5BS0A

Mage-a3 reactive tcr in complex with titin epitope in hla-a1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5bs0A01
3NZHH 5DZNA 1V5JA 1IILE 5LAXB 2NQCA 4FFWC 3NCMA 1EGJA 1XCQB 2XN9E 5E70A 2JELH 1Y0LA 5HHVH 1CU4L 1GGBH 2AEIT 1FIGL 2JJSC 5EIQA 3QEQE 3H9YA 1IARB 3O6FA 5I73C 4OFDA 5E2VH 2APXA 4OLVL 5DJAA 5E24E 5EUOE 1PW3A 4AG4H 3KPRB 1UKTA 3ZE2F 4TYUA 4P4KA 1QG3A 3S8WA 1W8NA 1MNUH 3E0GA 4L8SB 4K2UH 4MXVE 2R2EB 2JJWA 2ZKHH 4POYA 1MH5B 5E8DH 1EBPA 3KLDA 3KG5A 1F13A 1JUFB 4B53A 4KRPC 3FT2A 3MZGB 2Z4QA 3QH3A 1EXUA 3H3KA 3RPIB 2ARJA 4P23B 1RUQL 4P59L 1IVLA 2QQLH 4DAGH 4GW4B 2CR3A 3C6SB 3VFMA 4R2GD 3RUGB 4U6YA 2OLDA 4NP4H 1CFQB 2VXVH 5EOCL 1JGEA 3HAEG 2R23A 1YEHL 2E27H 3ARFA 4K9EC 5C86A 5D96B 1JRHI 5BRZA 2DLFL 4K94L 4MX7A 1T0MA 4I77H 4J4PA 1QFOA 1SJXA 5JQHC 3SGKA 4WI9A 4JQVC 4ZSOB 2F54A 5E6YA 3BP6B 4X99B 2YWYA 3ARXA 4CN4A 3FB5A 1BBDL 1N5AB 2ERJC 2X1QA 3NN8B 5MEQB 3L3DB 3B8YA 3E6HA 1HHHB 3PP3K 4U1LB 5ESQB 2J2ZA 1NANH 4X8JB 1RZ7L 2H26A 4AEHH 3N1MC 5I1IL 1B0RA 2R8SH 3HNVH 3Q3GB 5EWIL 3I2CL 4GW5B 5C0EB 1RIUH 3ORJA 1HOCB 2BJMH 4Y16C 4DVRL 4WVRA 4XWOD 4WV1A 4LF3A 3OKEA 4L1HA 4LMQE 4IRSA 3PWVB 4NKOB 1CE6A 2Q76B 3T0BA 1FVDA 3O3UN 4LRNL 2OR9L 5KANI 4JZJC 5A2IH 4FFZH 1UJ3C 1UXSA 1RHHB 4WNQA 2D7QA 1N59A 5SV4A 5HHMA 5MP6L 1NEZG 2EDWA 2BNRB 3FT3A 1F2QA 1OP9A 2DKUA 4PV8A 5E00B 5GHWH 2D03L 3LQMA 1XGPA 5MI0B 2A77L 2IBZY 3FQXB 1Z3GL 1KPRB 4PLKD 1OGTB 1BF8A 1I7RA 2V7HA 2XKNB 3OGCA 5DYOA 5D1QA 4XI5C 2CLVB 4LLDB 1IJ9A 4BK5A 4EDWH 1T21B 3JZ7A 4OQTH 3P73B 2H8PB 4PJBF 3FRUA 2H6PA 1KB9K 2R0LL 4G3YH 3F12A 3Q5OA 4ZOCA 5D1ZA 5HPMB 4GMSH 2AI0L 3O2WL 1UWGH 2QTEA 4BM7A 4CUCA 4F2MA 1OD9A 1S7RB 1YEKL 2AKRA 2EIBA 3HZVA 4IMKA 1Q1JH 2YRLA 4NQVB 2IPKA 5BVJA 1UH4A 2APFA 1A9EA 5GS1B 3PWNA 5BJTB 3VXRD 5TE6L 5FM5O 5LAXA 1XCQA 3MFFA 2G2RB 1PYWA 4CGTA 4Y1AE 5JIIA 1FP5A 4KZEH 1HCVA 3S36L 3ZKXB 4AIZB 4WWID 1IRAY 1G6RL 3P2TA 5HVHB 4IRSD 3BGAA 4WW2A 4Y4KC 2R2EA 3MRKA 3OKLB 4EVNB 5IVXF 2P44B 5DK0B 1MH5A 1RPQA 4OKDA 1IGIH 2GIYA 5BV7L 1JUFA 4HK3N 1UM4L 4HFWA 1OOAA 1NBQA 1K85A 4P49A 3RPIA 2V6HA 1FNLA 4P23A 1EO8L 4GLRH 2AAVA 1G6VK 2CQVA 4HXAL 3BT2L 3KLHD 1AGCA 1JPTL 4GW4A 4NWUL 3C6SA 3RUGA 3SJVB 4FA8A 5L6YH 5I8OL 5L2KD 5IROC 3EJJX 2ITDB 1LNUB 3V6ZA 4DFHA 5D1QD 5D1XB 2VZUA 4Z7VB 2HAZA 5IB2A 4N8VB 4NUGH 1X5AA 4ZSOA 2NY3B 3BP6A 4KK5C 3NIDF 4IDJH 4X99A 3MRIA 1XGUA 4YIQB 2F58H 4XVTL 4OZGF 4XBEH 2VAAB 1A6WH 5T3XH 1N5AA 1AY1H 3NN8A 2BOCB 5MEQA 3L3DA 1ZLSH 3GSXA 5SWSB 1HHHA 4U1LA 5B38G 5JHDB 4D0DB 1CE1L 5ESQA 5HI4D 1JHLH 2LTQC 1D9KC 3MV8D 2VUOA 1TFHA 1XGYL 1C7TA 2R69H 3Q3GA 4TTGA 4GW5A 5C0EA 3FO9B 4POUB 4LSDA 1HOCA 5C7XH 1YEJH 2GITB 5CEYB 1HHIB 4IMLB 4J3UA 1RURH 1J1PL 4XNUH 3PWVA 1NEUA 4DKAA 4V1DE 3GSQB 1FLTX 2Q76A 1BJ1J 1ZMYA 1IAIH 3WE6B 2LU4A 4Z7WE 5I66B 3STZB 1RHHA 1MF2L 5C0DB 1LQVA 4C59B 2HLFC 2BNRA 4LGRB 5EUOF 3I75B 4ZAKD 1TCMA 1NEZB 1J88A 5C0AE 3UZQA 5E9DA 1OGTA 3QDJB 5AAWA 1HIMH 2XKNA 4MXWH 4OB5H 5JIHA 5EU6B 4BZYA 2CIKB 2CRMA 4MXVF 4DKFH 2CLVA 2A6IA 3DXAA 4LLDA 3WD5L 1T21A 3JWNC 4LRIC 4YPGA 3C8DA 4EKXA 3P73A 2H8PA 3DECA 2XKSA 3P0YL 4M3JA 3SE9H 2DQTH 4YHIB 5F6IB 3TF7A 2RB8A 3H9SB 4UDTA 5ALCH 3GSUA 4UT7H 3R1GL 4FOMA 4HPYL 4FQLH 1Y18B 1MFBL 1KXQE 1S7RA 4NQVA 3U9PL 3LQZA 1O5DT 2ZCHH 5GS1A 1WT5A 1X4XA 3SDCB 5DT1H 4AK1A 4JHWL 4HWUA 1C08B 5T1KD 3TM6A 3SKOA 5LCVL 5DMGC 4WY7L 2ADFL 3DVGB 3EFDH 3RAJH 1QA9A 1XMWA 3MMEB 1WIUA 5H2BB 1FZJB 1J10A 4AIZA 4I3SH 1YN7B 3CVHL 4KROD 1FNHA 3WFDH 2IH1B 1DBAH 7FABH 1CG9A 1ZKAA 4X8XA 4ZUUB 1ZVHA 4EVNA 2ILLA 1OAUH 4UU9B 4CW1B 3HA0A 5DK0A 3GDBA 4YHOH 1BFSA 4U1GB 1Y6NR 3CXHJ 1TPXB 3LH2L 5HD8D 4AL8H 5CHNB 4Z7OE 3GJFB 3CU7A 1VFAB 5DD5H 4ONGH 2AS5M 5D7KE 3HI6H 1KSRA 4IS6B 5JXAL 5JOEA 1T03L 1NSNL 5E9DD 2ITDA 1LNUA 5FOJA 1T89A 3S88H 4FFEX 3HAEA 4NO0A 4OGAD 5D1XA 4Z7VA 5GS0D 1JNHB 1TVHB 4YJZL 2VNCA 4F7MB 5DJ8B 1NMCB 4YIQA 1WQVT 1A5FH 2FEDC 3DBXB 3JTTA 2J8UB 1NAML 3MJ7B 1VGEL 5SWSA 1FFRA 3LS4L 2HFEA 5GRYA 2BRQA 2JIXD 5IVZB 5JHDA 5CFHA 3TBTB 1QSEB 4KMQA 1TLKA 3TNNB 4DW2H 5A16B 3QHFH 5B38B 4FTVB 4C56B 5EZOH 1LO0H 1YMMD 2A1WH 4XMLL 3VGGA 3V5KB 5CBAB 3QFJD 3FO9A 2HKFL 1F4WH 2FB4L 4TULL 3FQUA 1REIA 3D85D 1I8KB 3DPBA 2R4RH 2EH8H 1HHIA 1J5OL 4IMLA 1FLRH 2Y5TA 3UP1A 4L29B 5DURD 1OLZA 3UTPE 4HWEL 3ARBC 1BFOB 5KVMC 4KTDL 3GSQA 4QTIL 2EYSB 4OZIB 2BY1A 4LLAA 5ACZB 2Q8BL 5IGXH 4QHLB 1CBVL 3LMJH 1MEXH 3TZVB 3PXHA 2X1PA 3TEUA 5I66A 3DX6B 1KJ2B 2CKBB 3FMGL 4OCNC 3A0OA 4JFYB 3FOLB 4ENEC 4JFZH 2B1HL 1CN4A 3DUHA 2WY3A 3I75A 4XVSH 5E08L 2AXFA 1NEZA 4X4MA 3MODL 5FO8B 4Y16D 3SDDB 3WNKA 3S35X 3QDJA 3FO1A 3VWKB 2GSGB 5HXMA 5EU6A 5GRJL 5EG6C 2CIKA 4HS3B 4ZFZA 3BPNB 5F7LB 1NCCL 2EDRA 3LN9A 1A7OH 3E3QA 3QCUL 2AV1B 5CJXC 2HG5B 1CLOH 3U4EB 4NO0D 3PGFL 4HFUH 3HI1A 4MA7L 2Y6SD 4YHIA 5DJCB 3H9SA 5K9OB 4U3HA 1IBGL 4HUKB 4U6VH 4CU8A 5T5FH 4HLZH 1FNEB 5EB9A 1U8QA 5EO9B 5J13C 4FQQB 4S1DC 5FM8A 3GI8H 3KNBB 5KSAB 3H3PH 4O58H 2YOCA 3VD5A 2IANB 1CLZH 2QADC 4XI5D 4L4VE 3VD4A 4HPOL 3BWUC 3BUTA 4KI5D 4CVWA 2EO9A 3OL2A 5GRUL 3UBXI 4KQ3L 4DN4H 3DVGA 3ARDC 1CFTB 2Q8AH 3MMEA 2BXZA 4LVHB 5H2BA 1FZJA 3C2AL 4BZ2H 2YBRA 3KXFB 5JO5B 3RBSA 1JF5A 3ECBB 1MCBA 1WZ1H 5D71L 4XP6H 3EDKA 1U8HA 4EN3A 4ZUUA 3OF6A 4ELKB 2DIBA 4UU9A 4CW1A 4Z8FH 1Q9KB 1FZMB 3RX8A 1QSVA 4LLUA 3TIDA 1WZKA 4DN3H 5IJVB 2HT3C 2HH0H 5CHNA 4JKMA 4NOFA 1TIUA 4X0KA 5D7LD 1VFAA 5IFJB 4HBQA 4PY8I 3V6OC 3MBXL 2Z8WC 3OB0H 4IS6A 4Z7WF 1IGJB 2YSSB 2X05A 3PNWB 5MEPB 2KBGA 5KZCB 1JZ2A 3I02B 5CGYC 3HC3L 2ORBH 1AFVL 4GKNA 2APWA 1CXLA 1BM3L 4LSPH 3RX5A 2ZG3A 3ISWA 4ORZC 1TVHA 1ZLUH 2R0KH 5K9JL 3UTSE 4F7MA 1I1FA 5JW4R 1G7QB 4HCRA 1L4IA 4XXCC 5AYUH 1BZ9B 1ZGLP 5F6HI 3DBXA 5F7UA 3D48R 3MJ7A 5KSUA 5IVZA 1R3KB 4UV4H 4OUUB 3FN0H 1DBML 3TBTA 3BP4B 1QSEA 3I6LD 3TNNA 4GXUN 5B38A 3PV7A 4ZYKB 4FTVA 4YH6A 4MNQD 5CMAB 4RGMB 1ZA3B 2ESVD 5CBAA 3V5KA 1OCWH 3LSOB 1CDBA 2CDFA 3C6LD 1IGFL 5KSBB 4PGZA 2DDQH 5BZWB 5D6DA 5CINH 3EOAB 5C0RL 3NFPB 1I8KA 3VXRE 1T3FA 4TPRL 2EICA 4L29A 5F97E 2Y4SA 3NZ8B 1VHPA 1BFOA 1UYWL 4IOIB 2EYSA 3ARGC 4OZIA 5ACZA 4HG4J 1FAKT 4QHLA 1G84A 3GBLA 3BX7C 1JJUA 4K7PH 3TZVA 1FG9C 5LGKA 5DHXB 4OT1L 4M02A 2CKBA 1S7WB 3V4VH 4EN3D 1G7IB 3K2MC 4JFYA 5HSFA 3FOLA 3QIWB 4L9LA 5E5RB 3V9FA 4GBXC 4LIQH 4PS4L 1OP5H 5F88A 5ISZD 4P2YA 5EORL 3SDDA 2N4IA 4JN1L 4YFLI 1NGWB 3EO9L 1U95B 1NFKA 4G6KH 4HS3A 1LK2B 2A0LC 2X7LB 3BP7B 1RVFH 2AV1A 1J0IA 3MLUH 4B7IA 3B9DA 5GISL 4S0TD 1NL0H 4L4JA 3P9LA 5D6CB 1DANU 2F8VA 1N4XL 2D7PA 2HG5A 2ZZUT 4IOFC 3L3HB 1NLDH 4Z7OF 1CL7I 3U4EA 1UM5H 4MXQD 3FB8B 5L2KE 5F9OH 1EJOL 1PQZB 5K9OA 3BRDA 1I9IL 3ZT6A 1FNEA 4G6AD 5EO9A 5AZEL 4FQQA 4KKLC 3CLFH 3H0TA 4GS7B 1OWWA 3KNBA 4YDLC 1GSMA 5KSAA 3MLVL 2IAMC 3AS0A 5ITFB 4X6DE 2BSED 1AKJB 2V7NB 3KR3L 5IW6B 3GMNB 3W0WD 5BS0A 3C60A 2EXYC 3RVVC 2DD8H 2IQ9H 3ZSTA 4HIXL 5CILL 5L9DH 3MV8E 1CFTA 1WITA 2GT9B 3WIIH 1I1AC 3IU4H 3KXFA 5JO5A 3TO4B 2NY2D 4LPWA 4FQPA 3LKSB 3P4MA 3ECBA 5ICZB 4PJHB 1M6OA 2OL3B 4KHXL 2PO6B 1SEQH 4O2EB 1JF1B 4ELKA 3HC4H 1EEZA 2PN5A 3SE4C 4XNQB 2W9LA 5F3HB 3S9DB 4XAKE 3B6SB 4XBGB 4H20L 4ZUTA 2EIDA 3VW3H 5IJVA 1CIUA 2R29L 3QCTH 5DMGD 1QR1B 5IB5B 3MX0A 4OI8A 3QNZB 2ED9A 1KCLA 4QRRA 2AQ1A 4CKVX 4OKVB 3WN5C 2FL5A 1KOAA 3PNWA 5MEPA 1Q8MA 1PG7L 3BJLA 1LGVA 1FE8L 2V2XB 3O8XD 3WV0A 4WW1B 4N0CA 1H0DB 3SE3C 3LQAL 2MMXA 2HTLD 1S8DB 2R0WH 5JA9A 1JL8A 3HE7C 2OZ4H 3M1BA 1BZ9A 3BPCB 1Z6JT 1OAXL 4X98B 1KBGL 5FDWB 4OZHA 1EHAA 4NM8L 5DEFA 5IBLD 4WFFE 1R3KA 3RZCC 4OUUA 3TFKA 1FFNB 3BP4A 2CR6A 2YMXH 1WJ3A 1SQ2N 3B2UD 4FQXB 5CMAA 3WIHA 1KPVA 1X6NA 2Y9RT 3CVIL 1AIFB 1T2QH 3LSOA 5F1OB 4L3CA 4MA1B 5KSBA 1HYSD 3FN9A 5BZWA 1NPUA 3RKPA 5BS0D 1ZEAH 3C60D 4M1CD 3NABL 3NFPA 2HJLA 4HIHB 4HAGA 3BUYB 4O9HH 4P2OC 5DEZA 1J0ZA 3IFNH 5L2JB 2HA1A 4APQC 1B90A 4PV9B 1HNFA 3C8KB 2MNUA 1ZGLB 3TBVB 1MJUH 3P4LA 5F7YC 1N0XL 4LMQI 2XI9A 4N1EA 1C8PA 1S7WA 4G9FD 1G7IA 2VISB 3GMPB 4XP1H 3QIWA 3X3GH 3IDNB 5D8JH 1Y6KR 3KPPA 5DJXB 3E2HB 4OLWL 2VDPH 3O6FC 2OK0H 4OM0L 1NGWA 5D7IB 1U95A 1J0KA 4HSQA 5F1KC 5BMFL 1LK2A 3CDFA 4P4KC 4XPTL 2DKSA 2X7LA 3BP7A 3V95A 2DQHH 5C0BB 4ZO7A 3RIAF 5D6CA 1F42A 1M05B 2V5RA 4ZS6C 5D93B 3FAXA 3L3HA 2W07A 4MJIB 3VWJB 4K8RH 12E8H 1X5KA 3FB8A 5EC2B 1OB1B 4YX2L 4PJ7B 3SPVA 1PQZA 3MRQB 3PWLA 4M4RA 4YDIH 2DQDL 5FOBB 1KCSL 3QUXC 1BIIA 4KAQH 2FD6L 4LCWD 1C5DB 4LVNB 3IFLL 3KWWB 5ITFA 3NOIA 1AKJA 3UTTA 3TJHD 3ARFC 1UB5B 5IW6A 3ULVC 3GMNA 4JPVL 1OWRM 3S4SB 2AEPH 3VXPB 3BSZH 4J4PC 3ILQC 1F8TH 3U0WH 5KVEH 2G5RA 4LSVH 1A1MB 3RWJB 2YR3A 3L5IA 1P2CA 4QYOA 1OD7A 3QFJE 3DX8B 3WNPA 3TO4A 3VXOA 3C9NB 4LCUA 5GRZA 5ICZA 4PJHA 4S1DD 3PQYA 4WFED 3GSVB 4N90D 1CR9H 4RMWA 2Z31B 2PO6A 8CGTA 1KEML 1JF1A 2QSCL 5DFVC 4AIOA 1FRGL 3F8UB 4HJGA 3EJYD 5F3HA 3G08B 3B6SA 4XBGA 3L7EA 1QFUH 5INDA 1QR1A 5IB5A 4WV1C 1UEMA 3QNZA 1VCAA 2EDQA 5JOFB 2EH7H 2CRZA 4OKVA 4PLJC 4GG6E 4HX1B 3PL6B 3PGCA 4QOKD 3QDAA 5F21B 2V2XA 4Y19B 5DLML 1E4XL 1T1YA 3MZTA 3WBDA 1H0DA 4RFOH 4GLRI 3LV3B 3T8XA 3GSWB 1S8DA 4LLWB 3C87A 3S37X 4KJQD 1FVEA 5DK2B 4OFYA 3BPCA 3MNVA 5F70A 3ZO0A 2WLYA 5FDWA 4MS8A 4MWFB 1MIEL 3MUJA 4POZD 5FYLH 3QRFM 1FNGA 4LU5L 5LQBL 2RBLA 4PFEA 4F57H 3LEVL 3RL1B 2WANA 1B0WA 4FQXA 4IRZH 1QLFA 2F19H 4CMMA 4NCC1 1AIFA 3DTXB 4OCYH 3BP5B 3RTQC 3HB3D 5ID1B 4TSAL 3QDGD 1A1NB 4PJ8C 4TSBH 4M5ZL 4HIHA 4XPGH 3HR6A 3VGAB 3GKWL 3BUYA 1P7QD 4S1SH 2XACC 1JYWA 4X6DF 4C55A 4R9HA 4KI5E 4IMKC 3A6BH 3VG0L 3IVKA 5JUEH 4J3XA 4M7LL 1A3LH 4PBVC 1LDPH 3B83A 5KTEL 4PV9A 3C8KA 1RJZB 1ZGLA 4Y5YB 1BAFL 1ED3B 5KBNC 3TWCL 3PQYD 1OPGH 3IDNA 4DOHE 2EDHA 2FECL 3EDEA 2YUVA 4JG0H 3EHBC 3H8NA 3E2HA 1ZHBB 5C09B 4IRJB 4I4WB 5A3IC 4QEGA 1ODAA 2IH3B 5D7IA 4Z0BL 5E6ZA 1MI5D 3HE6B 3JWOL 1GIGH 2CD0A 4TUOB 4L8SC 5AZ2H 5D7LE 5C0BA 1RAMA 1M05A 1JGUL 3EYFB 4MJIA 1MOEA 1MCPH 3TH2T 4P2CG 4CRPA 1AXTL 1OB1A 5EC2A 4PJ7A 3U0PB 2BVOB 2BVUA 3P11L 3MRQA 5DHYB 2H45A 3ZHLA 1KG0A 3O6ML 4PJFB 4J3TA 1HH6A 4P23C 3FHAA 1U8JB 3OMZA 3GSRB 4MQXD 1C5DA 4M48L 2EZ0D 4TRPL 2WIIB 4E41D 3KWWA 4MS8D 4N0YL 1I9RH 3REVB 3CXDH 1H3XA 1XAUA 5D96C 5I1KL 4LSTL 5GSRA 4NQEB 4DTGL 1UT9A 1YNLL 3DETC 4NCC2 1VERA 2GHWB 2V5TA 2PYEB 4S1QL 1QPPA 2WAHA 1A1MA 1E28B 1W0WB 3AREA 3RWJA 4MNQE 4XMPL 4UTBL 4LOUD 4QXGL 1PY9A 2ESVE 3DUUA 3TIEB 5I8CB 5IQ7L 3DX8A 1O7VA 5TDNB 2ADGB 3OSKA 3QEHB 5FGCE 5AG8A 1RFDH 2DM3A 4XCYB 1AC0A 4JO1H 4DZBA 5I1JH 4PJAB 2HMIC 2GK2A 4XAWL 3G08A 1Q0XL 5K9QI 1U8OB 2MSPA 1MLBA 3OHXB 1CDYA 1A02N 4RBPK 1JMZA 3D3VE 4WTZG 1JWSB 5JOFA 2CRYA 5HGBB 3FQWB 2OJEA 4HX1A 3PL6A 5F6HJ 5ISZE 1DL7L 4XPAL 2P8PB 3REWB 3WFZA 4KV5E 1FORH 4XXDB 3OJVC 1ZHNB 3LV3A 4BQ8A 3GSWA 3QUYD 4YHNB 2V9QA 4LLWA 2M8XA 5DK2A 4PJEB 5HHPB 3HC0B 5MI0C 4KTYA 5IOPB 1HZHH 4MWFA 5ICXB 2ZG1A 3BDYL 4HKJB 5C07A 1QLEL 4R8WH 3GHBH 3RL1A 2ZOLB 2ZUVA 2PYFA 1X7QB 5E8EA 3DTXA 3DWTA 4QHMB 4Y5XB 3BP5A 2AK1H 4HWBL 5ID1A 1A1NA 1J0JA 2AXGA 1MVUB 1J8HB 3W0WE 3AFLA 1DBKH 4ZO6A 3MJ8B 2J7LA 1LDSA 1EA9C 1OHQA 4GMTH 3ARED 2YD4A 3OJDB 3BN3B 4Y88A 1SJHB 5EOTB 2VDQL 1TNMA 1NC2A 3KPQB 4YQXH 1BIHA 6CGTA 5J6GB 1RJZA 1WT5C 5GS1C 4Y5YA 3MA7A 1WAAE 3MRRB 1ED3A 4UIKL 2DYPB 4BFBD 4I9WD 4UTAH 1J0YA 4WHDA 2Y06L 2VXTL 2OI9B 4I2XE 3OJMB 2XRAL 2LQRA 3O4LB 3SDXA 3KHQA 1ZHBA 2D4DA 3MBEB 4W70A 4IRJA 2JK5B 4I4WA 5GZOD 2PUQT 3HMWL 3ZKXC 3D25A 3MOAH 2IH3A 1JTOA 5CJQH 1G9NC 2PNDA 4FQ2H 2FEEI 3ARTA 4OFVA 5HVHC 1ZVSB 5FUZH 5I2IB 4MMXC 4PJXE 4TUOA 3BKCH 1RSFA 5GGTH 4HH9A 4ODVH 5ADOH 3U0PA 3SKJH 1PSKL 5DHYA 1YMHB 3KYKH 4Y0GA 1MCOH 5E4EB 1RY7B 2DQCL 2GYSA 2ZPKL 3QPXH 1KFAH 4OFKA 5DA4A 5D2NA 4OCRL 4GG6F 5FYKL 1DUYA 3EJZD 1U8JA 5T1LD 3GSRA 3OAYH 3D0VB 2DF3A 3CFKB 2WUBL 2EIZA 2WIIA 4R26H 4U31A 2MCPH 4YXLL 1NGZB 3REVA 2VLRA 1T89C 1DVFD 1H8SA 2AJVL 2YD8A 3KPSA 4NO2B 4OLUL 5C07D 2PXYD 3RI5F 4DAGL 5D1XC 5C0FB 1MFDH 2JB5H 3IAPA 2G9HA 1CICD 2ITCB 2L7JA 1YEGH 1XR8B 5GRVL 4NYLB 2NY3C 3TGXA 2PYEA 4YHZH 4EUPG 5EZJA 1E28A 3VA2C 3BGFB 4YDVB 5I8CA 4RSVA 3TIEA 3FT4B 3O3BB 3QUXD 3G6AB 5TDNA 2FATH 3T3PE 4LLQB 2ADGA 3QEHA 4XCCL 4NBZB 4XCYA 1YEDB 3N1PC 1A7NH 1DDHA 2VZ1A 3BZFB 1LO4H 4XCFH 4PJAA 1NC2D 5FUCC 1P84K 3HLAB 1U8OA 4TTDC 4HWNA 4KI5F 3OHXA 2QR0B 4PJGB 1PKQE 1JWSA 5DD3L 4D9RD 2DLTA 5IT2L 2BRRH 2AJSH 4X83A 1A3RL 1EMTL 5HGBA 3FQWA 3K46A 2NY4B 5DQDL 2P8PA 1IKFL 1IGCH 3P0VL 4M6NL 3REWA 4DKEL 4ELME 5F89B 4Q9QH 3UZVB 4P2RA 4YFEA 1MJ8H 4GG8B 1ZHNA 1RZJH 1TETL 5EN2B 3SHSA 2J8OA 4NKIH 5T3ZH 4YHNA 4WO4B 2CDGA 3BQUB 4BFGA 3F5WA 1KN2L 3P4NB 4PJEA 3HC0A 3H7BB 4JM2A 5IOPA 4Q9RL 1CDJA 1ZXQA 5I75B 5HDBE 2DI8A 4HKJA 1CXEA 5AUMB 4NQCD 5MENB 4OQTA 5CKAA 4WWKB 1P4IL 4JZNB 3E3QC 2R9HC 4LCWE 3EFFB 4OJFL 1X7QA 1ZHKA 5IG7B 4BQ9A 4JO2H 3B9EA 4MJ4A 4QHMA 3KPSD 4HLZG 5F6IC 3QUZB 3RGVB 1TQBB 4U2ZA 3WSQH 1SY6A 4KRMB 1J8HA 2VC2H 1JV5B 3MJ8A 1XH3A 1SVZA 1ULVA 2IPUG 3V7AE 4OGXL 1KCVL 2E7LE 1SJHA 3IFOB 1V3LA 4WIQA 5EOTA 4P9HH 3BH8B 4HC1L 1A6UH 3SDCC 3MRRA 4GRLD 4J6RH 5E2WL 2RGSA 4JKPH 4N5EA 4FRWA 2OI9A 4WFEE 4X6EB 4N90E 3RTQD 4GT7A 1ZT1B 5CP7B 3ULUH 3CDYA 4JFFB 1QSFD 5EA0H 3MBEA 1KELL 5C08D 2JK5A 1P5UA 1RIVL 4NKDB 1G9NL 3TA3D 1NAKH 5TDPB 1TVBB 3WNMA 2NY7L 4YWGH 2G5BB 2JTDA 1ZVSA 4HGWB 5C0CD 5DVKA 5I2IA 1OAKL 1JFQL 1MFCH 2ZCKL 3S3JA 2CK2A 1RQ5A 4XT1C 5BO1L 2B5IB 4M9PA 4U1GC 1A0QH 1TPXC 2D2OA 3F7YA 4QOKE 3ZTNL 1MHHB 4V2CB 1RU9H 5CBEB 1ZLWK 3B3IB 2YZ1A 3RFZC 3F58H 4RA3A 4KDTA 3OTTA 3EHBD 3D0VA 4KV5F 1OM3L 4J8RB 1YQ2A 2L7UA 4MB5A 1DSFH 1BQLH 3DHJA 4NO2A 5DQ9A 5ADPL 1A7QH 5GGQL 5SWZA 1I3GH 2ITCA 2APTA 2B39A 4OLYH 4NYLA 1I8LA 1DJSA 2WIMA 1KN4L 1OQOA 4YXHH 2NY6B 1NMCC 1ORQB 1PKOA 1XT5A 4YDVA 3MUHL 3GIVB 3NMEA 3FT4A 3N85H 3O3BA 3I50H 1QLRB 4LLQA 5HDQH 4DCQB 1DBJH 3OKNB 2AJXL 4I18B 1QFWH 1M1SA 1YEDA 1KV3A 3BZFA 4XVJH 4F9LC 1W8OA 4R4NC 4TQEL 1MUJB 5J9PB 5DC9B 3Q6GH 4WHYH 4KGJA 1F45A 4RWYH 2QQQA 3HLAA 4HJJL 3T2NL 2A9ML 3KHOA 3BWAB 2X6MA 3S5LG 3EKCA 1A7PH 1AE6L 4ZTOL 1MHCB 2CJUH 2EDFA 1H3UA 4M8QB 5SWQB 3LKRB 1D5ZB 3X13A 4WTZA 1MVFA 2IBBA 2F74A 3M07A 3SKUD 1WAAF 3STBA 4Z7UB 2CUIA 1FFPA 3BMWA 3TZVC 3MRJA 2IGFH 1BEYH 5F89A 3DV6B 3RP1A 5IJKA 2B0SL 4N1HB 1MI5E 4HUVB 4GAJL 4LHUB 2EE6A 1H15B 4LCYA 1OAQH 4U3CA 1EDQA 3ZKMC 5ICYA 3P4NA 4P9MH 3H7BA 3PDDA 1QO3A 4AMKH 3SDDC 3O6LL 4HKZB 1ZE3C 3VWKC 1MCDA 4PJXF 1MRDH 5K9KB 4YO0A 5BCAA 5AUMA 2NXYB 3BPNC 5MENA 4WWKA 5I1HL 1KEGH 4JZNA 1MPAH 3EFFA 3C09B 3VXMA 2KL6A 5T33H 5IG7A 3UJJL 5D5MB 1B6DA 3MGOB 3X11B 1L7TL 4KHTL 3ZYIA 4E41E 3IFPB 1T04B 1AHWB 5B22A 3HUJB 1EZVY 3EYOB 3QUZA 1MY7A 4X9GA 3VRLE 5SWZD 4R0LB 2AP2A 3T4YB 4P2QE 1EK3A 4XMKH 2F9BT 2D7TL 2WSKA 1LHZA 1KIQA 1JV5A 4TUKH 4CL7A 4RGND 2CDEB 5KSAC 3U4BH 3IFOA 3K8LA 4KJWD 1LP9B 1N6QL 1IL1B 5EULV 1Q9LB 1UENA 1WC7B 4HULB 2DQGH 3SDAD 4OLXH 2RCSL 35C8H 3HS0B 43C9B 3T3PF 5IHBA 5CP7A 4UQ2B 3G6DL 4JFEA 3IDMA 4JFFA 4M1DL 4ZG1A 4LVHC 25C8L 1WFTA 2GY7B 3CFBB 4UDUB 4NKDA 4G8GD 5TDPA 3MNWB 2G5BA 4HGWA 4PUBL 3ZHDA 1HXYB 2Y36L 2D7MA 3NCCB 4HKBA 2UWEB 3D9AL 5F9DC 4PB9H 5J06A 4OCSH 2J88H 4NM4H 4QRPB 2CMRL 2C1PA 1Q9OB 1TCRB 2YKLH 4MA3B 4RAVB 5CBEA 1IM3A 3B3IA 5B4MC 1PAMA 3BXNB 3TYGH 5M94B 3WJJA 1NUDA 4OIIL 2YD2A 4NWTH 3PIQA 5FGRA 3IDXH 1Z5LB 4FQIL 4ELMF 1BOGB 4J8RA 3UEZA 2YPKB 4G43B 2P47B 3I3EA 4OM1H 2XZCL 1NUNB 1JN6B 2C26A 3UJTL 4MJ5B 4N0CC 2YA1A 2KH2B 3N0PB 3QB7C 1NBZB 3SBWA 3R0MA 3VXMD 2FLBT 5B3NA 3DUSB 1A3QA 1GH7A 3BIKB 1ORQA 5ESVB 1ES0B 4S1RL 5I17A 5D2LB 3W82A 1GC1H 4AENB 2X40A 4EUPA 2VXSL 3GIVA 1QLRA 3MACH 2FX9L 4PG2A 4DCQA 3MJ9L 4QTHA 4WEUD 1I4FB 1K3IA 3OKNA 4CN6A 1LD9A 4I18A 3TFKC 2MKWA 1MUJA 5EBMB 4NIKB 3IS0X 4LARH 4RGMC 1BQUA 4R4BB 1QBLL 1K8DB 4XPHH 5I18L 1JZ5A 4HF5H 3MA9L 3S5LB 1MHCA 4Z77A 4M8QA 1S7QB 2ZSWB 5DRWB 4PJDA 5SWQA 3V4PL 3LKRA 4YGVA 4I9WE 1FL6B 1MCWW 4JHAL 5T1DL 2Q6WB 3HZMB 4CMHB 2YUXA 1RUAH 1KJ2L 4HD9A 4P5MB 4HG4K 3KGRA 3H42H 2R1WB 4HUVA 3QIWC 1H15A 3WO4B 5HGHB 1UACL 3GI9L 1N2RB 1QR4A 2AJZB 4FXLA 2O5ZH 1YYML 4U6TA 1EGJH 1XF4B 1KYOK 4F15B 4QNPE 5K9KA 4NDMA 2HWZL 4DEPB 1FDLL 2X89D 2C7UA 4D0CB 2DS4A 1Q0YL 1H3VA 4H8WC 5D5MA 3MGOA 3QNYB 3X11A 4D2NA 1T04A 1AHWA 3DVNB 1XF5B 4KKBD 5T1MB 5E0QA 3HUJA 5DJ2B 1YECH 2AJUL 1YEEH 4M3KB 4D8PA 5FYJD 1UKQA 4LSRH 3ERYA 3EOTL 4Q2ZB 2V2TB 2G60H 4GS7C 3AS1A 4NN5B 3I85A 5E4IA 4ACPA 2CDEA 4F58H 4KTEH 5ANMB 1LP9A 1M7DB 1RMFL 2J1KA 1T7YA 4I0PD 1IL1A 4TSCL 3GZKA 2BNQE 1Q9LA 1NJ9B 1U3ZA 1CD8A 1VACB 4YUEH 4MNGB 5F7HA 1KCRL 1C12B 5L8LB 3HS0A 3JBG7 2X10A 4HXBH 1ZLUK 43C9A 3M8OL 4UQ2A 3IDYB 2F8XC 3CFBA 3O81A 4MDJB 3TO4C 1KTDA 5BRZE 5TFSL 3MNWA 4J3VA 3MRFB 5IBTH 4P48A 3MLTB 5JW4M 1E4WH 3PHOB 3LEXA 3TPUA 4D9RE 3CMOH 2PO6C 1T22B 4XTRD 3TN0D 2AVGA 4CJ1A 3SGDI 2AABH 2UWEA 2E7BA 3SGEI 1NBVH 4C4KT 3L9RB 4GAGL 1KJ3L 1KIRB 2J4WL 3L3IA 1TCRA 4IBLT 4F7EB 3UBXG 5EBLA 4RFEB 5DMJB 4J1UA 5I0DA 2VZOA 3V0WH 2OSLB 4MJ6A 1Z5LA 4JRXE 3BDBA 1BOGA 1IKNA 2RFXB 4NKMB 2I60L 4G43A 2OYPA 1JN6A 4OSUL 1E27A 3W9EB 1DQMH 1UXWB 3IDUA 3I9GH 3S36X 2V2WA 1NBZA 4PJ5B 4W81A 4NQCE 3DUSA 1NC4D 3BIKA 1AJ7L 5ESVA 3CLEH 4M43H 2VXQH 5D2LA 4GJTB 4TUJA 1T0NB 1UM6L 3BZ4B 4EI5B 3T0AA 2ZUWA 1I4FA 4FABL 2H1PL 5J6HA 1CU4H 4K3DL 3PP3H 3HPLA 4N0UB 4FQXC 2ICEB 5EBMA 3VRLF 1FIGH 2VN4A 5TE4H 5KW9L 3D1MC 2UZIH 3MCLL 1MJ7H 1IEHA 3WFCL 1K8DA 4KKNA 4MA1C 4U1KB 1F3DJ 3RY6C 1D5IL 4NZJA 1JK8B 1I7ZB 3UAJC 3S5LA 5IFAH 4WUKH 2ZSWA 2PW2A 5DRWA 4JCMA 2VH5H 4ZDHB 5DWUL 2P5WB 3VFSB 2W0FB 5J3HC 2Q6WA 3HZMA 1QSFE 5F9WB 4KXZI 3LKNB 3WXWL 5C08E 4P5MA 2H9GB 1O0VA 1RUQH 5D7JB 2R1WA 1FNSH 1Q94B 5C0CE 5HGHA 2W59A 5HJ3B 5DR5L 5EOCH 1AO7B 3E2HC 3QZWB 4G6FB 1WWWX 1YEHH 3SQOH 1X5IA 2XWJB 1MHPH 4G8EB 5LKNA 4WU5A 4LPUA 4LSUL 3CFJB 2XZAL 4S0SD 4OCLC 3MRBB 1GOFA 43CAB 1T1WB 2EXWD 2CUHA 4H8WL 3QP3A 1YJDL 2AV7B 2E9WA 3MJ6A 1ZWIB 1BBDH 5D93C 3QNYA 3VWJC 3O11B 3DVNA 3T0EB 1XF5A 5C3LD 3Q6FB 5DJ2A 3KPRE 1EHNA 2FGWL 4G7VL 5HHOB 4WENB 4X7TB 3T0DA 1P4LB 3EO1A 4Q2ZA 3AMLA 4LVNC 4JQXC 5EWIH 1MRCH 3LS5H 5ITBL 3QG7L 3MXVH 4IJ3B 3VWKD 5ANMA 1II4E 1M7DA 1MIML 1X5JA 2ARWA 2VDOH 3HHRB 4K23L 4DVRH 2FIKA 2ZSVB 4MNGA 2XTJD 1C12A 1X5HA 3VXQA 3D18A 5FEBA 5FYKE 4FQCL 1UWEL 5I30H 3VRJB 4LP5A 1SEBB 4XPFL 2QHRH 4MDJA 4LDLB 4AEIH 1KB5B 5L7XH 1MSPA 2OL3L 3MRFA 5A43C 5C71A 3MLTA 4L5FH 3GSNL 1T83C 2Z31C 2Y5EA 3QDMD 5MP6H 1T22A 4FG6C 1FGVL 1QRNA 4X5WB 2QV2A 4YDJB 1JNJA 4LPXA 3CCHB 1RZFL 2A77H 4Y89A 2E6PA 1PY4A 1Z3GH 2CGRL 2HTKD 4F7EA 2VZ3A 3DJ9A 4PRPB 1QBML 4LKXB 4RFEA 3QIBD 2P5EB 3MGAA 1YNTB 1PEZA 2EEBA 1Y6MR 3VFWB 1M71B 2QQNL 4UBDD 1P5VA 2RFXA 5HGDB 4NKMA 3PL6C 2DWEB 2WM0A 4QHUA 1C16B 3NA9L 4M6OL 2AI0H 4OCWH 1QQDB 3W9EA 1TMCB 3QFDB 2PR4L 2X4NA 4PJ5A 4NO3B 2X5PA 3TVMB 5EOCJ 4QNPF 2Q87A 1YEFL 1T0NA 3RL2B 5TE6H 3TNMB 1IQWL 2LU3A 3BZ4A 3UYRL 4EI5A 3EIFA 1TJHL 1V05A 4NJAL 4KZDH 4Y2DD 2ICEA 3GO1L 1HE7A 2IJ0C 1LEKB 2DI9A 2HT4C 4A2LA 1KB9J 3S34L 4JFDA 4ZUSB 4U1KA 5IQ9B 1JK8A 5GS0H 1G6RH 4D9QE 1AC6A 3VGAC 4PRDA 3CAFA 5KG9A 3AGVA 1GOGA 2P5WA 3QYCA 2W0FA 5EFIB 5J11B 3V52L 2WWMC 1S7XB 1B4JL 5BV7H 1LEIB 4Y5YC 2H9GA 4G8GE 1EO8H 3IDJB 2RJMA 3JVGA 2LAAA 2H3NB 4NRYB 1QBBA 4HXAH 4XGZB 5D7JA 4Z95L 3FFCB 2C4XA 4NWUH 1Q94A 4XP4L 1AO7A 1LILA 3WXVH 3QZWA 5FGBA 3MREB 2XA3A 3RU8L 1SJVA 1F5WA 4IRJC 4G8EA 2Z8RA 2DQEL 1GZQB 2L4OA 4WTWA 1JHTA 1RZIB 4ISVB 5MHSD 1BQHG 1T1WA 3HE6C 3KDMB 3W5NA 3MV9B 3AAZA 4JY6B 1QFPA 2AV7A 4MJ2A 3O41A 1ZWIA 1U36A 2BFVL 4NQDB 3VGHA 5IVXB 3GBML 1PX4A 3MLYL 3OZ9L 3T0EA 3Q6FA 4X7FC 3OWEA 5J57B 3JSSA 3J7HA 1CE1H 3IXAB 4X7TA 1P4LA 3VXSB 2X4SA 5I19L 3WLWC 1JHKH 1ERNA 5E2TL 2B2XH 1TNNA 4K3JL 3A6CL 3AUVA 3GK8L 4MB3A 3T2QA 1H5BB 2ZSVA 3HFMH 3A6OA 3M17B 1NCAL 1J1PH 1U0QA 5FYKU 3SJVE 2FX8L 3VRJA 4JY4A 4KQ4L 4NZRL 3TYFA 3HAEH 3F7VB 4ZFOL 4JQIL 1SEBA 2ZUSA 2B20A 2GCYB 3CFCH 5F7DB 2W0PA 1UA6L 5JXED 1KB5A 2EEDA 4WI7A 4J7RA 4OD1L 5I1CL 4LAQL 4UUJB 2YRPA 1FSKB 3BN9D 3AY4A 1KJVB 5E5UB 3CCHA 3D39B 4CDHA 1KUMA 2JB6B 4UINL 4QRQB 1RZKH 1K6QL 4KJYA 3QSKB 4PRPA 4MSWB 4LKXA 4UT6L 3UBXA 1UH3A 3WD5H 1YNTA 4NFBA 3P0YH 3VFWA 1M71A 3LIZH 3LKOB 4GW1B 4G6JL 4WRLA 4XC1H 3H2WA 5HGDA 1U93B 1C16A 4HGMA 3VXUD 3FOMB 4HPYH 1DQDH 1MCEA 1JPFB 5CZVL 3QFDA 4M6AA 2HVKB 1CL7L 4NO3A 4MA8L 3TVMA 5EUOB 3O9WB 1QPXA 5CZXC 3SEPA 1WFNA 1TJIL 4JM2C 3VI4E 3RL2A 1KC5L 1WF5A 4JHWH 4RWHA 4GKSB 5LCVH 5DC0A 4WFGD 1CGVA 4W68A 4C58B 2VQUA 2VIRA 4S2SA 5LBSH 1AP2B 5GGVL 4D0BA 4U6HB 4RZCB 4U1JB 1LEKA 4OZ4B 4XBPB 4Y5XC 4KKAC 1FL3A 4ZUSA 5IQ9A 1RUML 4KVCL 1EHLH 3CVHH 4P3CH 3N1QC 5D7SL 4YNYB 3RWCB 3F62A 3I3BA 4Q6IA 4UI2A 5EFIA 5KVFL 1UWXK 2JE8A 1S7XA 4MB4A 2JELL 2DQIL 5HHVL 1EBAA 4WCYL 4U7MA 1GGBL 4PRIB 4ONHB 4XGZA 4NRYA 4NC1E 2K9UA 1CK0L 4N5EC 1IAMA 5L8JB 2OI9C 3G5YB 3N9GH 1S7TA 1T03H 1NSNH 3SY0B 3ES6B 3MREA 3ETBF 3MBEC 4BH8A 1MNUL 1GZQA 3L1OH 4ISVA 4OF3A 4JDVB 1F02I 2CLZB 2IFFH 5CSZB 2ZKHL 3KDMA 3MV9A 1EFXD 2DI7A 1YZZA 3QEGH 5IVXA 4EEEA 1LE5A 2QQLL 5DMYA 1NAMH 2UY6A 4LGPB 1VGEH 4F37F 5E4EC 4JJ5B 3IXAA 2VQ1B 5IR1B 1VKXB 3ELAT 3VXSA 4KDTC 4ESKA 2E27L 3VFRB 2O61B 4XMLH 4RMUA 1T66C 2XTLA 1OAZL 1H5BA 3BZDA 5DD6A 1J5OH 5LVEA 5L8KB 4O5LL 3T4AB 3M17A 1FO0A 1RUKH 3PWPD 4F33A 1EEYB 2DQFB 2SEBB 4HWEH 1I8LC 3GGWB 3GMLB 3VWJD 4QTIH 4OZGA 2E7MA 2XIDA 1W0YT 3BIAX 3BGFC 1CBVH 4JRWA 2GCYA 4AEHL 3BRGC 2NX5A 3NACL 1NLBL 3MRGA 2VERN 1XZ0B 4MNHA 1K5NB 1I85A 4KMLB 4UUJA 4WHYG 1RIUL 3W9DB 3QQ3A 1FYTD 5E08H 5GJTL 1KJVA 3RNKA 4X4ZA 3MODH 3D39A 1B9ZA 1L0YA 5I1AB 1EVTC 2J8UE 4N0FB 5GRJH 1AGBB 4QRQA 3BW9A 1NCCH 2DOCA 4MSWA 1R3JB 4PJ9D 4KUZL 1FPTH 4Y4FB 4C56E 2MFNA 4FFZL 4JB9H 3LKOA 4GW1A 2NY4C 1U93A 3PGFH 1ND0A 2PCPB 3HR5B 3RWGB 3DYPA 4U33A 1IBGH 5EZIL 1JPFA 2PKDA 2Z31D 4N68A 5IJKC 2BXYA 4P5KB 4Q9BA 2IC2A 4WO4C 3BQUC 2NY1D 4XNXH 5EUOA 5ACMA 1WCBB 2EDDA 1QBAA 4KUCF 5DRNB 3GIZL 5F72S 2H41A 2GI7A 5HDLA 5I75C 3ZL4H 4EDWL 5HYQB 4HPOH 2DQUH 1I7TA 2CKBH 4BSWB 1U8MB 4GKSA 4WWKC 3BI9X 3LKQB 4KQ3H 3MO1B 4H25A 1HSBB 4XNYL 4GMSL 2A73B 1K2DB 3C2AH 1UWGL 2E9IA 4PRNB 4OZ4A 4RZCA 4Y19D 4OI7A 3QUZC 1E4XI 3RGVC 1Q1JL 1TQBC 1PG7X 4AYFA 2IQAB 4R4FL 1BOYA 4I1NB 4YNYA 3RWCA 5ETUB 2XTJE 5TGBB 3Q1SH 1I9EA 5B39G 5I1GL 4E5XB 1KTRL 4HAFA 5GSVB 2NX5D 5A40E 2APVA 2W0LA 4PRBB 4OUOA 4PRIA 1G9MH 3BO8B 3HZKA 4ONHA 3CK0L 5E6IB 3ZDYE 1HI6B 1A7BA 5M7QA 3G5YA 1PJ9A 3MBXH 3QDME 1W72L 4JG1H 5DDHB 4YDKH 1GRWA 3SY0A 3ES6A 3WS3A 2IANE 1NFIB 1ACZA 4U1HB 1AFVH 2NMSA 4GAFB 1QP1A 2BK8A 4PRHD 3OAZK 3LB6D 1LQSR 4AH2B 2LABA 5CSZA 3CD4A 1KULA 5F96H 3QO0B 5GGTA 3QQ9D 1BQHA 3QXTA 4V3DB 1IM9B 2XN9D 4IDLA 3BFOA 5IKCB 2WW8A 2B5IC 2VLJB 3FZUC 4ODHH 3QEQD 2GJZB 5L6YL 3RVWC 5IR1A 3WJJC 1VKXA 1WTLA 1PVHA 2JCCE 3VFRA 4PJIE 4P5TB 3KYOA 1OF2A 3D2UB 2A2QT 3JV6B 1MQ8A 2EYTA 4FMKA 1IGFH 4UT9H 3VFNB 3NIFE 4IDJL 2J6EL 1F90H 2P48B 1CI5A 2CXKA 4RQQA 3T4AA 5C0AB 1A6WL 5T3XL 1EEYA 2DQFA 2SEBA 3QIUD 1AY1L 3VI4F 3GGWA 3GMLA 2NY6C 5J89A 2V9TA 1JHLL 5JHLH 5IB1A 1LO3L 4L4TD 4PG2C 3IT8D 4LSQH 4B0MM 1XZ0A 4I18C 1P7KB 1HKLH 3D69B 3W9DA 3UDWA 5C7XL 4HUWB 4DUVA 4PBWD 4JN1H 2EKJA 3CDCA 3DSFH 4NQED 4Y4HB 3EO9H 1AGBA 5EC1B 4K3GA 4XNUL 1R3JA 3QEUB 1NKRA 4YHPB 3WIHH 3VFUA 1M7IB 1I8IB 1DANT 2MQ3A 1KLUB 3NIGE 2M1KA 2PCPA 3HR5A 5HVWA 4DFIA 5KS9E 4Y1AA 4G5ZL 2Z92B 3NPSB 5AZEH 5MHSE 4P5KA 5F1NB 3OAUH 5DJ0B 2ENSA 5I6XB 5F8QC 1HIML 4MXWL 4OB5L 1YDPB 3L5WB 4DKFL 1VB9A 1VEMA 3KR3H 5DS8A 2XQBL 4DQOL 2NXYC 2IF7A 3UTOA 4NHUE 2DQTL 4HIXH 5CILH 4XRCB 2EYRB 2P24B 1HSBA 3C09C 4UT7L 4OIAA 3U0TA 4HBCL 4OF8A 2A73A 3FB7A 5ALBH 4Q0XL 2OP4H 4HK3J 3RDTB 1I8MA 4FQLL 1AHWC 1OTUD 1FJ1A 2DMCA 4M5YH 4M61B 5HI3C 4R0LC 4I0KA 5FAAA 5LGJA 3K74B 4OTXL 2HN7B 3V5HB 2IQAA 2FH8A 4QWWC 5ETUA 3PWUB 5TGBA 1OQXA 5DT1L 4WU7B 4NCDA 3IKKA 1BF2A 4H20H 4YBQD 5B39B 5DVNA 1NMBH 4EQ2A 5HI5C 4PRBA 3MRDB 3RNQB 3BEVB 4LLYB 2NXZB 5E1HB 3RAJL 4Z76A 3BO8A 3LEYH 1EERB 1U8NB 1U9KA 5E6IA 1J8KA 1HI6A 1UFUA 1JGDB 2ADIB 3TBYB 2WP3O 3MOBH 4I3SL 2QJDA 5DDHA 1NFIA 3ARRA 1FE8H 1DBAL 4U1HA 2Y72A 7FABL 1DBBH 1U3HB 3O45B 5FV2A 5E94B 3LQAH 2R4SL 4AH2A 4WDIA 2J8UF 1IM9A 4JO4L 5IKCA 4AL8L 1OAXH 2YN3A 2DYPD 3L5HA 5DD5L 4ZS7L 1ZK9A 4ONGL 2HVJB 5KOMC 1YY9D 1PD6A 3HI6L 4V1DA 3VXUE 1K9TA 2GJZA 1X4YA 4RDQF 1FN4A 3PJSB 1X9QA 3QPQC 4TNVF 3S88L 4P5TA 4LLVB 3RKDC 3DMMD 4WI3A 3D2UA 3CVIH 3JV6A 2YEZA 1IKNC 3E6FB 3VFTA 4WHTB 3NABH 5GGSA 5C0AA 5A1AA 4NSKB 3PGDB 4LFHD 1A5FL 5FKAB 4WFGE 4AEFA 4RGOH 2BHYA 2DAVA 2W0KA 4LBEA 4U05A 3QHFL 3O3DB 5HYEA 5BQ7A 1LO0L 1F4YH 2AXHA 2GFBB 4R2GB 1F6LL 4KK9D 1F4WL 3L7FA 4R3SB 3QI9B 1EO5A 1G7MB 4OLWH 2UUDK 2R4RL 4KK8C 1HNGA 4OM0H 1P69B 5EC1A 3INUH 5BMFH 3D5OF 1I3VA 5GGSY 4LASL 5IGXL 1FCGA 1MEXL 1M7IA 1KLUA 2AXJA 1L9MA 2FEEL 3ZDYF 4CMHC 4JFZL 3CZFB 2D0HA 1EAJA 3TV3L 2Z92A 4XVSL 2FD6H 1G0DA 1CQKA 5F1NA 3DROB 2R1YB 4KRLB 3WO4C 5DJ0A 4O4YL 3NFNA 2P49B 1FBIH 2ED8A 1YDPA 3L5WA 2E7HA 4PP1C 5C0ND 3O4OB 4V1DD 4F15C 2IWGA 3BHBB 4LEOA 1CLYH 4DEPC 2DJ4A 1CLOL 4HFUL 4XRCA 3RVUD 5FFLA 5TF1H 1OAYH 2EYRA 2P24A 2P8MB 1XIWA 3IF1B 4I0CC 5T5FL 4R90H 1HK6A 4M9OA 4HJ0C 2JCCF 1OTSC 4PJIF 3GI8L 4JRYD 1G7HB 1URLA 5FV1L 1GGTA 3V5HA 3H3PL 4O58L 3EO0B 3IETB 4U1NB 3PWUA 2QQKH 1CLZL 3PWPE 4NN5C 4NRZB 4PJBE 2IFGA 1NUGA 1GL4B 4GOSA 5E8NB 1Q72H 3NIFF 2ID5A 2B8OT 2Z4QB 3QH3B 1EXUB 1N5YH 2ARJB 4A6YH 4U4BA 2R2CA 3QUML 5B39A 1I3UA 4X9BA 3MRDA 4PGCB 3I84A 3AXLA 3BEVA 2VUYA 4MCZB 2Q8AL 2B4CH 1F00I 1U8NA 1J9CT 5HY9B 1JGDA 2V5MA 5I15L 2ADIA 3WS6C 3LRSB 3TBYA 1GPOL 4GFTB 5D9SB 4PBXA 3IDYC 4MX7B 1BVKB 3MV11 5DLMH 4KY1L 1S78C 4TVPH 5C0JB 1U3HA 5E8PB 2WBJD 3ME0A 5E94A 4HK0B 2VR9A 1NH6A 5I1EL 4Z8FL 3QHTC 1Z9OA 3RVTC 5LGHH 5A2LH 2EDTA 1X5ZA 2C4FU 3VXRB 1SVCP 3VFVB 5AAMA 4ZXBD 1RUPL 5LXGL 4KH2A 1UC6A 2H26B 1DN0B 4LU5H 3SQBA 1OY3B 5LQBH 3NIGF 4G42B 3PJSA 2ORBL 1P4BL 1HDMB 1U58A 5FHAH 4LF3B 2GJ6D 2R0KL 3OKEB 4JANB 5GPRA 4WHTA 4IRSB 4M5ZH 4AEEA 3GKWH 5AYUL 3C08H 5FKAA 4I3RH 4NJ9H 3WDJA 4M62L 3FTGB 4H1LG 4UV4L 1UXSB 3FN0L 5EBWA 5KTEH 2GTWB 1ZTXL 3MTRA 2K1MA 1N59B 4Y19E 1CDUA 2NLJB 5HHMB 1FG2A 1ZANH 3RVWD 5DFTA 1E0OB 4EI5C 5GGRB 3EYQD 1OCWL 2GFBA 3QRGL 1PLGL 5CP3A 3GFUA 4NGHL 5L2KB 4MD0A 4R3SA 3EOYG 1R3HB 2NYYD 2NZ9D 4KFZC 1AI1H 3ARZA 1G7MA 2R0ZH 5CINL 2X70B 5CEZL 5DYOB 5D1QB 3TH4T 3RY4A 1NDMA 3O2VL 5I8KL 3RIAK 2E3VA 3JWOH 3STLB 3ZDXE 1OSZA 5IBUG 4X6DB 1IGML 4RBPH 1EEQA 4K7PL 5JA8B 2JLLA 3GHEL 5D1ZB 2OJZH 3SCMA 1JGUH 2VR5A 1AXTH 3V4VL 4YE4H 1RZGB 3P11H 1F97A 5F9WC 1NCNA 3O6MH 1SM3H 3MV8B 4LIQL 2IPKB 4QXTA 4PRHE 3JVGC 5D7JC 1T7XA 3DROA 4M48H 2R1YA 5DD0H 5JPNB 3B9KD 1WBZA 2IBGA 1HINH 4N0YH 5C2BH 3MFFB 3UTPD 1YUHA 3MLUL 4JKWA 5I1KH 4LSTH 4X80L 3BHBA 3S96B 1PYWB 1NL0L 4DTGH 4U3XA 4ODTH 1NLDL 5FKPB 1UM5L 4S1QH 3K4DA 5F9OL 2ZWLT 2BP3A 2P8MA 4K8RC 1DZBA 3VGFA 4QXGH 5C09E 3IF1A 3T0EC 4LP4A 2FX7L 2VQTA 4WW2B 1G7HA 3ARPA 2I27N 4LHUD 3MRKB 3QQNA 1A1OB 4ZAKB 3EO0A 3IETA 4DZ8B 1MCJA 4U1NA 2JJTA 2J3SA 3O2DL 4NRZA 4XH2B 5E8NA 4HFWB 3VMNA 1A6AB 4TOYH 3CSBA 4IJ3C 4IHOB 4XAWH 1Q0XH 2VABB 1HHJB 2DD8L 2IQ9L 4LCCB 3UTSA 2DBLH 5HHQB 1AGCB 3TT1H 4PJFE 4PGCA 5L9DL 2FJGA 4MCZA 4L4TE 1DQLH 3ZDZE 4FQ1L 1NFDE 1MCLA 3WIIL 2ZUUA 1E6OH 5HY9A 3V6ZB 3LRSA 3IU4L 2H2PD 5D9SA 3N1GC 4E9LA 5IB2B 3NCJH 4XPAH 2Y25A 1BVKA 3SOBL 1NDGB 5C0JA 3VH8G 5E8PA 4QWWD 4NQEE 3MRIB 15C8L 4HK0A 1XGUB 3BD3A 4L4VD 3EYSH 2ATPB 3QG6A 3SCMD 3AY4C 3VW3L 3GSXB 2H32H 1MCNA 3QCTL 4MVBC 3VXRA 3VFVA 2AQ2A 1WFOA 2EDJA 3W5MA 3TC9A 5T1KB 1DN0A 3BDYH 3OG6B 1IT9L 4JFXB 3MLXH 4Y7MA 1BMGA 4G42A 3C5ZD 3WNLA 4GRWE 2XWTB 1MWAL 4MYWB 5HYJD 1CYGA 1HDMA 4G7YH 1MCKA 5HBBA 3G6JE 1YNKH 4HEME 5C8JA 1D7FA 3F7QA 4JANA 2R0WL 1NGQH 4KROB 4FZ8L 5DEGB 5TH2B 2OZ4L 2P1YA 3V7MA 4JR9H 1HHGB 3TVMC 3FTGA 1IC4H 1A22B 3LDBB 2GTWA 3K2UH 3MXWL 3RY5A 2NLJA 1HEZA 4KJPC 1MHEB 1BBJB 5GGRA 2VYRE 3BMVA 3ZKND 1ACYH 5E7BA 4CAGA 1T2QL 3RKDD 2Y06H 2VXTH 5L2KA 2XRAH 5E9DB 3VMPA 1R3HA 5D7IF 5FIEA 3X12B 1UVQA 1ZEAL 2X70A 2I25N 2A6IB 3UTSD 3DXAB 3VD3A 1G6RB 3HMWH 1A6ZB 4YPGB 3C5SB 2XKUA 1PDKA 1E4JA 1RK1A 1V3JA 3STLA 3VI3E 4K55A 1MFEL 4X6DA 3EGSB 1UCBL 4JAMA 4UDTB 5IBUB 1MJUL 3GSUB 2H2SC 2CO7B 2NZIA 3EBAA 4NNPH 3LN4B 5BV7B 5J11C 3VGDA 4FN0A 4RIRA 4QF1A 1PSKH 1RZGA 2JIXB 4XP1L 1SY6H 2BVQA 2DQCH 2ZCLH 3KPNA 3MV8A 1IE5A 4OCRH 3TLRA 5GGRY 1GAFH 3LQZB 1YMMB 1BJ1H 3QFJB 2OK0L 5JPNA 3QHZL 5IHUH 6FABL 5EO0B 3RIFF 5K33A 5CEZD 3ZYOA 3JTCA 3JV4B 2VLKD 2AJVH 3D85B 3SKOB 4UB0H 2A38A 2DQHL 2N56A 3S96A 2ICWJ 5DURB 1QA9B 5FKPA 4K8RL 1QYGL 3QISA 1FHGA 3K8KA 4YDIL 3O4LE 5DQJB 1G1YA 3QAZB 1NGPH 1EPFA 3E8UL 4WHCA 3WYRA 1BD2D 1C5CH 5MEOB 1DN2A 4NZTH 4PTTA 1JVKA 1CG9B 4Y5VA 2GK0B 2FNBA 4GG6B 1A1OA 1FYHB 1UGNA 4ZAKA 4DZ8A 1HHKA 1KTKE 5A2JH 4XH2A 3AMKA 1KIUA 2P7TB 3CPLB 2EC9U 1A6AA 2EDKA 4IHOA 3BSZL 4OLZL 2VABA 1HHJA 4ZOBA 4LCCA 1F8TL 3U0WL 3N1FC 5HHQA 1H5BC 1J87A 3IYLW 5FGSA 4IEFB 2XWBA 5IF0A 4K9EL 1R3IH 5M95B 5IT2H 1A2YB 1A3RH 4YFLF 1EMTH 3T2OA 2J8HA 2LVEA 2DQJH 2VWEC 3HAEB 4NO0B 3UCRA 4MDIA 5DQDH 5AEAA 4YAQA 5CUSL 3P0VH 4DKEH 1NDGA 5CWSB 2LFGA 3BYTA 3PUCA 5DTFA 4NBYB 4PB0H 3VH8B 4M7JL 5TQ2L 1IAOB 1AGEB 2ATPA 4JHBA 1FSKC 5T3XE 3JTTB 1QFUL 3ZMRA 2HFEB 4X7EC 3ZDXF 5IMMB 4Q9RH 4P46A 1W0VB 3BZEA 3MUGA 1P84J 5T1KA 4JFXA 1A6PA 2DLEA 2XWTA 1ZLWH 1BHGA 4MCYB 4E0RB 5DI8B 3FQUB 1S78D 4RAUB 1XGQB 4RFOL 4JDTH 3JWDH 4NUJB 2Y5TB 5DEGA 4PJGE 5TH2A 3OPZL 4XAKD 4O2CB 1KJMB 1HHGA 3O9WC 5FYLL 2MTPA 4MAYD 4HC1H 4F57L 2ZUTA 4H1LA 5D7LB 1MHEA 2AJYH 1BBJA 4Z7QE 1B2WL 2JJSA 2AXFB 1H3TA 4JRYE 3UX9B 4WI6A 2NY0D 5JIPA 1V7ML 1T1ZA 3FO1B 2DB8A 1N7ML 5EIVA 3X12A 1JCKA 4TSBL 1FQ9C 1KELH 4ZFZB 3EYVB 1G6RA 3CVHB 5GGUB 1A6ZA 4BZ1L 3C5SA 1GVIA 1C1EH 4R97B 5CD5C 5JNYB 5JUEL 1A3LL 1LDPL 1JFQH 2ZCKH 3EGSA 1FFQA 4QXUL 3HI1B 4WFFD 4PJFF 5I9QB 3LN4A 4XB8A 5SX4I 2WUCL 4DWHA 5BO1H 3ZDZF 1OPGL 5JLZB 1NFDF 1MQKL 1QFHA 1U8QB 2JIXA 3ZTNH 2UY7A 2BOBB 1VFOA 4MNQB 1FVCB 2BVPB 1YMMA 2ESVB 4JM4H 1IGYA 3RI5K 3QFJA 3RVXC 3WHXB 1OM3H 3C6LB 5EO0A 5FGCB 4P46D 5J7CC 2WWKO 3JV4A 1ADQH 3S6CA 4JQVA 4D94A 3V79C 1IAKB 3D85A 4ZNEE 1WZMA 3QA3B 5AZ2L 2VKWA 2BSTB 3QWQB 3OR7B 1YEIH 1KF9B 1MCPL 3BE1L 1KN4H 1NKOA 1J18A 2YBRB 3VDAA 4OF6A 5DQJA 1ONQB 5JZ7D 1NAMB 4PDCE 4LL9A 5MEOA 1T5WA 1U8HB 3QXUA 4GRWF 4EN3B 2GJ6E 3DX7A 2GK0A 1AGDA 2AJXH 4HQQL 4GG6A 3G6JF 2I9LA 5ISZB 1I9RL 3CXDL 4FFWD 4Y16A 4LLUB 3TIDB 2P7TA 3CPLA 1SMOA 4G8IB 4EXKA 1BWWA 1HILB 3T2NH 4ZD3H 5DZOA 2LU7A 3W81A 4X0KB 3OR6B 5DO2C 2W9DL 2IPTL 1AE6H 1MCCA 2PTVA 1J1XH 1A2YA 4K8RD 4L9DA 5IFHH 3UPRB 2YA0A 1NCDH 4LQFL 1VENA 1UJ3A 2GUOA 4GKNB 3O0RL 1N64H 1YC7A 3R8QA 4TN9A 4JO1L 5CWSA 5HHOD 1I1FB 4HMDA 1XCTB 1TJGH 3WFEH 5FYJH 2B0SH 3VH8A 4GAJH 1IAOA 1AGEA 4KRPD 3T1WA 2Z93B 3UDWC 4EUPH 3LZFL 5KSUB 4LPYA 2DICA 4XHJC 2PW1A 1S9WA 3O6LH 4QXWA 5EZLB 3VI3F 1W0VA 3W0WB 4XVUC 5IMMA 2XNAB 1JWUB 3V7AG 4NHCH 4BFIB 4L8CB 4YHMH 1KCGC 3U83A 4U1SA 5CJOH 1HSAB 2PTTB 3BEWA 2CDFB 2P45B 4Y4FC 4F8QA 4MCYA 5EDXA 5JR1H 4E0RA 1FORL 3UJJH 2K3TA 1JRHH 5DI8A 2NY2B 4KHTH 4RAUA 1XGQA 2ZUXA 1MJJB 4NUJA 1T3FB 4YPJA 2I9TB 4I2XB 1RZJC 4F3FB 2VZTA 3DX9B 2D7TH 4JGMA 1JYNA 5DJYB 2VL4A 4O2CA 1KJMA 4LDEB 1HZHL 3UJIL 1QHPA 2MWCA 2VLMD 4Z7UE 4R8WL 1N6QH 4P57B 3NPZB 2NTFB 3GHBL 3TPKA 4CADB 3QO1B 4L9LB 4PJXB 2R56H 5D7LA 1KCKA 1BGXL 2LE9A 5F88B 2CK0L 4TVSa 5IHLB 3GSOB 1D6EB 3RJDA 2AK1L 2MKLC 3VXNB 4NO5B 3FB6B 2QKIB 3O8XB 3QCVH 3EYVA 2NNAA 2DL2A 3CVHA 5GGUA 4GMTL 2CPCA 3P9LB 5C92A 5JNYA 1Z0NA 5GJSH 2I26N 1INQB 1PZUB 1S7UB 4YQXL 4TNWK 3D9AH 3U6RB 4P9HC 1JMXA 5BXFB 1NBYB 4UV7H 5JLZA 1KLFA 4UTAL 3U1SL 3H0TB 2BOBA 3LRHA 1SBSH 4MNQA 4OIIH 5E6IC 1FVCA 2BVPA 2ESVA 3ULUC 2CXGA 4FQIH 3WHXA 3O3EB 1OTTC 3C6LA 4Z7NE 4LHQB 2C3XA 5CJQL 2W38A 5BS0B 4FQ2L 3C60B 1IAKA 2XZCH 4ZPVB 2CRIA 3THMH 3QA3A 4YLQT 2BSTA 5GGTL 1F4XL 3OR7A 4ODVL 5ADOL 1ONQA 4S1RH 1UQSB 3UROR 1MAJA 3P4MB 3QPXL 1NAMA 5HYJE 1KFAL 2O26U 3D3VA 1PKQB 3FQTB 2VXSH 4JE4B 1D9KA 1M6OB 2FX9H 4G9FB 3FRPG 2GW5A 5GZNC 5GQBA 5JQ6H 1EEZB 1HYRC 4FS0A 5ISZA 4ELMB 5J1AB 4P5TC 4ZUTB 2JB5L 4PJGF 4G8IA 1HILA 4QRPE 1YEGL 2R2HA 2DTMH 3OR6A 4XWGH 1KENL 2EE3A 3MA9H 4QRRB 4HV8B 5CCKL 4UNUA 2FL5B 5FA3B 1VA9A 4NQDD 3UPRA 3SDYL 2GSIB 4MXQA 1EEUA 4JHAH 3NGBB 4Z7QF 1NMAH 1WBYB 2XY1A 4Y4KD 1AR1C 1LO4L 1XCTA 4DGIH 5EU7C 2KZWA 3M1BB 4PD4K 4YK4B 2Z93A 4OZHB 5DEFB 4XPBL 1KIPB 5D2LE 4MHHI 5EZLA 3W0WA 3MLZH 2RHEA 2XNAA 1JWUA 2BRRL 2AJSL 4Y4HC 4BFIA 4L8CA 2HWZH 4PGDA 2VDLH 1FDLH 1AD9B 1KPVB 3AM8A 1HSAA 2PTTA 2KKQA 5IB3B 4L3CB 2J5LB 1IGCL 3GRWL 2C3HA 1NGXA 1WAAA 2NR6C 2HRLA 3BH9A 4OBRA 1Z0MA 2HJLB 1MJJA 4KK5D 4ZPTB 4Z5RA 5CEZE 5J56B 4NKIL 5T3ZL 2CIIB 2I9TA 1MCQA 2VLKE 4FXGB 1D5MB 4I2XA 1HCFX 1GGIL 3JV0A 5JW3H 4F3FA 1AQDA 3NPSC 3DX9A 1JIBA 3V2AR 2CSPA 5DJYA 4FZEL 2VL5B 5I6XC 3D3VD 2VRAA 4GKOA 2VOTA 1D9KD 1RMFH 4P57A 2XPGA 4W4OA 2NTFA 1BD2E 4CADA 5KVGH 3QO1A 4PJXA 3KPPB 4H88H 3WNOA 1KYOJ 4XNMB 1I9JH 3VFPB 4LIQE 3GSOA 1D6EA 4LVEA 3VXNA 4NO5A 3FB6A 3M8OH 2D7NA 4HMCA 2X4RA 2QKIA 1CT8B 4QOKB 4ZOEA 3WSQL 3O8XA 1P6AB 3OKOA 1OGAD 1P53A 3HNSL 3RDTC 5J1SC 3RQ3A 1VSCA 3MV01 4N9OB 1PFCA 1N0LA 1SJEB 5L88L 1INQA 4OGZA 1S7UA 4RX4D 4OV5A 3SPVB 3U6RA 3PWLB 4M6MH 5DGRA 5BXFA 3B4NA 1NBYA 4GAGH 2HLFD 5BW7C 1BIIB 1KJ3H 3I6GB 4MD5B 2J4WH 3ROOB 3IJSA 4U0QB 4U1MB 1FZOB 2HFFA 3S35H 1UEYA 1C5BH 2NXZC 4F8TA 4L3ED 3ULUL 5EA0L 3UTTB 3ZTJG 3ET9F 3O3EA 3LY6A 1NAKL 3MNZB 1TDQA 2YD6A 2J12B 2P43B 3QDGB 4ZPVA 1MFCL 1U3HC 1NCBL 1R0AL 2COQA 2KPNA 5EU5A 4MNGE 2A74B 1P2CB 2V17H 4QYOB 1AJ7H 3VXOB 1UQSA 3GKZA 4LCUB 5DMKB 1RU9L 3FQTA 1PKQA 4XZUB 1RI8A 3PQYB 3ABZA 1C7SA 4G9FA 1JGVH 2Y07H 4EOWL 3RWFB 3MCG1 2H1PH 3DSNA 2XG5A 4HJGB 1JTTA 4K3DH 1DSFL 4CN1A 1AXSA 4ELMA 5J1AA 3L7EB 1H8OA 5KW9H 5INDB 3WHE1 1MI5B 1GHFH 4OLYL 4OFPA 3ARBA 5DRZB 1LK3H 1BREA 4YXHL 4HV8A 4G6ML 4Z78A 5J4MA 4Z7UF 1OW0A 3VFGL 5FA3A 3PGCB 3N85L 2GSIA 5DWUH 1GC1C 2AEQL 2V5SA 2DM2A 2OXGA 1T1YB 1DBJL 3T8XB 1QFWL 3G5XB 1WBYA 4NBXB 4LCWA 5H8DA 4U7KA 1FVEB 3LVEA 4R2GC 3MNVB 4E41B 3P4OA 5DUPH 4RISH 1ZHLB 5DR5H 3TJHA 3GMQB 3QI9C 1A7PL 1KIPA 1FNGB 3KAAA 2CJUL 3PP4H 3VDBA 4M7LT 3TBWB 4GUPB 4LSUH 5CJXA 1AD9A 2ZJSL 1QLFB 5DVOA 4CMMB 4Z9KB 2E7LA 3DIFB 1YJDH 4N0UE 5IB3A 2A83A 4ODSL 2IGFL 1BEYL 3L5XL 2XFXA 4PYHA 1NANI 4XHQA 4ZPTA 5BZDB 4HT1L 5KAQF 2CIIA 1VGKB 4FXGA 1D5MA 2VITA 1UB6B 4V2BA 3U36A 1OAQL 2XZQH 4E42B 4BSVB 4G7VH 4G80B 2FEDD 4Z7NF 3IVKB 4P9ML 2VL5A 2MQCA 3QG7H 4O2FA 1MRDL 2X1WL 4RAHA 4Z18A 2VDRL 1G7LB 1MIMH 2X42A 4XWOC 4F7PB 1ZA6A 1MPAL 3O4OC 4JO3H 2KUTA 2FSEB 5BVPH 4XNMA 3L3GB 3VFPA 3L3KA 1TZGL 2Q20A 2WLZA 1G1CA 1CT8A 4QOKA 4QT5B 1KCUL 3ARBD 3RWDB 4WJ5A 4TUKL 1EAPB 3QUYB 2BDNL 2XG4A 1SJEA 1L7IH 3U4BL 1KPUA 2JJTC 2DIJA 3EZ8A 1RZFH 4PLKC 4YHYB 4A6YB 1KG0B 2DQGL 4ENED 4OLXL 1ORSA 1CTNA 1HH6B 35C8L 3I6GA 4MD5A 3OXSB 3DO3A 3ROOA 4U1MA 3O6KH 1CXFA 1FZOA 4UMGA 5HHOE 2EECA 2F5AH 1QNZH 3U9UB 4JJHA 4UILL 1U8KA 1U92B 1NCWH 3A67L 5FF6B 2QQNH 2ZUYA 3MNZA 5LG1A 5GSRB 1DFBH 3QDGA 4M6OH 3NA9H 3SGKC 1P7QA 4XXCA 1JI2A 4UNVA 4OCSL 3AREB 5D2LF 4MGXA 2A74A 4NM4L 3DUUB 4F9PA 3S3PA 5IW3A 1S9VA 5DMKA 4W6XB 4WI2A 2X9YA 1YEFH 4XZUA 1KB5H 3TYGL 1DEDA 2Q7YA 3UYRH 4NWTL 4DZBB 4HUMB 3IDXL 3RWFA 3K7UA 3ULUD 3FRPA 4NJAH 4WUUD 2QADD 4RMQA 1U8PA 4OM1L 2HRPL 2P8LB 1MLBB 2AK4D 5GS2H 4M00A 2VLME 3MLSH 1MI5A 3ARDD 1RHFA 1D6VH 5DRZA 1LO2L 5ELIA 4IRSC 4PR5A 4KKCC 2OJEB 2OR8A 2P5EE 3NTCH 4DGVH 3VD9A 1GC1L 4HMEA 4Q97A 3BKMH 3MACL 3V0AC 4CU7A 2E9JA 4DK6A 5GZND 3G5XA 1S9KC 2Q3AA 1BFVL 2FR4B 5T1LB 1S9YA 4GBXA 4HZLA 1QEWB 3KLHC 4LARL 4Z95H 1YYLH 1QZ1A 4E41A 5HGAB 2HT3D 4EBQH 3T77B 4XP4H 1ZHLA 3GMQA 3W2DH 1DVFB 1CD9B 2D3VA 1U6AL 5C07B 4HF5L 2PXYB 4HS8L 4P2QA 5D1QC 3RU8H 3MR9A 1INEL 2DQEH 3TBWA 4XCEB 4GUPA 1CICB 1WVZA 2AGJL 2WK2A 2PYFB 4M1GH 5FA4A 5CGYD 3DIFA 5E8EB 1IC1A 1G0YR 3HMXL 4FQJL 5I0ZA 5D1ZC 4PG9A 2XY2A 3DOSA 3MLYH 2AXGB 3OZ9H 2XOTA 5BZDA 5DF0A 5I1DA 1VGKA 2X41A 5HI4C 4E42A 1UB6A 5LWYH 4QCIA 3M45A 4BSVA 4G80A 3P0GB 2OMBA 4RNRA 3OKMB 1NC2B 5I19H 3ARVA 2MCG1 3OKYA 1EGJL 1UJTA 3MA7B 4ZQKA 5SX5K 1VPOH 3A6CH 1G7LA 4F7PA 2FSEA 3RHWF 1I1YB 3SDXB 1OT1A 3L3GA 3FFCE 1IAII 4X7SH 4NZUL 4FP8L 1FAIL 3D25B 2FX8H 3HI5H 4KQ4H 3QXAB 4NZRH 4QT5A 5F93C 1YECL 1YEEL 4JQIH 2YPLD 3RWDA 4LSRL 1EAPA 3ARGD 3QUYA 4H0IA 4OD1H 4WW2C 5I1CH 3GJEB 4F58L 4ZAKC 4HH9B 3MV9E 4C4KO 4NQDE 3DV4B 4A6YA 1MRFL 4UINH 5D2NB 3OXSA 1DUYB 4GBXD 1BECA 4NQCB 4LCCC 2VDML 1UWXH 1K6QH 1MAML 3RA7L 2EIZB 3VE0A 1ZT4B 1GZPA 3U9UA 1V3MA 3ULVL 1U92A 1R5IB 4BA8A 1TZIA 2VLRB 5FCUH 3RDTD 3KPSB 5FF6A 4P2QD 4G6JH 2A0LD 3SE3A 4XP9L 1DE4B 5IBTL 2G9HB 1RJCA 1TQCB 2FO4B 1PEWA 4P3WA 2EDYA 2ICWB 5AWNL 4IOFD 4JVPA 2IADA 4B50A 1FO0H 1LO5B 5EZJB 4KVNH 2F53D 1CL7H 4NFDA 2H32B 2VWEE 2FRGP 2FYYA 3U79A 1UKSA 3CUPB 3C2SA 2YD9A 2WQ8A 4KKLD 1TJIH 1PX3A 4Z0XB 4GRLB 2C3WA 1CDGA 3V8CA 1DDHB 4F7CA 2IAMD 4PY8J 4YBLB 4JKLA 5EPMA 3MRNA 1JGLH 1QSFB 2PTUA 3T04D 2YD5A 3VGBA 2P8LA 5GGVH 5C08B 1MREH 2EXYD 3RVVD 3TA3B 1CF8L 2MPAL 3I9GL 1S9XB 4GXVL 1RUMH 4KROC 3UC0H 5C0CB 5D7SH 1I1AD 5FO7A 4M43L 4FNLH 4GSDH 1OT2A 2DL9A 4RMSA 4BJLA 1IC5L 5KVFH 3EOBA 2HFGH 4P2RB 3LDBC 4KPHL 3UYOD 5HD8C 1T2XA 2DQIH 4NQUA 3EW3B 1OGAE 4P3DA 4WCYH 5IESL 2FR4A 5T1LA 2CDGB 3F5WB 1QEWA 4HS6B 3D0LA 4K7FB 5TE4L 2ATKB 1CK0H 2UZIL 1MJ7L 5HGAA 4JM2B 3HG1D 1M7XA 2BVYA 4HDIB 3T77A 3V4UL 4MAUH 1DVFA 2PXYA 3CH1B 4OGAC 5IFAL 2WBWB 4WUKL 4XCEA 5F7EH 3Q0HA 5GS0C 1CICA 5IK3A 1DLFH 2VH5L 5AD0B 5FECB 2XA8H 5IW1A 7CGTA 1ZHKB 5JW4N 1X5LA 4K3EL 4L3EE 4I8DA 5DK3A 2BNQA 3TF7C 1K4CB 4KI1A 3BVNB 2P46B 3QUXA 2VN7A 5BV7C 3S37H 2ICES 3VDCA 2Z8SA 2FBJH 3HE7D 4HKXB 2A6JB 2PF6A 2C3VA 1FNSL 1XH3B 1I7UA 1RD6A 3SQOL 3OKMA 3QI9D 4ZFGL 2EE2A 3HPJB 1MHPL 3RZCD 4N8VG 2OTWB 4OGYH 5FUOL 4ONFH 1OAZH 4P4RB 1H9VA 3X17A 4GAYB 4PRIE 3ARUA 4O5LH 1I1YA 3MFGB 3MV7D 4N8PA 3QXAA 3DGGA 3QAZC 3DARA 4P2OD 1EZVX 3NACH 1NLBH 1JZ6A 4JRXA 3PHSA 1MRCL 2YPVH 3LS5L 4GRWH 4APQD 1U42A 3GJEA 2R1XB 3MXVL 3H9HA 1X44A 5J0BA 2VDOL 5GJTH 1Z9SA 3DV4A 3F7YB 4NQCA 4UOJA 5DHVB 5B3JF 3WJLA 3O6FD 5I30L 1MCRA 4KUZH 1ZT4A 1R5WA 3BAEH 4OCXL 1R5IA 1TTUA 2QHRL 1BQSA 3NCYP 4AEIL 4P4KD 5DQ9B 4JHZA 2NY5H 2Y6SC 1GGCH 1IC7L 1WFUA 5L7XL 1DE4A 3NAAH 5SWZB 2FO4A 4U0RB 4L5FL 3RWHA 2QBWA 2ICWA 4ZS6D 5EZIH 1LO5A 1JTPA 2M26A 3FKUS 2OX5A 3I3DA 4RGNB 4YHKL 2BNQD 5D72L 3OAZH 2H32A 3ZHKA 3BKYH 3CUPA 1CGXA 3GIZH 4M93B 4Z0XA 1RZKC 3SDAB 4GRLA 1A6VH 4KI5C 3B2VL 5HVGB 2DIAA 3ARFD 4UNTA 3RTQA 3ULVD 3L6FA 2AW2A 5BRZD 1QSFA 1XF1A 4MZ3A 5C08A 4XNYH 4PJ8A 4HWBA 4J4PD 2AJ3B 4OCWL 3ILQD 3TA3A 2F54D 4G8GB 4ZTPH 1CDHA 2KQNA 5IM7B 1S9XA 4OBSA 5F3BB 3X13B 1JPST 4Q58C 5C0CA 3QT2A 2F74B 3DURB 4R4FH 1YPZE 1FFPB 3BOVA 4JPWL 4OD3H 4FFYH 3MRJB 1DEEB 5I1GH 1L9NA 4KZDL 4M7KL 5DFVD 4JRXD 2I5YH 4LCYB 5T3ZE 4HS6A 4K7FA 4DK3A 3CK0H 5ICYB 2ATKA 4X6BB 1PBYA 1YQVH 4UAOB 1QO3B 4KC3B 4HDIA 4D9LH 3BKJH 1W72H 3KPRA 5GRVK 5GS0L 4YO0B 2VAJA 1WWAX 3CH1A 1DQJB 4JY5H 4JZOB 3U30B 4PLOB 2O5YH 3MLWH 4KKCD 4L8SA 4WI5A 4PLJD 4XC3H 5KANG 5AD0A 5FECA 2FH6A 4R97C 3VXMB 4NN6B 4PP2B 4EI6B 1K4CA 4F37K 3BVNA 5ACLA 2EDXA 5I9QC 1JZ7A 5HHMD 1CZ8H 2F5BL 2Q1EA 4HKXA 2A6JA 1KIQB 1EIBA 4B41A 3ESUF 1CFVH 1DQTA 5JMOC 1CFQA 3WXVL 2BHUA 3HPJA 3U82B 1IZJA 1JZ3A 1SMAA 3AB0B 3C6LC 2OTWA 4QRTB 3U7YL 3IDIB 4P4RA 4GAYA 2J6EH 4OD2B 3LRGA 4JFEB 3IDMB 3MCKB 5D1ZD 3ULUE 3DI3B 4PJ8D 4WUUE 3MLRH 4LSSH 1DUZB 3TT3L 4QGYA 2HKHH 2AK4E 4X8JA 5TQ0L 1U91B 1LO3H 4KGLA 3HRPA 4RDQG 4EN3C 2YC1B 1JNLL 4HKBB 1JHKL 2R1XA 5C6WH 2B2XL 5H37G 2C1PB 3KVQA 4H0HB 4TNWF 2BCKB 1IM3B 3HFML 4WFHE 3PDGA 2VLJE 1R3LB 3U7WL 5C6TL 3PIQB 3H3BC 5DHVA 4NKOA 1CTOA 5A3ID 3ZKSD 4HIIB 1WUNT 3U46B 3KPRD 3CFCL 4MXQC 2MOVA 5A2KH 5E8OB 4ZUVB 4MQTB 4G6AC 3NCEB 4G5ZH 3V6OE 5E00A 4JN2B 1KNOB 1MLCB 5I17B 3FQXA 4EUPB 1KPRA 4Q9CA 3KJ6L 2FDBP 4I0PB 1RZKL 4P23D 5KVDH 3DRTB 4QTHB 1LD9B 2W9EL 3SDAA 3H6JA 5FYKD 3TBSB 3BRFA 2XQBH 4KMTH 4DQOH 5EU7E 3G5VB 3LIZL 3AM8C 4X5LA 4JPKL 4XC1L 5FO9B 2YRZA 5HPMA 4HBCH 1X5XA 2AJ3A 5D6DC 5IHZB 3DETD 1DQDL 2V9RA 4Q0XH 2NY2C 4G8GA 1RIHH 2Z0BA 4Z77B 5IM7A 4BELD 4NNYB 4PJDB 5F3BA 4YGVB 4ZODA 3DURA 4OTXH 3LCYA 5C70A 2R39A 4N1CA 5IUSA 3Q5TA 3TN0B 2IMNA 3L3JB 5BJTA 4HC1A 1DEEA 3B8SA 1CFBA 3HZYB 1A21A 4W4OC 2V5YA 3D6GA 2YPLE 2HMID 4C83B 2G2RA 4L9LC 5LBSL 5F7KC 5E99L 4X6BA 2X4OB 4A2MA 1JPSL 2YXFA 4N8CH 2OTPA 4XP5L 4AJ0A 1EHLL 4NDMB 4P3CL 3O8XC 1DQJA 2D31B 4JZOA 3TCXA 2C7UB 2HLAB 2UUDH 2HTLC 3X3FH 1E6JL 2R4SH 3OKLA 1NC4B 4PP2A 1CXIA 1H3PH 2AEWA 5HHXH 1N3NB 2IG2L 1CVRA 4EI6A 4JO4H 1F58L 4D8PB 2EDNA 5IBLC 3RX7A 4LGSB 2BNRD 4ZS7H 1G9MC 4OIBA 1ETZB 5DMIL 3N9GL 5F71A 1QTYT 5IV2B 4C57C 3SJVA 3B2UC 3T1FB 2WP3T 5F9JB 3MRLB 1T7ZA 2F53E 1RV6X 4D9QD 5KJRL 1ADQA 3SO3B 4D3CH 5E03A 3DXAD 3L1OL 4H5SB 1HYSC 5EU3B 4N8VA 1I3RB 1T1XB 3C60C 2IFFL 4M1CC 4QRTA 3IDIA 3U4AA 4OD2A 1V7NL 1INDH 1CS6A 2W92A 3QEGL 1AR2A 2VAAA 3MCKA 1VFMA 2BOCA 1DUZA 1KTDB 3VD7A 4ERSL 4D0DA 2X9WA 2D4FA 4K7PX 3LEXB 1U91A 3TPUB 1T80A 1BVZA 2YC1A 2OBGA 3RWEB 4U2YA 3BYYA 2JKXA 1Z2KA 5FHBL 3L3IB 4KUCD 2GITA 1HXMB