DJDA 4KUZH 4XWOC 3MXWH 1UCBH 5I0ZA 5F6IC 3EYUL 3IKCA 2D7QA 4G7YL 3THML 2YD9A 4QWWC 3BGMB 5C07D 4Q6IA 5GS3A 1NCBL 4I5BB 4ZNEE 5F9OL 5DJCA 1XGPB 2B7DT 3LSOB 4YHOH 3OKMB 5FGBA 1YNLH 1KIPA 3JWDC 3D3VD 3IFOB 1C12A 1G9NC 4YC2C 3WXWH 1MCLA 3KR3L 4A6YL 1MCHA 4S1DD 3SY0A 5BVPL 1TTFA 2DI9A 5DYOA 3MUHL 2PF6A 3L7EB 4YAQB 2FHFA 5E7FA 3OAUL 1E28A 4NRYA 2WAHA 1KLGB 5HXMA 4P9HL 4Y4FD 5HGAA 5CWSA 4ZFOB 1SVCP 5BS0D 2OR9H 1GGIH 2Q8BH 2FEEI 1J9CT 5E24E 1A7BA 1PY9A 4MCZB 5ALCL 5DSCB 1S7VB 4PP8C 5DQDL 3TNNB 2IFFH 3W39B 4YJZL 4ZDHB 4TSBH 4GG6A 3CLEL 1GZPB 4XI5D 4JG1H 1CD1A 5KSAC 4M61B 3D39B 4W6YB 3ARPA 1SYSB 5EOTB 1B6DA 2ED8A 1A2YA 1G7PB 3RDTC 3A6BH 3PP3K 2VLLB 5DC9B 43CAA 4U7KA 3DIFA 4QRPE 3WFBH 2VZVA 3DMMC 1MI5D 3N1QC 4OGXL 5MP6H 4NUGL 4OCXH 4X4YA 3RZCB 3K2UH 1VGKB 3RBSA 3WEXA 5IQ7L 2Y7QB 4EBQL 3HR5A 4IDLA 1KCLA 4G6AD 1IGFH 1KF9B 3BZEB 1YN6B 2FH6A 3EOYG 1DEEB 5J1AA 4TUOB 5FDWA 4FQXC 3LB6C 4TTDD 3GNMH 2AK4D 1YDPB 2DWDA 2NR6C 5DRWA 3Q5TA 4LLMA 5F44A 2WANA 3TV3H 4K94H 5LCVH 4UBDD 5IR1A 4NIKB 4W81A 3HZMA 5J8OA 3O9WD 3C2AH 1T3FB 3CVHH 3DX7B 5C9JA 3BI9X 1QRNE 4JM2B 4IMKA 5A2FA 4JY4B 4HKXB 4NYLB 3ZDZF 1DBBH 4KK6C 1P5VA 3DGGB 1N7MH 2Z4QA 4JFDA 5A3IC 3QDGB 1A47A 1I8LA 4OFIA 2ZOLA 3T0WA 4QRSA 1NFKA 1KEGH 2XA3A 5IQ9B 1P4IH 1KPRB 3FQXA 4NN7B 3HC3L 4XAKD 4F33A 2NPLX 4O9HL 5TF1H 3V6ZA 1UM4L 5FYKU 4NP4L 3V4VH 1NCDH 2AAVA 3MRHB 4RQQA 3BP7A 2OK0H 3X13A 3BN3B 3ZKXC 3ZE1E 3TJHD 1EXUA 1FO0L 1TPXC 4N1HB 1J0YA 4GSDL 1FSKC 3GUTA 3HUJB 5FYJH 4FXKA 4Y4KC 1TVHA 5JW5A 3MLYL 2UWEB 4NQSB 1N6QH 1SEBB 3EO9L 4DOHB 2XN9E 3P40A 3OR7A 2J7LA 2FX7H 2X5PA 1CF8H 5GISL 4OLVH 3MLUH 2PYFA 3GK8L 4UDUB 3Q1SH 5DDHA 5GHWL 3IFLL 5FECB 4M93B 3CFKA 4HXBH 5FUCC 1EGJL 3EO1B 3AFLA 4XH2B 3OX8A 1OGAB 5C71A 5HGDA 4IRJA 2X4RB 5EORL 4CNIA 5HYSA 1JCKA 4N5EC 3K8LA 4Y5XC 1UVQA 2PYED 4MZ3A 2ERJB 4CDHA 1G7IB 1IGJB 4HQQL 1H5BC 2QHRL 3QRFM 1U8QA 3QZWA 4HGWB 4NN6B 4RMVA 2V5TA 2VWEC 4HWUA 3AY4C 4D2NA 5CIPA 3F58L 1KCKA 4IRSA 4JPVL 4V3DB 4ELMA 2MJWA 1UWXH 2VLJE 3AGVA 3VFUB 1BVZA 4L4VD 1LO4H 2BCKB 4UOW1 3VXOB 3NTCH 4CKVX 3SGJC 4P46C 4J8RA 1XF2B 2KUTA 1XIWA 2BSRB 5D7LD 3C5ZD 3WFHA 3GI8L 4NOBA 2Z8SA 5L2KA 3SO5A 1DP0A 4OUUB 4JO3H 1YEDB 1NLDH 3AMLA 1U42A 3BSZL 1A9BA 4JQXA 4KI5C 4UV7H 1RD6A 1MNUH 1CTNA 3ZDXE 2NY0D 2E6PA 1K3IA 3U6RB 4ONFL 2D31B 2YC1B 3JWOH 1JNJA 5CBAB 3BD5A 3UJIH 1KB5H 4Y4HA 3EOBB 1CE6A 3NCCB 4O2EA 5D7KE 5E94B 2H2PD 4IHOB 1UT9A 2EEDA 3MR9A 2AJ3A 1JGVL 4G8IB 4G80B 4NFDA 3P3YA 4JY6A 5DJ8B 5E1AB 3BJ91 3O11B 2YN5A 2VYRE 4Y2DA 5JHDA 5D2NA 1CK0H 3L7FA 5I16B 5IVXA 5C0FB 2BVYA 2YEZB 1IAOB 3ZKNC 3VXMB 2CJUH 3E3QE 4HWEH 3CX5K 4DN4H 2AKRB 2EYTA 1LO5A 5M95B 4JO1H 3QQ3B 3UTZB 1NAMH 3GSQB 2QSQA 2D0HA 3HG1A 2Y5TA 2W92A 3DECA 5DVNA 5DZLA 1OAUH 3WS6C 4U2ZA 1I1AD 3BPLC 1P9MC 2O5XL 3X14B 4D9RD 1Q94A 2DIBA 1X7QA 1MLCA 4P5TD 1KYOJ 4L3AA 3FFCB 5IMMA 4ZPVA 1NGPL 1K8DA 5BZWB 1HHHB 4H8WC 4NQEB 3L3IB 2BSTB 4GRWF 3BH8A 3EYVA 2QTEA 4X9BA 4NM8H 3U9PH 1PY4A 4LVNB 3F6IA 1DDHB 4GG6E 1TTUA 2O61B 4WW2F 2VIRB 3MLVL 1YY9C 3FB8A 4B0MM 2OBGA 4L4TA 3RWJA 1EO5A 3FRPG 2X9XA 1A3LL 1MAKA 4OLZL 4Y5VC 5FOBA 3SBWA 4ETQB 3HE7C 3EOTL 1BAFL 2EE9A 3DX6B 1CDUA 2HMIC 2MKLC 3BP4A 1KN4H 3QQ4B 2EYSA 5JXEC 4HPYL 3MOAH 4FG6C 5CLWA 4QRRA 2YOCA 4Z7VA 2R23A 5J11B 4U7MA 4NKIL 2Z31B 1VPOH 1F4WH 4ESKA 1FRGL 4RAVA 1JWSA 2FCBA 4LP4A 5JUEH 3SE4A 1JZ5A 2JJTC 1H8NA 1CCZA 3QUYB 2VDML 3RQ3A 4Y8DC 3CFBB 4D0CA 3TN0D 4O00A 3QO1A 3F7RA 4OIIL 2DOCA 2FD6H 3VI3F 5GRZA 4H5SB 2LQRA 2A6IA 1ZLWH 2ATKA 2IC2A 1XF4A 2ICWA 1QLRA 5I19H 3VGHA 5SWSB 3KPSA 4YUEH 3UBXG 1XF3B 4OD1L 3G6AB 1X5XA 3QDHA 4D9LL 4C55A 4LCWB 3TA3A 1G9MH 1S7TA 3JV6B 1CFQA 2GT9B 3LS4L 4P3DA 4EI5D 4I0PD 1F11B 4X6BA 5GGVL 2E8YA 4XPTH 1S9YB 1A7NL 3MRDB 5F7KC 4JFDE 3CIQA 4PRHA 1E4KA 1AJ7L 4QO1A 2OL3H 5EG6C 3QCVL 1KJ2H 5TGBB 5IW3A 5CEYA 1MREH 4S1DC 1CT8B 2AEIT 1Z0NA 4BH8B 4M8QB 1ERNA 2R2HB 4HF5L 5F1NB 1RZFL 1NDGB 2ZCHH 5E8DH 4D8PB 5TPWH 3K3QA 4PJDB 4MDIA 5E1HB 3OB0H 4PJAB 4WI9A 1OAYH 4FZEL 4X8JA 4Y4FC 4ZNCD 5DMIH 3S96A 2CDGB 2A74A 4R8WL 4MA1B 4UNTA 3ZHLA 5FYKH 3RA7L 3T77A 3PWLB 3DX8A 3QWOA 3G04B 3CLFH 2BSSA 3P4LA 1RUPL 4U1HB 1L7TL 3OJVC 3KXFA 3KWWA 3GGWB 4TUKH 2JK5B 4DCQB 5C8JA 1BZQK 1JPFB 1U8OB 5B39G 4XXCA 1KPVA 3TH3T 2X9WA 3MPCA 3ILQC 3MRCA 4FFWD 4XPHH 3ROLB 2CK2A 3ALWA 1W0VA 4PJEF 3F12B 2B4CC 1F00I 4RFEB 4RISH 2PW1B 2IAMD 5IEKA 2AABL 1F6LL 2CMRH 2YK1H 4NRZB 1IBGH 4OLYL 3I75B 4WFFD 4JPKH 3SGKA 1T83C 1YYMH 4I3RH 3FMGL 4FS0A 4WO4A 4PJBB 4HBCH 4G6AC 1JMXA 3I6LE 3IDXH 5F7MC 5F7LB 4UOW0 4G8GD 3W0WD 4LF3B 3F7QA 2MPAL 4ELME 1R3LB 4NSKA 4ZFZB 3P30H 2CQVA 4U6HB 3LKPB 1IFHH 1D5ZA 4HH8A 1QFOA 3GFUA 4WWKD 1OP3K 2BNRA 2CKBL 5JMRA 5HHMB 4LSQH 2YRZA 1IAII 1T7XA 2ADFL 5FKAA 4UBDC 3NPSC 2DBJA 3TO4A 3TIDB 3N50A 5E2WL 3OSKA 2NY3D 3O9WC 5HDBF 4XNXL 1N4XL 3PWVA 3C08H 2Q7YB 4PG2A 2IADB 5IM7B 5BXFA 4JHWL 4KY1L 4NO2B 1OB1A 3NMEA 3IAPA 1B0WA 1CDIA 3VWKA 3T65A 2XTJB 3VCLB 2HP4A 4R4FL 2QSTA 4HW6A 1A3RH 3VFWB 2EIBA 4HIJB 1A7OL 5KANI 3W2DL 2BRRL 4NBZB 3UYPA 4KJWD 1Y6KR 4LVEA 4PREB 3DVNB 3SE3C 1CE1L 2VLKD 5KOMC 1UWEH 1EHXA 3UX9B 1UA6L 3LMJL 5JHDE 1FVDB 2LVCA 2ED9A 3MBEA 5IVXE 3RWFB 4F3FA 1GAFH 4PJCF 5BO1H 5LGJB 1PX4A 3VFGH 4NC2B 1I3GL 2IMNA 1ZHKA 1IARB 2PW2B 5F7NC 1BM3H 3R1GL 2EH8L 5E00B 4GRWH 2QQKH 4QXTA 3L1OL 5JLZB 3INUL 2NYYD 3O6KL 3TJHC 1RJYA 5KW9H 4M1DL 3V8OA 5C2BL 4BFBD 3IGAA 4EI6B 3NA9L 2NQCA 4Z18A 5TE6H 3GMOA 4XPGL 4BZYA 3LS5L 5IVZA 4WV1A 4HFUH 5DRXB 1NLBH 4GBXA 4PD4K 3VW3L 1PKQA 1CU4L 3JWDL 1G9NL 2QADB 1U8JA 5EZIH 3DVIA 1PQZB 3QIUA 5FAAA 1H3TA 1ACZA 3QIBA 2EXYD 5J0BA 5JPMB 3KJ6L 3ZYJA 1TLKA 1QFWH 3MCKA 3O3AA 2VAAA 2GSIA 1IAMA 2OTUB 3S37H 3LKRA 2ZPKH 3OJDA 1Q9WB 2IQAB 2VR5A 5CLTA 4MJ2A 3F5WA 1V7MH 1ZLUK 1J8HD 4JO4L 3TGXA 2CDEA 1OSZA 3ARTA 1FN4A 3WO4C 1G7JA 4KDTC 3BRGC 2C4FT 1U9KA 4ZUVB 4DKAA 2O26U 4X4MA 4CRPA 1FNAA 4KPHH 5FYLE 1JVKA 3HZKB 4Z7VE 4XRCA 4DGYL 1EA9C 1XR9A 5F89B 4CW1A 5KSVB 4LAJH 4RBPK 2GJ6D 2BVQB 5SWQA 1YPZE 3EGSA 5H8DA 2X4PA 3TFKA 2J5LC 5DC0A 1U6AL 4LGRB 1HXMA 4GRWB 4LPUA 4NZTH 5IOPB 3IJYA 2V2TB 1R5VA 1M6OA 3C5ZC 1MVUA 2Z35A 4O02L 4BFIB 5ADPH 5J6GA 4PY7A 5EO0B 3P77A 2NY4D 4FQCH 4M43H 2PR4L 1ITCA 2LE9A 2NY0C 3EFDH 3LV3A 1BD2D 4WHCA 1RURL 1QRKA 3G6JF 4H0IA 5C0BA 2VLRD 2FATH 4I9WE 3KPSE 2H2PC 2CGRL 1NMBL 5JR1L 3MRQB 3QI9D 1D9KB 1I8LC 3RIFF 25C8L 3P9LB 1N59B 2EIZB 4M6OL 2XKNB 4LCYB 1VGEH 3RAJH 2QL1A 4PRHE 3C6SB 3U7YH 1YYLH 1OP9A 3U0WH 1ZXQA 3WNKA 2EKSA 3DYOA 5E9DE 1DE4B 4P3WA 5DRNA 4KMQA 1Q72H 2VC2L 4IOIA 3RKDD 1E27B 3S34L 3HCVA 4OZGA 2YN3A 5ANMA 2NW2B 4P57B 5GRYA 3QDMA 3V0VA 1WCQA 3MUZ1 4P5TC 5A43C 2ZNWA 2ITCA 5DUBB 5B22A 4UT9L 2QHLA 5DVLA 3B9EA 1AXSB 3CZFB 1AGDB 3C09B 4L8BA 2CKBB 4DW2H 4F7CB 2FGZA 3DV6A 4R97B 2FNBA 4WDIB 1VESA 5KBNC 3TNMA 3KGRA 4LSRL 1SJHA 4LRIA 1IAIM 3E1F1 5I1CH 3ARDB 4G43A 2VXTH 1BJ1H 3UPRB 4ZUTB 1DSFH 1I8MB 4XBPA 1QZ1A 3G5VB 3KLHD 4JM4H 1D5BB 1GPOL 3BUYB 3WLWD 1FVCB 3OG4B 1GH7A 1MHEB 2HRPH 4F7MB 4H25B 3DHMA 3ZO0A 3GHBH 1MIEH 2R1WA 1J12A 2BHYA 4NQDD 5D1QA 4NZUL 4DKFL 1IGCL 4DQOL 4Y1AD 1LVEA 3PWJB 3LDBB 2AVGA 2E9IA 3ARED 2EYRA 1T4KA 1S7RB 3BP5B 3LQMA 4P2QB 1A1NA 5B8CA 1WZLA 4OI9A 1PYWB 4JKLA 3BDXA 4YHMH 4IJ3B 1J05A 4WU5A 5JA9A 1KLUA 4PRDB 2DJUA 2BNRE 4D0DA 3S98A 2VB5A 4LBEB 2RIKA 3ROOA 3TZVB 1SY6A 3O6LL 4TRPL 5IK3A 1U8LB 3T8XA 2B1HH 5ADOH 3MRNA 2Q20A 3OKOB 1N6UA 1YEGH 4HKZA 4WEBL 1X6NA 3U9UB 1DQQA 4NO0D 3TF7C 5HJ3B 4N1CA 4EI5C 4I0PC 1OCWH 2HVJB 1H3WM 5HYEA 5GGSA 1KIRB 1FLTX 1TZIA 3MUJA 3LHPH 2E9WA 5GSRA 3VDAA 4NCDA 4I4WA 4M7JH 4LPTA 4RNRB 5GS1A 5JOPE 1A6UL 4JHBA 5HYJA 1FE8H 2PO6D 5F8RC 2YA0A 4YDLC 1RIVL 3GSNL 1R5WB 3WKNA 4XWGH 1R5IB 4JGUA 1UFUA 3SDDB 1S7SB 1RUKH 4FQQB 2BVUA 3FRPA 3GMMB 1WIOA 5AZEH 1BBJA 2OXGA 2DKUA 4LCUB 3CNKA 1PX3A 4LARL 3WNLA 3OKEB 4M00A 1OAKL 1ZLSH 1IC4H 1TJGL 3I6GB 4JZOA 2RAMA 1A4JA 4PJ7F 5CSZA 4NJAH 4WJ5A 4MD0B 3V6BR 1MPAL 2Z92B 5KSAB 2DM2A 1M71A 5DFVD 4LLVA 1BOGB 4OB5L 3GSRB 1I9IL 1QBAA 2XKUA 3SE8L 3VMOA 2BDNL 4C59B 4MA3A 5AG9A 1MEXH 5DK0A 1KJ2A 4JDTL 5GRUH 4OLEA 1A8JH 3ULVF 2Z8WC 3RDTB 2DJ4A 4FFWC 2DM3A 4NWUL 4YHIB 5JQ6H 4XBGA 4RGOL 3HE6A 3O6MH 4M7ZC 1MCPL 5BJTB 2KH2B 3QUMA 1IEAB 3GMPA 3KYOB 4RFNB 4W6XB 4PJCB 4OI8A 3F62A 2X40A 4Q6YA 3KPQA 1UJTA 4ZTPH 3SBWC 2IAMC 4UT7L 2OMNA 3GBML 3LQAH 3SO3B 1U8PB 2IPTL 4X6CB 5GJTL 3RTQD 4XBEL 4U0RC 4JPWH 5EU5B 5F96H 3ZE2F 2NY2D 5FYJE 1C5CH 4CVWA 4GW5B 1MJ8H 1DLFL 5KS9F 4UQ2A 4AEHL 1F8TL 1CBVH 4Y16D 2VXQH 4WFGE 2ARWA 3QNZB 1UC6A 4WWKC 1BFSA 2IMMA 2A9ML 3O0RH 4G9FA 1KCGC 1ZVSB 4OFYD 1XGQB 4HAGA 4LPWA 2R1YA 3G9AB 3I6KA 1BZ7A 2NY3C 5B3JE 4ODTL 4H88H 4F7EA 5DQ9B 1HDMB 4UZGA 3TLRA 2Q86A 1WCBB 1VKXA 3Q6FB 3MRFA 5C0BE 5IF0A 5J3HC 1OTUD 1KTRL 2FJGB 3RJQB 3TA3C 1RMFL 4H1LB 2HWZL 2I27N 4KJWC 2HKFH 2HJFB 5DUML 2Q3ZA 3DARA 4JFZL 4ZO7A 1IKFL 4FQJL 4HZAA 3VRIA 3BD3A 4PRIA 2F74B 4YXLH 1A7RL 4QYOB 2ENYA 5DRZB 3BP6B 5B39A 3N0PB 1GHFL 3AUVA 4OZ4B 2VDOL 3Q5YA 5GGQH 3CDGA 3GBNL 3ZKXB 1NC2A 2Y06L 1XCTA 4TQEH 3STLA 1HIMH 5L2JA 2JF1A 1A14H 3X3FH 3BISA 4PJXB 1DN0B 1OM3L 3E8UL 3QIWA 5IGXH 1T04A 1I7TA 4BJLA 1S7QA 3H42L 3QDJE 3O2VL 4Y4KB 3UYRH 2X4QA 3WCYA 2IBZX 3ARFD 3B9KD 1ZS8B 1D3CA 5ANME 3WMSA 4WHTA 4MQ7A 4KZDH 1QHOA 3G6JB 3MNVA 1NC4B 1JZ7A 1IC7H 3L3DB 1RUAH 1S3KH 4MXWH 4NPYB 3VFMB 1E6OL 5FCSH 3S5LG 3KPRA 4JRXB 4UINL 4KMTL 2FH8A 2H3NA 4MNQA 3UTSE 4NO5A 3BIBX 1TNNA 1IGTA 1K8IA 2AJSL 2ICEB 1D5MA 3QUKA 1P1ZA 4R6UA 4MQXD 3AB0C 1I9RL 4HUXA 4U1GB 3UPCA 5DJ0A 4S0UC 1ZHLA 3QG6A 3B9DA 5ERWA 4N0CA 1KBGH 1TJIH 1U8MA 4UUJA 3I84A 4TNWK 5M7QA 5L7XH 2YPVH 1YEIL 2E7BA 3UJTL 3F7YA 3OG6B 4KDWA 2QLVB 5GJSL 4P23D 4O2FB 5EUKB 4C83A 5MHSD 4R96A 4RGMC 1X5AA 5BRZE 5C0AA 5F9WB 3NCFB 1FZOB 1M7DA 5LXGH 5F6HI 4Z7WF 5KJRH 5TH2A 2I25N 1XF5A 4QRPD 4L3EB 5TFSL 2BOCB 3GRWL 3T2PA 2B4CL 4I18C 4MD4B 2NY4C 3DETD 3MUGA 4JFEB 4KHTL 4QTHA 3HZVB 4QRQA 2MSPA 3PHOB 4MAYA 4RMRA 3DYMA 3NGBC 5ISZB 3H3BC 3BHBA 4WTXA 2RJMA 1D6EA 1G7HB 2ARJA 5CGYD 3OAZH 4M6NH 4TOYH 5ITBH 1YY8A 4MAUH 3NBNA 1JNNL 3P4MB 3QI9C 2X89D 2P5EB 2OM5A 2W91A 1B6UA 5GRVK 3RIAK 4EUPG 2X4NB 4X99B 1AI1H 2NXYD 4UTAH 4NCC1 4Z77A 2FX9H 4FFYL 4JFXB 2XZQH 3M8OL 3D25B 1MCFA 2MFNA 4APQA 2OSLA 3ZDZE 5I15L 3SKNA 5EOQL 2ESVB 3DSFH 1BQUA 3DOSA 3RKDC 1ZK9A 4GUPB 4U6XB 1ACYL 2EEBA 4Y89A 1XGYL 1UM6L 5D93B 3HAEH 2AEPH 2IBZY 4P4KA 4O51B 1HEZA 5IB2A 1A1MB 1F90L 1S7UA 3C5JB 5EUOF 3T0EE 3ULVH 3BGAA 3PABA 4ORGB 2AJUH 2VR4A 4LDLB 3ZTNH 4PGBA 4GS7C 4M48H 4OBRA 4X7FC 4YQXL 4HV8B 1FFQA 5DTFB 4BZ2L 3N1GC 3B9AA 2MQ0A 3IFPB 5IKCB 3BFOA 4HXAL 4W70A 3RL2B 5DA0B 5LWYL 4KVCH 4ODWA 3GHEH 1QBML 3GSUB 4MA7H 4OLWL 1J0JA 2MNUA 4ODXB 4XNUL 2ZSWB 3QIBC 3P4OA 4M1GH 4JAMA 1WITA 1UEMA 3RGVB 4P2OD 4KTEL 3V7AE 3KLHC 2J88H 3DVFA 4KHXH 4W4OA 4G5ZH 4JVWA 2X1OA 2GK0A 4K3GA 4XC1H 3CFEA 1K5NB 4L8CB 1JZ3A 4YWGL 4NQVB 3W5MA 1JF6A 3MLPA 1FHGA 3H9SB 4KWUA 1FAKT 1W72B 1I7ZB 3PGCB 4OJFH 5MEOA 2YUWA 3UTTA 3AREC 3RWHB 4PG9B 4FP8L 3ZHDA 2G2RA 4RZCA 4PJ7B 4P5MA 5FHAL 2V17H 4RIRA 5CP3A 5CUSL 4QRTA 1KIUA 3N1PC 4OCRL 3MNZA 4G9FE 1AHWA 3ZDYF 5DI8B 5FO9B 2E6QA 3B8YA 4RFOH 4DK3A 3FOMB 1B0RA 4R7NB 2XACC 4KK5D 4NUJB 2VZUA 1JN6B 3R06A 1K4CA 4DZBB 2EDHA 3MMEA 1GGCL 3AROA 1J0HA 5IHZA 2VLJD 3MROA 1VENA 3PGDB 4PP2B 2F54B 2XTLA 2AJVL 4LCCB 1H3GA 2W59A 4GKNB 1OOAA 3K80A 2YR3A 4Z0BL 1HHJA 1E0OB 4X7SH 1KTDB 1KPUA 5C09B 3QFJA 1FNHA 5HYFA 3NIGF 2PO6C 2FECL 3CX5J 2J4WH 3NH7L 2DQTL 1DVFD 4UIMA 5IBTL 2M1KA 4NHUA 3RWIA 2X70A 1UGNA 3O4LD 1IC1A 4HIXL 5D7KD 5BS0B 1E6JH 3FT4B 1G1CA 2VO5A 2HT4D 3NACL 3E6FA 1MHCA 3EYUH 1B2WH 3THMH 4I3GA 2WIIA 3MRKA 2E7LA 2C3XA 2G75B 3UDWA 3FQNB 4WFED 1WBXA 1NBYB 1NCBH 4N9OB 5ESQA 3HNTL 4MJ5B 5DFVC 5EN2B 1NEZB 1P7HL 3KPRE 5CHNA 3RGHA 5IUSA 4JKWA 2IF7A 3KR3H 4MNQE 3MA7B 4A6YH 1FFPA 1UG9A 1C7TA 5BVPH 2NNAA 3X3GL 1MI5B 5LBSL 3EJZC 5TE7H 4FQLH 1A6VL 3OAUH 4XCCL 1UZ8A 1RIHL 4V1DA 3PGFL 3FFDB 2HFFA 5K93A 3HC0A 3VRJA 5DK2B 4PRPA 4AH2A 2ZG2A 1XZ0B 4J1UB 4MS8D 3H2WA 3RTQC 3U7WL 2NY2C 5ALCH 5TJWK 5A16A 3SJVE 3DROB 5DQDH 1CFTB 2AK4B 2JIXA 4LSTH 3CLEH 3TBVA 3RUGB 1EDQA 3CK0L 5DJZA 4Y16C 1YEEL 3NPSB 4HG4K 1NPUA 4TVPD 2C3VB 5C0AE 3H0TB 4PPTA 1MCCA 4HJGA 5KSUA 5B4MD 4RGNE 2IBBA 2GIYA 5GIRA 3TH2T 4OGXH 4NUGH 4AYFA 5TDNB 2YBRA 1MRCL 5J7CC 5SWZB 5GGRB 4S0SD 1F58L 5IQ7H 5C3TA 3OGCA 1OTUC 4EBQH 5KN5B 3AMKA 4PLJD 3REVA 4KRPD 1QO3B 4N0FA 4QRUA 3VXRA 5FB8B 5T1MA 1EHLL 5EC2A 1X5HA 1UWXK 3OQ3B 2PUQT 2DTSA 3UO1H 3FB6B 1SJXA 1IM9D 1CICA 3U4EA 1KTLA 3MC0A 4QNPF 1NCTA 4CJ0A 3I3BA 5C7XL 5DURD 1D5IL 3ZYIA 1UH3A 1GOGA 4U49A 4G3YL 5DVOA 1BX2B 1PG7W 4MWFA 5ICYA 2XV6B 1UJ3C 1MWAL 3I85A 3ARFC 3B9KC 4Y19E 2DDQH 2XFXA 2YD7A 3KHQA 1MCJA 2L7UA 1J88A 1FIEA 3EDFA 1S8DB 3LRSB 4CBPA 2GJZB 5ENWA 35C8L 4AEEA 1W0YT 5CKGA 4U1SB 2X4OA 4ERSL 3WDIA 3WHE1 5BV7C 1I7RA 3HC3H 1S5HB 1BGXL 3GMQB 4X7TA 4O9HH 3VG0H 1T0NA 1BIHA 1UM4H 4NP4H 2PYEB 1I4FB 5C0EA 1CLZL 2WUBL 4Y8AA 4MQXC 3Q5OA 1VFBB 5JW4R 3LKSB 5I1LB 3A67H 1ZHNB 4GSDH 2YSSB 3QR2A 3D5OF 1RHHB 2ZUQC 3FOLB 1INQA 5D5MF 4HPOL 1AGEB 3MLYH 1VFAA 3QULA 4U05A 3WSQL 4LMQE 3EO9H 4L4VB 2C9AA 2J5LB 2VDLL 5DS8B 3OKLA 5GISH 4P23C 2Q6WB 4PJEE 3L95A 2CXKA 2E9BA 5JNYA 4QXGL 2ADIA 1G7MA 3GK8H 3MUY1 1B0GB 5GHWH 3CVIL 4J3OC 4PGDB 2EIDA 1CWVA 2NY0B 1TQCB 4ZO6A 3AU1A 5JW3L 3SGEI 1JWMB 3TBTB 4ZUUB 5EORH 1CXIA 1J8KA 4XVJL 4YO0B 3DETC 4K7PL 3MRLA 1S7XB 4EDXA 4MJIE 4LAQL 5AAWA 2V5MA 3I6LD 2BHUA 5ETUB 4HQQH 5JDSB 2FLRT 4FABH 3TCLA 2QHRH 1BECA 3IDNA 1JHTB 2GW5A 5CGYC 4Z95L 4IRSD 2BZDA 1JRHL 2OTWA 4J3SA 5DWUL 3MRBA 4JFQB 1T1YB 3F58H 1DBAL 3PL6D 4JPVH 1XT5A 1ZSDA 5GS0D 4S1SL 4E0RB 4HIEA 1NFIB 1CTOA 1NL0L 5HDBE 1D6VH 2B5IC 4I5BA 2NXYC 3MX0A 1QOKA 2WWKO 2LV4A 4RSVA 4NZJA 1XGPA 1T03L 3GI8H 5IROA 2J2ZA 3QUZA 2F8XC 3QFJE 3EYFA 4F2MB 1ZGLA 3BSZH 1WISA 4F37F 1I1AB 5CP7A 5D7IF 4D0BA 2A73B 3FB7B 3MNWB 4NHUE 2FJHB 4ONFH 2I07B 3QIWC 4P5TB 4YAQA 4GAJH 2C3GA 1OAXH 2EKJA 4NQCB 4AMKL 1BF8A 2E7LE 1JGVH 2X1QA 4CVZA 3W9DB 1JHKH 4PD4J 2EO9A 1G7LB 5MEQB 2YXMA 4RWHA 5MERA 4MCZA 5DFTA 3QISA 3MV8D 5IB4B 2D4FA 1U3HD 5J4MA 1RZ8B 2MHAA 3TBWB 3CSYB 5C2UB 1P7QD 2YUVA 2YWYA 4C56E 3REWA 1G6RL 2DIAA 4M61A 2H9GB 2CIIB 3D39A 5FM4A 4GG8A 1EEUA 3IDGA 4P2OC 5EOTA 1P2CA 4HH9B 3OB0K 1G7PA 4WI5A 1KC5L 4U1NB 3OR6B 2O5XH 2VLLA 3TESA 3BKJL 5I73C 4MDJB 4XNQB 2IPKB 1IZKA 3OMZA 1AO7D 3CPLA 1IE5A 4P2RB 4PJIA 1NGPH 1VGKA 2DQGL 2WUCL 3VXUB 4NCC2 3TN0B 5E6IA 5FV1L 1BZ9B 1IAIH 4Y2OA 3MLVH 4EUPA 1EEYB 4LNRA 1F42A 4BZ1L 3D85A 1FORL 3TBYA 3ARBA 1B4RA 1TCMA 3TT1L 1A3LH 2OR7A 1YDPA 4M02A 3V0WH 4OLZH 4NM4L 1VADA 5FEBA 3EOTH 4KK5C 5KS9A 4JRYA 1BAFH 3QB7C 1PZ5A 3SDXF 4I0PB 4BUGA 4HPYH 4YHKL 1LP9F 1TCRA 4GRLB 4Z6AT 4JM2A 3VFVA 3E2HA 4NKIH 4JY4A 3PJSA 4NYLA 1AXIB 4O5LL 2F8OA 3VXRE 1YJDC 4ZTOL 3WD5L 1RZ7L 5J89A 5FUZL 4U6YB 5I1DA 3U2SB 1PG7L 2VDMH 2APXA 3MXVL 3MJGX 4OIIH 5F97E 2NY1B 4DTGH 3L3GB 1OT1A 1KPRA 5DJ6A 4HDIB 1DVFC 1RSFA 2IEPA 3B43A 3KPSD 1FYTA 2OI9C 1F4YL 4YBQD 2CR6A 2YWZA 4OD1H 4Z76A 5JO5A 2VKWA 2HT4C 3DXAA 4D9LH 4P4KC 4E41A 5IMLB 3M1BB 2D7TL 5C0GA 2X9YA 3H6JA 3LS4H 3Q3GB 1S9KC 5MENE 5GGVH 3FAWA 3KYNB 4R7DA 4XNYH 2QEJA 1A7NH 3GDBA 3IU4H 4PRHD 5D96C 3WHE0 3HUJA 4NNYB 3WS3B 1JRHI 1AJ7H 1R3HB 3EDDA 5E9DD 5JOFB 2UWEA 4NQSA 3QCVH 3MREA 1QSEB 3LEYL 2HJKB 2P4AB 4YR6A 5LAXB 3VXSB 4OF6A 3SHSA 2AXGB 4HF5H 4UDUA 2IAMB 3RVUD 1RZFH 1IC5L 3QUXD 1RJCA 3AXLA 2FJFB 5C0CB 3EO1A 4PJ9A 5I75B 2DLHA 1AQDB 2DLFL 4W4OC 1OGAA 4XP5L 5IB3A 5E8NB 4PJFB 3QWRA 4G8GB 3T4AB 4R8WH 1E4JA 3FQUA 2P44B 3W0WB 4MS8C 4CVUA 4OM0H 1I7UB 5FF6B 4LHUB 4LHQB 4QT5B 4LFHG 2W0FB 1G7IA 1IGJA 1MRFL 3RZCD 1RUPH 3HNVL 4MXQD 1KCUL 1X5IA 4NO3A 2BJMH 4PGEB 3P0YL 3EUUA 3L5XH 1CD9B 4FFEX 4J3TA 1T20A 3ARGB 3IF1A 3UTQB 2NY3B 1V8HA 3VFUA 3STZB 4A6YA 1WBYB 5B4MC 2BCKA 3VXOA 4NOFA 5I6XB 1U8NB 1F4HA 3NFNA 1PSKL 3IJSB 2CSPA 1JFQL 3C9NA 1OQXA 1KN2H 2VERN 1MY5A 1CG9B 1R6VA 4M5ZL 2AABH 4OUUA 3JUZA 1PDKA 1YEDA 4XP6L 4OLYH 3VWJA 5ITFA 5DZOA 1KOAA 4PIRF 3RVVD 3KYKL 3MLRH 3FMGH 3NIDE 4GXVL 3U6RA 4AY0A 2VLKB 5BOPA 1JPTL 4PLJC 2D31A 4KRPC 5C0RL 4OI7A 2EDLA 2MPAH 1J11A 3CXDH 5E94A 5FHBL 3OF6A 3CC5A 1H15B 4G80A 5L9DL 4CMHC 3QDGD 4U1LA 1JMZA 2P49B 3FKUS 5DJ8A 1IKNA 1G6RB 1HSAB 1QFPA 2ADFH 4JZJA 4KMLB 3N1FC 5I16A 5L88L 3HKFA 5E2WH 4XNXH 1N4XH 2SEBA 2Y72A 4MLSA 3VXMA 1A6PA 5FK9B 3HRZB 3MV7A 4PBXA 1BP3B 4JHWH 1WIUA 4KY1H 2AKRA 1FFOB 3UTZA 3GSQA 1OAQL 3KLAA 3OKNB 4R4FH 2GJJA 4POZD 2EDNA 4R3SB 1A7OH 1VB9A 2BRRH 4WNQA 3UDWC 4MQTB 4RAHA 3X14A 4P59L 1CE1H 1NGYA 4J3VA 5JOPD 1U0QA 3IXAA 5AG8A 4ZG1A 5ACZB 4MD5B 1AD0B 1UA6H 4CGTA 3LMJH 1G0DA 3D87B 4ODUA 4NC0B 2QQNL 3L3IA 2BSTA 1DCLA 5BZDA 3KDMB 3MYJB 5J9PB 2GAZA 1I3GH 3FO2A 1U92A 2O61A 4J3WA 2VIRA 1F5WA 3R1GH 4Z9KB 12E8L 1NGQL 2EH8H 2GTZA 2Q1EA 5T1LA 5KG9B 2VAJA 3L1OH 3D39E 3INUH 3RWGB 3WKMH 3OKDA 1MUJA 3MGTA 1EAJA 2ENSA 4M1DH 4HS3B 5C2BH 2F5AL 3TJEH 4NKOA 4GQ9L 2QR0B 4ETQA 3NA9H 4I8DA 3CDCA 5DVMA 4XPGH 4XMKL 1WIPA 3OKYA 3LS5H 4H20L 3O3BA 4RGMB 2M2DA 3QQ4A 4U1JA 3ULVE 1OLLA 1X5YA 4PJIE 4N8CL 3VW3H 2Q76B 3U7AA 3VFSB 1CU4H 3DSNA 3JWDH 2Z31A 1G9NH 2XG5A 4I18B 4RX4A 2JB5L 4HK0B 3B9VA 3KJ6H 5INDB 3I50L 1IQWL 4NKDB 1BD2B 3QUYA 5L6YH 3FCTB 4XVSL 2X10A 1A7PL 3ZE2E 1EEZB 4JN2A 1HHIB 5HHVL 4JO4H 5CZVL 2H32H 5KS9E 4HUUB 4JRYE 1FO0A 4H5SA 4PYGA 1GGYA 5FYJD 3QI9B 2BVOB 2E3VA 3K8MA 4KKBD 1NCCL 5SWSA 1JI1A 3JVGC 3PL6C 3BDYL 4WFGD 2DB8A 2DN7A 5DT1L 2VXVL 5GS0C 1KELL 3MLSL 1I1YB 3BESR 4LCWA 4OAWA 1P4LB 1P7KB 3JV6A 4NQXB 2GT9A 1F11A 1KCVH 1KCSL 1S9YA 2XQYG 3MRDA 5AYQA 2R39A 1QR4A 5ILTL 4X4ZA 4JHAL 4O02H 3T0VA 1EGJA 1OLZA 3G08B 1SY6L 1E4WL 3HFML 3ALXA 5E4EB 4OCYL 5C0BD 1OVZA 1CT8A 3NAAH 3WFDL 3C87A 1I9JL 1FYTE 1RURH 2DQEL 4M8QA 3BPNB 5T3ZH 3FT2B 2QQLL 4WY7H 5KSBF 1TQBC 1FL6A 4E41E 3DXAE 1IM3A 2CGRH 1FIGL 1NMBH 2AV1A 4CADA 5JR1H 4PJAA 1ETZA 1QD0A 2P5WA 4H1LG 5IW6B 2Y36L 1NFDB 1B90A 4M6OH 4JLRA 4ISVB 2OS7A 3EYQD 4JFFD 5E70A 2ICES 3FFCD 3DJ9A 1HI6B 1OL0A 2N56A 4U1HA 4NQED 2NY6D 1U3HC 3GGWA 2H32B 4DCQA 5I8KL 2P1YA 1JGUL 3QDJD 3E0GA 4ZAKB 2Q7NA 3QEQB 1JTTA 3GI9H 3ROLA 4F57L 3QAZC 3S34H 3F12A 3LCYA 4Y1AB 4KI1A 4RFEA 2D9CA 1FNSL 4L4JA 3Q6GL 5FO7B 5IBLD 3AREB 3PWPA 1XGTA 2PW1A 4PJHF 4IIQB 1R24B 2EC9T 2GSGB 1QG3A 3N85L 4NRZA 4N9GB 4UT9H 3N9GL 3UTSD 4OZFB 1AIFB 2VNCA 4S11A 5CMAA 1KTKE 3MV9E 2BOBA 4M8VA 5BV7L 4EJ1C 3WN5C 1VHPA 4LSRH 3WO3B 3DUHA 3VXPB 4QHKI 1SQ2N 2EE6A 2XQBH 4P0DA 4U6HA 1A6WH 1HE7A 4URTB 4X4XB 2ICWJ 1IGYB 5HHMA 3QUML 1MJ7L 2ADJB 3QCUL 2GITA 3CH1B 3EHBC 1GPOH 3SKOB 4Q9RL 4NFBA 4QOKE 1EFXA 2ZG3A 3HMXA 1LEGB 1N3NB 4NZUH 3SQOL 2ILLA 1IGCH 2Q7YA 4L9LB 4AT6B 2IADA 3BN9D 5IMKB 5IM7A 1CVSC 5IHLB 5JW4M 4Z7WE 5BRZD 1MCSA 2IJ0C 4UDTB 3VCLA 1WT5A 3ZE1F 3MOBL 2PO6B 5DD1L 1JYNA 3LEXB 1T1WB 3DVNA 3HS0B 4M7KL 1AGFA 4XZUB 3TPUE 5IROC 3O6LH 4TRPH 2X1XR 3P9WB 2AJYH 3RWFA 1GZQB 5D9SB 1A22B 1JUFB 3RIFK 5KVGL 3D9AL 1C16B 3AAZA 4YBQC 2XRAL 3NN8B 3MV7E 4HMEA 4F8TA 4WEBH 3J7HA 3VXNA 4LCIL 1K2DB 3BZDA 3KPMB 4LHJB 1RZJC 3V7MA 5ESVA 5JLZA 3S97C 2DRUA 4WUUB 4YHPB 1J1XL 3A6CL 4HWBA 4UIKL 1QBBA 5AYUL 1DQMH 4DGIH 5D71L 3MRRB 4PFEA 1ZT1B 4LSDA 2L4OA 2R1XB 4X98B 1RI8A 2VUYA 2R56L 1ZTXL 4NC1E 3TCXA 5KTEL 1QA9A 1A6UH 1RIVH 3P0VL 4PJ8D 3GSNH 3VU2A 3F7VA 1W8NA 5EUOE 5TDPB 3ZMRA 2VDKL 2C3HA 1PQZA 3KPNB 2X09A 1R3IL 4ZODA 1CGTA 3D69B 5H94A 3T0ED 5JPMA 1OW0A 2BC4B 5I1HH 2Y6SD 3H3KA 4LARH 4JQVA 2NY2B 4RA0C 5I76A 1OAKH 5DJ2A 2RGSA 2DKMA 4ORZC 5DVKA 1TJGH 1Q9WA 4P3CL 3GKWH 2P45B 5CCKH 4HMDA 4Y16B 3TYGL 3ZDXF 1S7WA 1FNGB 2FR4B 3RZCC 3PIQB 3TYFA 5IT2L 1R3KB 2HG5B 2PXYA 4MXQC 4LSSL 1I9IH 3SE8H 3HZKA 4GH7B 4PRAA 2IGFL 1U93B 1AKJB 4JDTH 5KSVA 2JJUA 4NWUH 5IB1B 4LEOB 2BNQB 1MCPH 1NSNL 4YPGA 2V2TA 3BPOB 4FTVE 4BFIA 4PDCE 4UT7H 3GBMH 5EO0A 4ELKB 5GJTH 3P9MA 3RVVC 1DFBL 4XBEH 5DMKA 5EU6D 5FYKD 5EIIA 5DEFA 4GRMB 1DBKL 3U46B 4X0KA 2F53E 5EOCH 4QHLB 1FG2A 1VCAA 1NMAL 1Z9MA 2DQFA 1DLFH 1DQDL 1L0QA 4AEHH 1F8TH 4G8EB 3ZDYE 1QKZL 3MJ7B 3QCTL 5CD3A 2C4FU 1IL1B 2IQ9L 2A9MH 2AXFA 4IDJL 5TDOA 3G6DL 2DLTA 4DJMA 1N59A 2XKSA 5F7YC 2VDNL 4NN7C 1UJ3B 1U95B 4ODTH 3ARFB 3B9KB 4Z7UF 3FTGB 2JELL 1OARL 3ARUA 4KAQL 5DZNA 3NFSL 1IT9H 3NZHL 1BIIB 2I5YL 4OQ1A 5FA4B 5EO9B 1RMFH 4O58H 4HEPG 4POZC 1BPVA 5E5MB 2HWZH 1I1FB 3LZFL 4EN3B 4MNGA 1YJDL 1CGSL 4BFEA 5DUMH 2P5WE 2ATPB 3ZSTA 5L8LB 1MFBL 1MRDL 3K0WA 5C92A 1IKFH 1SJVA 2FHCA 3HB3D 5CEXB 5D7IA 3S4SB 4BK5A 5DUBA 1A7RH 2ZCLL 2OP4L 4R0LA 4RMSA 4MNHB 2DL9A 3CZFA 1NDMB 2CKBA 1CGWA 1NC2D 1GHFH 2HVKA 1NH6A 1J87A 5EU7C 4ENED 3O6FD 4XMLL 2DQIL 3GBNH 1TDQA 2Y06H 3H7LA 1CL7L 4Z7QF 2ZUQB 3E8UH 4M93C 1XR8B 2CRZA 3H42H 1QVOA 1KJMB 1I8MA 5E4IA 4OT1L 5A2JH 2UYLA 4ZPTB 3G5VA 1JZ4A 1YA5A 1D5BA 2RCSL 3JTTB 4XCYA 4P23B 1FVCA 3KPTA 3PWPE 5HGBB 5EO1B 2IANE 3NVQA 2ERJC 3CSPA 3KPRD 1I85C 2X4TA 1E6OH 3ERYA 4CU8A 3I9GL 4LPVA 3VGAB 4UINH 4KMTH 4CU6A 1J1PL 4HG4J 3W11D 4NN6C 4QRPB 1NEZG 1MFDL 2AJSH 3IJHB 3C60A 4OFDA 3R0NA 3TVMD 4JO2H 1OD9A 3T08A 1PYWA 2B39A 3OXRA 4GLRI 1TENA 4G59A 4PRDA 4GMSL 1I9RH 5I66A 2A6DB 2P8MA 4LBEA 1K9TA 5E2UH 3TZVA 3VE0B 2Y23A 3SJVD 5T1KB 4KKBC 2HN7B 1YEIH 1F97A 2OQJB 3UJTH 5E95B 2B5IB 3GMRA 5EZLB 3VJ6A 4OTXL 4DVBB 3IVKB 3QNXA 2YA1A 5HJ3A 1NGWB 2DJSA 2HVJA 2VQTA 5FA3A 3IRZA 4TVPL 4PUBL 1QRNB 1KIRA 4E5XB 1HNFA 3NCJL 2KQNA 1JPST 4FQIL 3UYOD 5JDJA 5TFSH 3GRWH 3QA3B 2B4CH 4LLYB 4DKEL 4JFYB 4RNRA 2IG2L 4KHTH 4X5WA 3GJFH 3HPJA 4YXHL 1ZT7B 3WUWB 3SDDA 2GTWB 4FRWA 4FQQA 3HMWL 3L3KB 3GMMA 4HIIB 3U82B 1I8IA 1JNNH 2YRLA 4X5XA 1LK3L 3KG5A 2FEDC 4QNPE 3BEVB 3IS1X 4B5EA 1ED3B 5E99L 2HTLC 3BO8A 4FQPA 3BZFB 2DYPD 4Y5YC 4JFPB 2B2XH 2R0LL 5C70A 4MD0A 3BGFC 2MCPH 2Z92A 2KL6A 2AI0L 4FFYH 1ADQA 5KSAA 3M8OH 3GSRA 4EOWL 4OF5A 4LVNC 4M6ML 5EOQH 4HX1B 2FB4L 2J3SA 4FZ8L 1FZMB 2YUXA 3SKUD 3RDTA 1ACYH 1TITA 4Y19D 3U30B 2XN9B 1XGYH 4N90D 4YHIA 1UM6H 2APTA 4KK8D 2Z93A 3DMMA 5I73B 3ISWA 2Z9TA 4N0RA 3KYOA 1F90H 4XX1G 5EBMB 1S9WA 2BHZA 5IBLC 4PS4H 3EW3B 4U1IA 2W65B 3IDUA 1JF5A 1C8PA 3KLDA 5EC1B 4BZ2H 1U8PA 5IHUL 5F1KC 4HXAH 5IWLA 5EU5A 5LWYH 2I9TB 2GCYB 1F4XL 3B3IB 4L1DA 4X6DA 1QBMH 4FQXA 4OF7A 4OLWH 5J11C 2Z31C 3WLBB 3HC4L 4Z78B 4XNUH 4P2QD 2R0KL 2X4SA 1IAKB 1F3RB 3QNZA 5D5ME 2G9HB 5FKPB 5HI3D 3RJDA 4HUKB 1T1ZA 1ZVSA 4KTEH 1T0MA 4KXZH 3QO0A 2Y07L 2W9LA 1CLYL 1ND0B 1CGVA 2VLJB 1CL7I 4U2YA 5T1DH 2P24B 4YWGH 3MZTA 3OTTA 5DQ9A 2AQ1A 1HDMA 4NKMA 3NFPA 1AD9A 3BN9C 2V2WB 1U8HB 1WCBA 4XP9L 3Q6FA 4QGYA 1YNTB 4XMPL 4ONHB 1Z9LA 4FP8H 3ECBB 4H1LA 1JTPA 2OJZL 2AXJA 5FHAH 3K4DA 2A1WL 1BQHG 3O8XB 1CD8A 5CUSH 1J0ZA 2VTFA 2W07A 3LN4B 4DN3L 2PN5A 4OCRH 2P47B 4XNMB 1V7NH 4JREC 1UB5B 3BX7C 4PRNA 2QKIB 5DJDB 1NCWL 4MJID 2J8UF 1WZMA 3QXTA 5E08L 3IKCB 1FH5L 2NCMA 5DRZA 2V2XA 3BP6A 2JJVA 1T0PB 5IMOA 2EC8A 3SDCD 4PJXA 5GGVY 1GGCH 1DN0A 1FGNL 3PP4L 4Y4KA 3O41A 1G6VK 1JNLL 1C12B 3SKJL 1HZHL 1YEJL 5GS0L 3T09A 5L8KB 4MNGE 4MJ4A 2Z91B 3SY0B 2AJVH 2XPGA 5HDQH 1NC4A 3MFFA 3L3DA 4XT1C 1FG9C 4NPYA 1FVEA 5D7IE 4MJ6B 3VFMA 2F9BT 2FYYA 1EJOL 1E28B 4NRYB 3QEHA 2EZ0C 4Z7VF 4JRXA 3VGEA 2R29L 1KT2A 3NH7H 5CWSB 5HYIA 2DQTH 5IBTH 4PY8J 3H3PL 1UYWL 4H0HB 2CLVA 3MTRA 1WV7T 3WNNA 4P4RB 4HGKC 4N5EA 1B3JA 1L9NA 4Y5XA 3RX5A 1W0WB 2Y6SC 3NACH 4I77L 5F88A 2WV3A 4GG6B 1HHGB 1TXKA 1DR9A 3CMGA 3SQBA 1H5BA 1LWRA 1WBZA 3PQYA 5I1KL 3AY4A 3RHWF 2XWJB 3HNTH 1GGTA 2VISA 3SGJA 4GKSA 4C56D 4M4PA 3SGEH 43CAB 1RUQL 1TZGL 3DIFB 5D7JD 4BSVB 3S8WA 4O2FA 5EUKA 1WQVT 1UADC 3UZQA 1BBDL 5HHXL 3X3GH 4AL8L 5LBSH 4XCCH 3CDFA 4LNVA 3HR5B 1MQKL 1RIHH 5C86A 2OMBA 5C6WH 4N1EA 3PGFH 1RUML 3QXWA 4GKZA 3IFNL 4MD4A 4F80A 3I3DA 4UV4L 2IH1B 4ZO9A 4LPYA 4JJHA 5FDWB 3U7WH 3HZVA 5AD0B 4YDIL 1FLRL 1O0VA 2DWDB 1DBJL 5DRWB 5GGUB 3RWEA 1IM9B 5ISZA 2BSED 2VL4A 4CMHB 5IR1B 2XTJC 1OTTD 1WT5C 3CK0H 3P4MA 5DURB 5HTSA 2AJXL 5C9JB 1IGML 4HIHA 3SDXE 3GMNB 2X4NA 3DHJA 4X99A 4JVUA 1LP9E 4OLXL 3T2NL 4JFXA 3D25A 1RVFL 2Z4QB 4JFDB 3SDAD 3D0VA 1QFWM 1MRCH 2ZOLB 3WS6A 1HXYB 2WY3A 2IH3B 1N0LA 1F58H 1NKOA 5CEZL 4KROB 1P9MA 3MRMA 3TWCL 4J4PD 1T2XA 4F33B 1KB9J 5CIPH 4O51A 5DJXA 1O7VA 4K3JH 2XG4A 1CLOL 3HB3C 4JR9L 1MCWW 1RFDL 5SX5H 5DTFA 5J13B 2ZSVA 1V3JA 2H1PL 5KVFL 4ONOA 1EXUB 3RL2A 5FXCH 4ENEC 5C7XH 3O6FC 1C08B 2H8PB 2WMPA 5IEHB 4TNVF 2QADC 4G3YH 4KV5F 4ODXA 5I9QC 1F3JB 2ZSWA 4Y5VA 3HE7A 3OR7B 1MWAH 5MEND 2MCG1 1FC2D 1S9VA 2GUOA 1Y0LA 2EDBA 4M9PA 3RGVA 1RZJL 5JXEA 4PV9B 5J6HA 4GXUM 5T3ZE 5IP4A 1S5IL 3L3HB 4OLUL 3QXUA 3VRLF 35C8H 3CFKB 4L8CA 2NX5E 5GRVL 4NQVA 3ZE0F 3GO1L 4ZFOL 4KJYA 3AVEA 4ERSH 3VMNA 3D18B 1I7ZA 3BKML 3W11C 2E7MA 3CFJB 1BGXH 4X6DE 4CNIB 3RWHA 4U6VL 1SYVA 4PG9A 1TVDA 5CILL 4UQ3B 3O2DL 4MZ2A 6CGTA 5D6DC 1K3ZA 3BAEL 3CDYA 2BNUA 3HLAA 1CLZH 2WUBH 3ZL4H 4HKBA 1A64A 5ACLA 4BQCA 1CFSB 2FX8L 5DI8A 5FO9A 2ZUTA 2NZ9D 1UCBL 4IRSB 4L3ED 4WW2C 4ELMB 1BFTA 5A40E 5BMFL 3EBAA 1BQLL 4HPOH 4I2XA 4JFED 1A6TB 1F6FB 2WIMA 3WSQH 3CCHA 4PB9L 4NUJA 4Z7OE 1JN6A 1XIWB 2VDLH 5C07A 3UXFA 4DZBA 3WFHB 4YHOL 2D2OA 1JTOA 4WI2A 4U6TA 4QXGH 1A9BB 3PGDA 3RWCA 2RFXA 4PP2A 2DLEA 3CVIH 1D9KC 3D3VA 2P5ED 5DLML 1VEMA 4U3CA 1T89C 3D6GA 4GKNA 2BY2A 4D3CL 5DD5L 5JW3H 2DIJA 4Y4HB 1CE6B 1X5FA 2WINA 4XVJH 5CINL 2FWOB 5D2LF 3MR9B 2AJ3B 4LAQH 5LGKA 4QHNA 3VMPA 3KLSA 4RA3A 4JY6B 3FAXA 4Y4FA 2ESVD 2GFBA 5FYLH 5I1AB 4Y2DB 5JHDB 4Z95H 3RX7A 3L7FB 4U3XA 5IVXB 5BS0A 1JRHH 4XPFL 3DUSA 3FT4A 1GOFA 1DBAH 2UZXB 4S1SH 4K71B 3MV8B 1J0IA 4M1CD 1RAMA 3CH8A 5E6YA 5MEPB 3FQNA 1NL0H 3QHTC 4ZUWA 1NBYA 1LO5B 3RI5F 1ES0A 5GS2H 4MJ5A 1T03H 3ZTJG 4K3DL 4R4BB 4NNPL 1NEZA 4EXKA 2WP3T 32C2B 1Q94B 3GRWA 4MLIA 3L9RA 1MLCB 3WFBL 3ZHKA 1IQDB 4KK8C 3ARDC 5IMMB 1MI5A 5HI4D 4ZPVB 1JPGB 3BH8B 3ALPA 3EYVB 1T83A 2GYSA 1QHPA 1C5DA 3KPPB 3PQYE 2APBA 4PV8B 2VWEE 4J1UA 3RWJB 2VQ1B 2M26A 3H9SD 4LRNH 1W8OA 4AM0B 1X44A 4MCYA 1BWWA 3DROA 3TV3L 1HK6A 2AK4A 4QLRA 5LCVL 1Z9SA 2EO1A 3D1MC 1BJ1J 3BP4B 1ZWIA 1UXSB 2C3VA 5HI3C 4KUCF 3O9WA 4IJ3C 4Z7VB 5DO2D 4KI5E 1NCAL 3GM8A 3TZVC 1KC5H 4GAGL 4GW1B 1WSST 2JE8A 3X17A 3Q48A 1YPZB 4RAVB 3VFOA 1CDBA 2XWBB 1JGDB 3T0AA 1QSFE 1NBQA 3SCMD 5TDNA 3ZSSA 4M7LL 1MFNA 5C0IA 1ONQB 3AS2A 2DQGH 2WUCH 5ID0B 1A4KB 5ISZE 3SE3A 4CN4A 2YRPA 3GIVB 4M5YL 5KN5A 5K59F 3D0LB 4OZGF 5FB8A 3O4OB 2ATKB 1RJZA 2F54D 1XF4B 2ICWB 4BZ1H 3I2CH 5E03A 1QYGL 4WI6A 1FORH 4TSCL 5D1ZD 3KPSB 4N0UE 4XCNB 3FB6A 2P42B 3TT1H 3RL1A 2DMKA 4NM4H 1CQKA 2OK0L 1JGLL 1CFQB 5C09D 4P3DB 4EQ2A 1INEH 3C2SA 3T3PF 3TJHA 5F7DA 4OF3A 4YHKH 5CBEA 3VFPB 3SDDC 1CS6A 2ZNXA 4MMZC 4PRHB 1G1YA 4U33A 1QPPA 1M7XA 3GJEB 3HI6L 4K3HA 5E9DB 3MLWL 2FX7L 4O5LH 1CF8L 5CEYB 3WD5H 1RZ7H 4NBXB 5FUZH 1OTSD 1CQYA 4Z7UA 3HA0A 3LRSA 1PG7H 1JPSL 2GJZA 3MXVH 5BOZG 5KZCD 4WWID 2OXHA 2HLFD 3QUXB 4U1SA 4PP1D 3S7GA 2XNAA 1Y18B 5KSBE 1TETH 4OCWH 3PP3H 4TUJA 5FGSA 1YUHB 2A74B 3QPXL 3IYLW 3L3JB 1F4YH 5IFJB 3S35L 1SMOA 3T77B 1Z9OA 2BSSB 2VMFA 1EHNA 2PYEA 1FZJA 1KV3A 4RFNC 4KDTA 5C8JB 1NAKL 4C58B 3LKSA 4DUVA 2YSSA 5T3XL 1RHHA 1CXFA 3MRCB 2Y1VA 4XGZA 3SO3C 1K4DB 4OQTL 2D03L 4F15B 2X42A 2CKNA 1LO2L 1LO4L 3WFEL 3HI1A 3NTCL 5IWLC 1IGIL 3BIKA 4L4VA 2UV3A 2ZWLT 2D4DA 1R0AL 2R9HD 1ZLVK 3FO0L 3LEYH 3BZ4B 2Q6WA 3SPVA 3AS3A 1BQHA 5D7LA 1NLDL 2RB8A 3C5ZA 4GQPH 1NBVL 3I02A 4LLUB 1IC5H 4I48A 1LILA 3ARSA 4PJHE 4WO4B 1I9EA 1QLEH 5HHOE 1U8KA 2V7HA 4XP5H 4CVXA 1AXTL 4ZUUA 4YDJB 3TBTA 1HOCA 3T2OA 2P8LA 1S7XA 1AQKL 2IPUK 3MV9D 5C08E 4I2XE 4WCYH 2BNRB 2HFGL 4POUB 3G5XB 5ETUA 1MRFH 5JDSA 4KFZC 2OZ4A 3HNVH 5SWZD 5KAQG 4R26L 5FKAB 1KCUH 4YFLI 5C07E 3BEWB 1MQ8A 4OZFG 1OTTC 3P0YH 3TO4B 4K9EC 5HY9A 1SBSL 4YGAB 1XGRA 3ZKMC 4K8RL 2V9RA 5HPMA 2R0ZL 2XWTB 1MFCL 3PWVB 5EA0L 4HUNB 3D3VE 1GC1H 1NFIA 5BXFB 1PSKH 4QOKD 3T65B 1JFQH 4RMTA 1U2CA 2CLRB 4JFHD 5HVFB 4M5ZH 3ARWA 2HRLA 4XP6H 3SDAC 4F2MA 4OM1L 1QSVA 3H9YA 3KYKH 3PHSA 2NZIA 1P69B 3FB7A 4GXVH 1JPTH 2I07A 4J4PC 4QXUL 3MLXL 3RPIB 4P5TA 3MBEB 3B6SA 3QNYA 4PTTB 5BS0E 3DVGA 4F3FB 2VITB 5AWNH 3WXVL 4LLAA 3P73A 5FHBH 1ZHKB 3LRGA 5BVJA 5IJVB 2A6KA 5JHLL 4LLQA 5L9DH 2GKIA 2QJDA 4LASL 2E27H 3CVHB 4O2CB 1AP2A 1ZA6B 5CJ8A 3MCLL 3MACL 3B2VL 5L88H 1GVIA 1C7SA 5F7HA 2UZIL 3MV7D 3IGAB 3QG7L 1CFBA 5HD8D 2AK1L 3TBWA 1ZGLM 3CSYA 1M7IB 1N0XL 1SVZA 2H9GA 1BOYA 4GBXB 1P6FA 1OAQH 1V05A 5H35B 3O3EA 4HH9A 4U1GC 3ZLQC 1U8JB 2A83A 3JV4B 3OR6A 4P59H 2DM7A 4N8VG 2K3TA 4MDJA 1ZT4B 2ZUYA 4LIQL 3O3AB 3OPZL 2VAAB 2GSIB 2EEAA 1FPTL 4PJGF 3OJDB 1CFVL 4DWHA 5HHQB 2E9JA 2XQYK 3TN0A 3F5WB 3EIFA 2CDEB 1OSZB 5HGHB 2EDOA 1FN4B 1G7JB 1RPQA 12E8H 1EEYA 1NGQH 3VDCA 4R90H 5F9WC 3UEZA 5I19L 1WC7A 3MBXL 4ACPA 3QEUB 1ZEAL 4XRCB 5MI0C 4CW1B 4KQ3L 2F5AH 1MWAA 5CJXA 4GQ9H 2VABB 3TF7A 4H20H 1HXMB 4EI5A 1RZIB 4I0PA 5D7SL 3IJYB 1R5VB 3SDYH 3OHX