5BXFA

Apo fcrn structure at ph 4.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
263
structure length
263
Chain Sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/immune system
molecule keywords IgG receptor FcRn large subunit p51
publication title Human Fc-Receptor Neonatal at low pH gives insights into different states of FcRn
rcsb
source organism Homo sapiens
total genus 58
structure length 263
sequence length 263
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bxfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5bxfA01
1I75A 4NNYB 2BCKA 3R4DA 5SX4I 4WFED 3DXAD 2Z91B 4JN2B 2H26B 3PWUB 5IGXL 2IALA 1S7WB 3L3GA 4JHAH 5IVZA 1HHGA 4X8JB 3BH8A 4X7TB 2BVOA 1HXYB 3OSKA 5L2KA 1KN2H 1PY9A 1A3RH 4JFED 3L1OH 5J6GA 3ARGB 3PXJA 3UTZB 2DS4A 1W72H 4PIRF 5I1HH 4H5SA 5CCKH 1Z3GL 4OKDA 1OAUL 4YNYB 1OW0C 3RWHB 4HMDA 3GRWA 5BZDA 1OAYH 3T0BA 1BZ7B 1O0VA 3ILQC 1IARB 5IB2A 5H94B 3B9AA 2I07B 1WWCA 4QRUA 4QF1B 1VCAA 5CJOH 3W9DB 3BGMB 3L95B 3CVHH 4JKMA 3RWFB 4GMTL 2XN9E 3FAWA 5DS8A 2XXMB 3MBEA 3O8XC 2XZAH 5TPWL 4XCEA 5JXAL 1H3WM 1UG9A 4XZUB 4MXWL 2D7MA 4EI6A 1R3HB 3BRGC 2DI7A 1MFCL 3VD5A 3EGSB 5IMLA 3W0WD 1F2XK 5HHNB 1T1WA 5J9PA 2NY1D 2W9DL 1BJMA 4PJ8A 4OZFG 1YEKH 3FMGL 4BQ9A 1VB9A 2HRLA 4Z7VB 2BDNL 2X1WL 5J56B 4YHKL 1CT8B 1WT5C 2IFFH 2BJML 5A16B 3QI9C 4OKVB 3WFCL 3IFLL 3KHQA 3FRUB 3LEVH 5F7NC 3V4VL 1D7FA 1HK6A 3QFDA 2O5YH 4CMHC 5LXGH 4HKBA 3LSOB 5IKCA 2PN5A 5A40E 1JZ2A 3QULB 5FUZL 3LKRB 1EBAA 2DQIH 2B0SL 1HHIB 2ZSVA 4FQ2L 5GGUB 4GOSA 2FH6A 3CFBB 1PQZB 3G6JB 2ATKB 3FAXA 3L3IA 2AJYL 2NXYD 3G08B 2PTTB 2FATL 3GNMH 5TQ0L 1GZQB 4L8DB 1YNKH 2XNAB 4YLQT 1SEBB 5DJ6B 4D9QD 1KN4H 1KXQE 3P0YL 3AREA 1NCDH 1LK2B 3PQYB 2E9WA 4WGWB 5KVMC 5CS7A 2X89A 4Y4FC 4RAUA 1A7OL 5GS2H 5FGBC 3SKNB 4M7KH 1EFXA 4JN1H 3T2QA 1N0XH 4HGWA 5EIVA 1A6TA 3ZTJG 4Z7NE 5ADPH 3KLHC 5F7EL 4LKXA 2OTPA 1MWAA 3EKCA 4F58H 3TNNA 3IDIA 2PW2B 4ELKB 1KCGC 4EBQL 1ZLVK 4IM8A 4IS6A 5FKPB 4NZUL 1HHHB 4MX7A 1UCBH 3ARSA 4J1UB 3QA3B 3CC5A 1KG0A 2BNQA 3VFPB 15C8H 3ULUD 4BQ8A 1S9XA 1SJHB 4CVXB 3NCJL 4WHDA 2YD5A 3HI6H 3IXTB 4WEBL 4JREC 2EYRA 3Q0HA 1M71A 3NIDE 2UY7A 1KGCD 1YQVH 3X3FL 5DJYA 4Z78A 3DUUA 2HT2D 5D70H 4QYOA 4HKZB 2R39A 1CDHA 4AMKL 3KDMA 3DO3A 4OB5H 4U6XA 2GTZB 1CTNA 4WW2A 3O3BB 2R0ZH 4N0RA 4UQ2A 4ZS6C 3BKYH 2KDGA 5T5NG 1XMWA 5JIPA 3C60D 5IESL 1N26A 1W0YT 4ODUA 4TSBH 1EX0A 5IR1B 4GKSA 2CGRH 3WFCH 4QXGH 3UTPE 4LLQB 2DLFL 5E2WH 4P2OA 2VE6A 5KSAA 3B5GA 4P5MB 4RBPK 1MJUL 5EU7C 4BH8A 4F33B 4PUBH 2AXFA 1L4IA 5GGRA 1F6AB 1FV1B 2JB6B 5I19H 1AHWB 1NGWA 3I02B 3U7YL 2R2HB 1RJLB 3CSBA 2V5YA 3T65A 4ZFFA 2ITCB 2YD1A 3P73B 3QCTL 4I0PC 1VGEH 5DJ8A 4N68A 1A5FL 4NO2A 4U1MA 1E27A 4CMMA 5LWYL 2KQNA 1IAKB 4Y16B 4XAKD 4LU5L 2R56H 1RIHL 4U1GC 5INDA 3ARGD 1EUTA 3VXRE 5BVPL 5ETUA 2NY0B 2UWEA 3A67L 3MO1A 4MJ5B 4EQ2A 1INDL 4APQC 4YDLC 3ARQA 1FVCA 1TCRB 4WHCA 4OUUA 4GRWB 5HDOA 3DSFL 1LWRA 3MJ6A 3KPMA 4Y5YB 2A1WH 5CLWA 3GSNB 4OUOA 3TO4C 4IOFD 3FB8B 1II4E 1BVKA 1DP0A 5E2UH 1Q1JL 1WZ1L 3RVTC 2HKHH 1CR9L 2EYSA 4ZTOL 1MIMH 4PG9A 5DEZA 4Y19E 3UC0L 1YDPA 5HYSB 3WN5C 3GSQB 5ITFB 2FJGA 5BS0A 1J1PH 4YDVA 4MZ2A 3HRZB 4WV1A 1CZ8H 3NCJH 1EGJH 4YZFF 5HVFB 4F3FA 4RISL 4LCCA 4G6MH 2W38A 4MNHA 2YA2A 4RGNB 5I17B 1WUNT 1H3GA 4FNLL 1OLLA 2Y9RT 3HAEG 1J1OL 3NGBB 2DMCA 3WHE0 3UJTL 4I3RH 3X3FH 2MJWA 2D3VA 4KU1A 3S9DB 1E4XL 4OCNC 5CSBA 2VZVA 3OKOA 5EBWA 1F4XL 1D5XB 3AS0A 3EYOA 1CD1A 2ZOLA 1TQCC 5CD5D 1BVLB 4R3SB 4HUWA 4NDMA 3VXOB 1UKQA 1DQLL 4P5KB 1F4YL 5IESH 5FYJU 2VR5A 5T1DH 1GRWA 5GRJH 5DC0A 2IBBA 5ANMA 5F9JB 2G2RB 4PRIE 3L7EA 1MJUH 4W6YB 4DN3H 1JYXA 1PAMA 5DUPL 5I30H 3WHXB 1S9KC 3KVQA 3PQYD 1CWVA 1U8IB 1AY1L 3VWJC 3SGJA 3QAZB 1JHLH 4RGMB 4XHQA 4CDHA 3B9DA 1WIUA 4K2UH 1SJXA 3QEQE 2Y07H 4FQQA 1QFWL 5LBSH 5BOZG 5CEZD 1OVZA 5IEKA 1DQQB 3A67H 1Y6KR 3VGBA 2R1WB 3HG1E 1X3DA 2X4TA 2CD0A 1F3RB 5FF6B 3V4PH 2V5RA 4U2ZA 4L29B 2VDQH 1NFKA 3P11L 3U1SL 4F7TA 3DHMA 4Z7WE 3T2PA 1WAAE 4MNQD 3NCMA 3S7GA 5EU3B 4NHCL 1VFUA 4NUGL 1QUNA 1S8DA 5I8KL 3D3VB 5EN2B 4H8WC 1WZ1H 3O2VH 2RIKA 2HFGL 5EZOL 4OZHA 1YY8A 4W6WB 2DBJA 1F4AA 1OOAA 3UC0H 3MBXH 2OS7A 4Q0XL 1RJYB 3RWJB 4Q9BA 2GAZB 1FDLH 1JGVH 5JZ7D 4X6DA 1NDMB 5JIIA 5GSRB 3O2DH 4R2GB 3X3GH 2QQNL 2IGFL 3SY0A 5DFVC 43CAB 4OLEA 4XI5C 3S37L 3UJTH 3PDDA 3HE7C 3BUYB 4WFGD 3PV6B 4UV4L 3SQBA 4Z8FH 2EH7L 1M7DA 3MMEB 1CF8H 1T2QL 1UH3A 1UGNA 3B2VH 4J4PC 5C08B 4NO3A 2ZPKL 5DDHA 3UJJH 5HI3D 3FB7B 2CDGA 5A2JH 2CLVB 3I75A 2ESVB 4X5WB 2AVGA 4L9LC 5GRYA 5ISZB 2I27N 3QDAA 3A0OA 4DQOH 5GGSY 1DQLH 2JLLA 4RA0C 5MENA 5FYLH 1NC4A 5ERWB 2R0LH 2VLMD 3K81A 3GBNL 1ZHLB 3D0LB 5HHMA 4KRPB 3H9SA 1N6UA 4Y16D 4AYFA 3H2WA 3WO4C 5DUPH 1ZT1B 3TJEL 3NCYP 4R26H 2VDML 2NY0D 4PV8B 2F74B 3CDGA 4PJHB 4V2CB 5CIPH 2EE2A 5D1ZA 3B6SB 2P1YA 4PJFA 1AY1H 1RURH 1KJMB 5CINL 3FOLB 1U9KA 3ET9F 4PJBA 5DUBA 5E00A 3ULVL 1RZGB 2FIKA 1E6JH 3TA3B 1BD2A 2RFXA 4U1KA 4O58L 2IPUK 4PJDB 1KIQA 4N0YH 3I3BA 3QO0A 5DA4A 4LNRB 1QFWH 3UPCA 3OG4B 4P2CG 1AIFA 4U1LA 4BSJA 3NZHH 4Z6AT 5HYJB 1MPAH 1XF5A 3DMMA 4CBPA 4NCC2 4JGUA 2COQA 3RI5K 3JV4A 5MEOA 1IGFH 4PJ9B 3E2HC 4H1LB 5DC9B 3WNPA 1TTUA 4IDJL 3IDYB 1FFQA 2VQ1B 1WLHA 5F21B 2YK1H 4I18B 2FJFA 3NN8B 3NCEB 4G9DB 4LPCA 2VJXA 3S98A 1VHPA 3TYFA 1X4YA 1VPOH 3ZTNH 1P5UA 2DM2A 3BEVA 3MACL 4O02L 4C56A 3Q5OA 5GS1A 1T5WB 1D6EA 2HMIC 3ES6A 1JHTB 4XBPA 5EPMA 3MV8E 5C0IA 2IG2L 2QQNH 2IGFH 3EOBB 4JG1L 3X17A 3FQRB 5IB1B 1VDGA 1OTSD 4I3SL 5ESVB 3LKPA 1DQJA 2JK5A 1KTKE 3AY4C 4YBQC 3B9KD 4LCWD 3VXSA 4ZUWA 3MNWB 5FYKD 1ORQA 4NYLB 4UBDD 4UV4H 2H2PC 2CRIA 4WUUA 3PUCA 1GC1L 1G9NL 2EH7H 1XIWD 4OM0L 5J8OA 1KEML 6FABL 2XZQH 4P46B 4HXBL 3RGVC 2JJWA 4KQ4L 2E9JA 3C5ZC 2VAAA 3MV01 4XWOC 1EEYB 1R3JA 1UXSA 2I26N 2W0FB 1G9EA 5F7DB 5FO7A 1M7XA 1TZIA 3FN3A 3N1MC 2J8UF 1MLCB 3EYVA 4MJ4A 5IVXB 3P40A 5L9DH 5K9QG 2GFBA 1HOCA 4YC2B 3MLRL 3KXFD 1LVEA 2ADJB 3MJ7A 1U42A 1JRHL 4NHUB 2B1AL 5I1AB 3INUL 5DD1H 4QHLA 3HHRB 3U4BL 2RB8A 4XNUL 3O6MH 4JCLA 4WDIB 4OT1H 1XGPA 4UIKL 5JDSB 4LHUG 3R06B 4PLJC 5EG6C 3MRJB 3DV4B 4E42A 3TH4T 5KS9F 1N64L 1I85C 4YQXL 3K1KC 4TSAH 1DSFH 4DJMA 3IDJB 4N0FA 4G59A 3KPSB 1YNTA 2O61A 5IQ9A 1JRHI 1OPGH 5C6TH 3G5YA 3UBXA 5JPMB 2HH0L 3EOTL 2FX8H 5EUKB 1NBVL 2GUOA 3QIBB 4DWHA 1B9ZA 4KKBD 2E6PA 3HE6A 5I1GH 2IH3A 3M1BA 1JF1A 3STZA 1B4JH 3UTSA 4LIQE 4D0CB 1FFNB 2NZIA 3IAGC 5AZ2H 3S36L 4PJEF 3UPRA 1KUMA 1NSNL 5HD8D 4BFBD 5E2TL 1DN0B 2Y72A 4P3DA 1X5LA 3PP4H 4X98B 3E6HA 5GISL 4R2GD 3U0PB 1DBML 1KCLA 4XP6L 1G84A 3BDBA 2A83A 5B38B 4UNVA 2PW1A 2BVQA 4NKMB 1BOGB 3CSGA 3OXSA 4R4ND 1A6PA 5T1LA 2D7TL 4ALAH 1NEZB 3EBAA 4Y5VB 3HMWL 2YXMA 3L5WB 3TF7A 1I8LA 5GZOD 1MCDA 3I9GH 3L3DB 3ZDZF 2JCCA 3T4YB 3QEUA 5D1XC 3LMJH 2DQDL 5B39B 5EC1B 5ISZD 2F19H 1W72B 1NGQL 4GAJH 2OR8A 3KG5A 5AG8A 1PFCA 2NCMA 2VITA 4JFQB 1MJ7H 1Q9KB 4KK6D 4FFEX 4KRPD 3RX7A 4U49A 3W2DH 4FTVD 5D2NB 5KTEL 4UT9H 1JN6B 1ACZA 5L2JA 4PRPD 4AIZB 1OTTC 2GSIA 3N9GL 4OM0H 2F58L 3CVHB 3FO0H 2C1PA 3MRBA 3W9EA 4ETQB 3H3PL 1FZOB 4KAQH 4J6RH 1G7QA 3GMPB 4K8RL 1IGJA 4I1NB 4JANB 1JTTA 1W0WA 4V1DD 3KPOA 5FCUH 3MV9B 4LVHB 2P46B 4BKLA 3QRFM 4XBEL 3FT2B 3ZE0F 5J13C 3IDUA 3TA3D 3TPUE 3QDME 4PJXF 3MV7A 3D9AL 2AAVA 3OTTA 4OLUL 3VH8B 1ZK9A 5CEXB 3G5XA 4OCYL 1QO3B 3IKCB 3UYPA 2X4UB 4M7JL 1JPST 5F6IC 5FHBL 3G9VA 3ZE1F 4XNUH 3MRCB 3F5WB 4YJZL 1G6VK 5DI8A 2BCKB 4OF0A 1I7TA 5IBLD 1ITCA 4OQ1A 4YXKH 5HYJD 2IALB 3L3GB 4FFWD 5HI5C 2NPLX 1R5WA 3MRRA 5BO1H 5IVZB 1IGML 3E3QE 3BH8B 4X6CA 1S7TA 2BVOB 2K7QA 4HWZB 3O8XA 2AEPL 4CN1A 4P48A 1C8PA 2DKUA 5L2KB 4KZEH 1RAMA 4LSDA 1CFNB 4KV5F 3EOTH 4PJ9D 5J6GB 1K8IA 1YEIL 3THMH 1NBVH 4KHTH 2NTSP 3VJ6A 4H5SB 1FYTB 4HK3J 4F37F 4N9OB 3IFNH 1HSAA 5GS3A 1QBLL 5BZDB 5IB2B 2JJUA 3V6FA 4QGYA 1WT5A 4QRUB 3MLUH 4LLWB 4S1DC 5J6HB 5BCAA 2CR3A 2X6MA 1CXFA 4YBHA 5DS8B 5TDNA 4P99A 3MBEB 1XF1A 1T03H 4XCEB 4PJCE 4Y4KB 1A4KA 2LAGB 1I9RH 4NZTH 4EI6B 3DOSA 1FG2B 1R0AL 2XTLA 1HCVA 1ZS8A 2L7UA 2UZYB 5IMLB 3WFZA 3WFBH 5IV2A 5ADOL 4P57A 5J9PB 4P46D 3I3EA 2IBZY 2VZOA 4KUCF 1D6VL 4PJIF 3AM8C 4OLYH 1J0JA 3MUHL 3KJ6H 1U3HC 2EIEA 2PYFA 3MROA 3FZUD 2VLLB 4FS0A 3OX8A 3QFDB 5KTEH 3OQ3B 4YGVA 4LP5A 5IKCB 1NC2A 3LD8C 2F58H 4JFYA 1IVLA 2BSSA 3QQ3A 5LCVL 4B41A 3LEXB 1FCCA 4QOKE 2FO1A 2VLRE 3LIZH 3KNBA 4TQEL 4RWYH 3V0VA 2ZSVB 3QUZC 1NKRA 4M6NL 2LU4A 1O5DT 3BKCH 2XZCL 2DLIA 3E6FB 3L3IB 3RQ3A 5A2LH 5GPRA 2EH8H 5DMGC 3ARVA 3F7PC 5FO9A 2CSPA 1PKQE 2PETA 4L8SA 5FM5O 3DXAE 5E8EA 2NW2A 3MRQA 1I3GL 3QIBD 4M7JH 2LFGA 3U7AA 5ILTL 2L4OA 1H3TA 3DX6A 4RA3A 2CLZA 3OL2A 3IYLW 2VIRA 4R4BA 3MRNA 2VQUA 3WIFA 4N1EA 4RAUB 3GEWB 3TV3L 1FRGH 4EN3D 5JO5B 4JFEE 4JJ5A 3EFFA 2X40A 1P9MC 1EFXB 3OZ9L 4M5ZL 4MXVF 5BRZA 3RBGA 4HGWB 4S1SH 1OARL 1A6TB 4PGCB 3GMOA 4LRNL 3E8UH 3OF6D 1UKSA 2KUTA 3P4OA 3VXUA 1MWAB 3B9EA 3TNNB 3IDIB 3EDDA 4OZIB 4KK9C 1EPFA 4YK4C 4IS6B 1K8DA 1FC2D 2OMNA 1KPUA 4MX7B 5D7LD 2ZUSA 2EDLA 1XR9A 1KG0B 2BNQB 4OIAA 4P2RA 1GGCH 2HKFL 1S9XB 2OQJA 2ICEA 5T33L 1M7IA 1K5NA 2BSRA 1KIUA 4Z7UA 4I8DA 3W0WE 3NCYS 4M8QA 4G8GA 3CCHA 2EYRB 3NMEA 3JUYA 1L7IH 4EEEA 5FXCH 1M71B 5HHXH 1JYWA 2FL5A 4GAGH 2AEIT 4XXDB 5I1LA 4Z78B 5ESQA 1TQBC 5DJYB 5I71C 3DUUB 3V52H 4JZNA 5JQ6L 1JGDA 4QYOB 3HZYA 5MI0B 3KDMB 1Q9OA 3MJ8A 3S6CA 4Q9QL 2EO9A 4ERSH 1YJDC 4GQPH 4WW2B 4PGJA 2DD8L 2AJ3B 3CU7A 1KB5A 3DYMA 4UQ2B 5IMOB 4GSDH 4JJHA 3WHE1 5HGGS 4X4YA 2ZG2A 4GAYA 4U33A 3MV9D 1CFVL 1RUPH 3MOBH 4GKSB 2AQ2A 4HUXB 1MCCA 5AYUL 4X80H 4MJIA 5D2LA 1KACB 4JKWA 2VE6B 4P9HL 5C0RH 5KSAB 4O4YL 4OD3L 4NT6A 2YA0A 5J0BA 4A2MA 3T3PF 4R97C 4BH8B 3RA7L 2AXFB 4ELMB 5GGRB 3V0AC 1NGWB 1LO4L 2BOBA 4ZOEA 3T65B 2YKLH 3H9ZA 5DJ8B 4NO2B 4U1MB 1E27B 1EEUA 1DDHA 5T5FH 3ZKXC 3MXVL 4XP4H 3QDJD 5L2KD 2FRGP 3P2TA 1TIUA 4JHWL 3VGFA 5INDB 5JW4Q 1FL3B 1LO2H 5ETUB 3O6LL 5DLML 2R69H 1OAXL 3MO1B 4HJ0D 1FYTD 2O5ZL 2DN7A 4L3EA 5I76B 1TZGH 1FVCB 4JM2D 1RUQH 4OUUB 3TN0C 4PRDA 3PWPE 3C2SA 3KPMB 4JEGB 4FFYH 1IZJA 1SVCP 1BVKB 4AJ0A 2FDBP 1F8TL 4JRXB 3MBED 5D7SL 5I8EA 3I3DA 1LHZA 1FL5A 1KB5H 3ULUE 2EYSB 1CDJA 4PG9B 4Y4KD 5GS2D 3SDYH 3BISA 5BW7C 2FJGB 5BS0B 1DUYA 1LDPH 1I1FA 1JYNA 3MRHA 2ENYA 4ZOAA 2MKLC 4WV1B 1KGCE 1FBIL 2DQTL 4FQ1H 4F3FB 1A7BA 1HZHL 1I8IA 1RVFH 2Z8VC 1JGEA 4HC1A 4MNHB 5EULV 1DFBH 5E6IC 2R9HC 4KJWD 4RX4A 2VLKA 1NDGA 1X6LA 2EECA 4Y4HA 5HVGB 3CJJA 1CXHA 3WJLC 4XC3H 3OKOB 5EBWB 4AM0A 2XV6B 5KW9L 2HN7A 3U36A 1RU9H 2OP4L 4H8WL 4QWWC 4DK6A 2DD8H 3OG6B 3EYOB 1KCRL 1CD1B 2D03L 2ZOLB 4RDQF 1AH1A 1BJ1J 3EFDH 4IMKA 2R1YA 3REWA 4NDMB 4XMLH 4Q2ZB 2GYSA 4BQ6A 3C08L 3TIEB 4ODBD 5I1JH 1HSBA 3UAJD 3WFEL 2VDOL 3MOAH 4G8FA 3KS0H 3IJHA 4KMLB 3Q1SL 2NZ9D 7CGTA 1NCUA 4XPHL 4WCYL 5JR1H 2LU3A 1LP9A 1WTGT 4L4JA 5ANMB 3QZWG 3L7EB 4WO4B 2E5EA 3GGWB 3Q5TA 2J8OA 4OD1L 1ZLWH 5FUOH 3DSNA 3BJLA 4DGYL 5J12C 2Y06L 1JBJA 4X4ZA 3BE1H 3HNTL 3NCFB 4XAKE 4BUHA 5C0FA 3DX9A 1EFXD 5D96B 4CL7A 4DTGL 2VXTL 3WKML 3FFCA 2P5EA 1YEHH 2ZUQB 4MA1C 1DLHA 3CSYA 4ONHA 5FCSH 1BZ9A 3TEUA 2M1KA 4K3EL 4U6YA 3UPAA 2AK4E 3OR7A 4DVBB 5JHLL 4F57L 1A21A 3UMTA 1MHCB 1H8OA 4LDOB 3O41A 4O2CB 1LQSR 4HLZG 1CGWA 1QFOA 2X4TB 2C4FT 1MQKL 2WLZA 1E4KC 2BNQD 2YPLA 4YHPA 5F71A 4JFDA 4O2FA 1OWRM 4F7TB 1FFPA 3C5JA 1P4IH 5DRXA 5HYIA 1RIUH 1JWUA 4MAUL 1P6FA 3IU4L 4R8WL 1S8DB 3B4NA 3D48R 3HPJB 4NM8L 5CIPB 2QSCL 3BP4A 4M1CD 4CVUA 3HE7A 1A7PL 4OZHB 3QQ4A 4M8VA 2RHEA 4X6EA 1YY8B 3SOBL 1OF2A 2Q8BL 1T1YA 4Z7VE 1ZE3C 4GBXA 3PF2A 4N8VG 4KJPC 4X6DB 4W4OA 1MCQA 1FBIH 2XTJB 1WVZA 1H9VA 1AQKL 3SY0B 4RFNB 1DQDH 5L8KB 5DVOA 3REVB 5IHZA 3EYQD 1HYRC 1U3JA 1RK0A 3BZ4A 3SO3C 5C0CD 2EKJA 3R1GL 2VN7A 5I6XC 5KSAD 2F8VA 3G6JE 4NO3B 2OP4H 3LH2L 1D5IH 2CDGB 5B4MD 2MSPA 3VI4E 4OFYA 4A6YH 3HPLA 1KENH 1KELL 5F1NA 3RWCA 1OD7A 4XMKH 5CZXD 5EOCL 5J11B 2IADA 2OL3L 5F70A 3BZEA 1BQLL 5MENB 2A73B 1MH5B 2ED7A 2QTEA 4IJ3B 4OIIL 4E0RA 4C83A 4KK8D 2AK1L 2JJSC 5HHMB 3PQYE 3H9SB 1HQRA 4XPHH 4M1GH 2GITB 1VGKB 3EW3B 4Y1AA 3CSPA 1BQUA 4U3XA 2AV1B 4NC2B 3L6FA 5K9QI 5SWQA 4OD1H 1B88A 5TQ2L 5D1ZB 3O6FA 1T80A 2GJ6B 4PJFB 3TLRA 1PKOA 4EUPG 4AEIL 4PJBB 5DUBB 5C9JA 5E00B 1KNOA 4DTGH 2VXTH 2FIKB 4PJDF 4OTXL 1F58L 2X44D 2RFXB 3WUWG 2IPUG 1PG7L 3LKNB 4OZGF 5HHOA 1KIQB 1U8LA 4JRXD 4PJAA 5JW3H 1KBGL 4Q6IC 5MP6L 2VTFA 1DVFA 3QO0B 2R2EB 4JPWH 1QBBA 4EI5B 3PP3H 4F15B 4F7PB 3BAEL 1AIFB 4U1LB 4WI7A 3SDXE 5BS0D 4Z95H 1YPZA 4YHZL 1T20B 1OL0A 1XF5B 2PTUA 3IF1B 3CFCH 4V3DB 5B8CC 2BVPA 2W9EL 1MFDL 5E5MA 4HULB 3DI3B 3IU4H 3JV4B 4XVTL 5D93C 5MEOB 2OCFD 4FQXC 4PGDA 2AJSL 5DF0A 4J8RA 4M7ZB 5MEPA 3SOBH 1YYLL 4HH9B 4QO1A 1KCSH 3BD5A 4PB9H 4UNTA 3UTTA 5CBEA 1FZMA 5D7JC 4ZAKC 4PTTA 2H1PH 4FXLA 3TYFB 4C56B 4RAHA 2MCPH 4ISVA 5GS1B 1J0HA 1D6EB 3ES6B 4WFGE 5C0IB 3S4SA 1ZHNA 4WNQA 4JKKA 4QCIA 3RY6C 1CDYA 2N7BA 4CN6A 3OAYK 1DQJB 3UEZA 3WLWD 1E4WH 3RVWC 2HT2C 4U3CA 4XPGL 1C5DB 2B5IB 2E6QA 5CGTA 1U41A 4Y7MA 4ZUWB 5IBUB 2P8PB 3H7LA 1ORQB 1HH9A 1FSKB 4K3GA 1MI5A 5FAAA 5HYQA 4WO4D 1UQSA 2EDKA 3VWKC 2Z8WC 3G6DL 4XVSL 4X6FA 3UZQA 5IW6A 2WIIA 2GQHA 3C60C 1I85A 2VAAB 1EAPA 3R0MA 5GGQL 1IGYA 1X5HA 3RUGA 1CFQA 1UXSB 1A9EA 3ZSSA 4NJ9L 5FM8A 2NY5C 5FO7B 2ARJB 1TZIB 1PX4A 35C8L 4OIIH 4ZQKA 5DD5H 3EYVB 3JVGC 1DBBH 4HQQH 5CSZA 4ODTL 4R90H 2GFBB 2YR3A 3QCUH 1FNEB 1HOCB 1NGZA 2YMXL 4P4RA 4XPTL 4EJ1C 3MJ7B 4JFOB 3C2AL 4GRWE 2DTML 4UUJB 1IEHA 4QHLB 1BECA 3IAQA 2BY0A 5FYLD 3P30L 2VRAA 3SCMA 1XGPB 1JWMA 1YN7A 1VFAA 1UZ6F 3QFJA 1EO5A 2FGWH 2WSKA 2FCBA 1IKFH 4KROD 1QD0A 4N0FB 2WM0A 4XCNB 1YNTB 2O61B 5IQ9B 1MSPA 3SE8H 3EJYD 4PGBB 1KBGH 1BWWA 2AJUL 2A2QT 3UBXB 3QEGH 2Y7QB 1YYML 5HI4C 3HE6B 2IH3B 1JF1B 3STZB 3T09A 4GRMA 2DJSA 3UTSB 3SBWA 5TFSL 4RGNE 2D4FA 2ARJQ 1JZ4A 1ZLSH 1R5IB 3UPRB 1ITBB 1CS6A 5D1XA 1HEZA 5GS0C 5I1EL 3F58H 5B21A 2XTJD 3E6HB 1FFOA 3BN9D 2A83B 3QIUA 4KDWA 2PW1B 2BVQB 5F8RC 1RHHB 2A77H 3HUJA 3OXSB 4YHLL 3MZGB 3RDTA 1JPSL 4OBRA 4JQXC 4M00A 3S5LA 5T1LB 1UACH 3VXTA 4G6KL 3BPOB 4JFXB 1AJ7L 3FO9A 1A6UL 1AXIB 4UDTA 5CEYA 4OCXL 3Q5YA 4UU9A 5CFHA 2JCCB 3KAAA 3RHWK 1VERA 3MYZA 3Q6GL 5FYKE 3QEUB 3QUYA 2IANA 2EDRA 2DBLL 2Z31C 4JDZA 2VITB 1SYVA 3CFEA 4GXUN 4JFZL 3VXPA 2P5WA 2FECL 4YUEH 3U4AA 1A4JA 3BQUA 3H9SD 5DJZA 4Y2DD 3QG7L 4U4BA 2F53B 1E28B 5L2JB 2GSIB 1WWAX 1UJ3C 1G7HA 1QRNE 1ZT7A 2C1PB 3MRBB 5CD5C 2GJ6D 1ROWA 4P2QA 1IGJB 4PP8C 1W0WB 1U8PA 2FECI 35C8H 1IE5A 3PGDA 4BKLB 5IB3B 3HZMA 4DCQA 3VRIB 3PABB 2VDLH 3MV7B 5I1CL 5IOPA 3NA9H 3G5XB 1J12A 3EYSL 3U2SB 3PWJB 1B4RA 1LO3H 3BI9X 5J57B 1MVFA 4EI5D 2X4RA 3IDNB 4DKAA 1IM3B 4U7SA 1YEDB 4M6ML 2E9IA 3BRDA 5DI8B 4EDWH 2RR3A 3WD5L 3D3VE 4WI5A 5FYJE 5IB4A 2Y5TA 1I7TB 2BNRA 4WI6A 3EDFA 1OTUD 4HX1A 1XT5A 1R5WB 2APVA 3MRRB 4X6CB 1S7TB 5CKGA 3O8XB 3Q6FA 1QNZL 3NIGF 2YD3A 3LCYA 5KJRH 3LKQA 4BSVA 3FT3A 1K8IB 1YYMH 4JM2F 1N6QH 3VJ6B 3GB7A 3T04D 1CLCA 4POZD 4LGPB 5HGAA 4NM4H 1HSAB 3MFGB 2XWTA 2B4CL 1A1NA 3KJ4C 1CBVH 4C56D 2HFEB 4E41A 4GS7B 3V6FB 4LSUL 2HTLD 2ZUUA 1V7MH 5C1MB 5C08E 1WEJH 2E9BA 5TDNB 1BGXL 4G7YH 3I6LE 3PWNA 5F1OB 1A2YA 1GGBL 1YEFL 1U8KA 2UY6A 1N7ML 1A4KB 1BX2A 2ESVE 4LSTL 2QQKL 3F7YA 3VMOA 3C87A 1KCUL 5ISZE 2ZUVA 3IRPX 4PJ7F 4I13B 4G6JH 1WZMA 4OLZH 4GW5B 4JG0L 3DRTA 4OCXH 4CADA 5IJKA 1X5AA 3F65A 3FHAA 5HGBA 3Q6GH 1BWMA 3U4EA 1J1XL 4GG6E 5DD0H 1NMBL 2BXZA 4HT1H 2AABH 1JNJA 4NRXA 1DCLA 4G8IA 5CHNA 3CLFH 4GXVL 1CICA 3EHBC 4PJHE 1GGTA 4FZ8L 3KYNB 5EBMA 5E94A 4LIQL 3OX8B 1SM3H 4YGVB 2F54E 1NC2B 1CN4A 3SDAC 4JFYB 2BSSB 5C0ND 5JLZA 2VXSL 1OT2A 3SGDH 1HI6B 1UB5A 4UTAH 3KNBB 1KPRA 1P9MA 3BVNA 3FQXA 3KGRA 5TF1L 3V0VB 4OSUH 2OI9C 1ZSDA 4Y5XC 5F89A 2JJTC 3C5SB 2FX7L 4N0CA 3WJJA 1KJ3L 4GW4A 2R0KL 4NBZB 4L8SB 2QSTA 5E8EB 2NW2B 1GZPA 5HYJE 3MRQB 2APTA 1YEEL 4NUJA 1EMTH 2V17H 1RZIA 5D9SA 5ACZA 2IPKB 4KQ3L 3DX6B 1MFEL 1HWHB 2CLZB 4M6MH 2IPTL 1NFDB 2VIRB 4R4BB 5ICZA 5F1SA 3MRNB 3WIFB 5SWZD 2JKXA 4KUZL 3EFFB 4PJAF 4TNWF 2X4NA 3M8OH 3GMOB 3FT4A 1C16A 4JREB 2V5TA 5SWSA 5D1QC 2R4SH 3K8LA 5HHQB 2ICWA 3P4OB 3HI1B 1WISA 2DM3A 4UINL 2P8MA 2EDOA 1D5ZA 3CZFA 4QRPA 3VXUB 4LK4A 3VRLE 1JTOA 4C57C 5T1LD 1K8DB 1QSFA 2AKRB 1XR9B 4ZO9A 4P2RB 2AXHA 5EO9A 2Q3ZA 1VFMA 5L0QB 4LDEB 1UM6H 3T0XA 3VFRB 2ICEB 2L0DA 2DICA 3CK0H 5DJAA 1L9NA 4RGNC 3FRPA 1M7IB 3K74B 4I0CC 1K5NB 1I9IH 2BSRB 2NY3C 1Z0NA 4Z7UB 3NGBC 4M8QB 2EDEA 5IF0A 3C9NA 3CCHB 4G8GB 4LLDA 2EXWD 3UTQB 5I1LB 3IXAB 2QQKH 1JGDB 2IFGA 3HZYB 3ARDC 2F53D 4X7EC 1Q9OB 1DQML 3MJ8B 5TH2A 4TNVK 5GXBB 2VUOA 2BX5A 3TO2A 1GOFA 5IFHH 1AC6A 1EJOH 5IVXE 1KB5B 4ZG1A 4LCIL 2E7BA 4NQSA 4WI2A 5T3ZL 5GGTL 2VDNL 4LSQL 1X4ZA 3MPCA 1CXKA 4Z5RB 3NPZB 4X83A 4GAYB 4X4YB 5JOPD 1FNGA 3KYKL 4KPHH 2NY7H 4DKEH 5DEFA 1UCTA 1NL0L 5EORH 1D5MA 5HYSG 3OR6A 4MJIB 3MZTA 2APBA 3MV7D 4L8CA 1X5XA 1T7WA 1QHPA 3RUGF 4PBWD 3RX5A 1R3LA 2VXSH 2BOBB 4NNXA 3SE3A 3KPSE 3FJTA 5DHVH 1T89A 3ILQD 4LCYA 2CK2A 2CRMA 5TF1H 5E2VH 3EO0B 4Z7OE 1ERNA 4PPTA 2C3VA 4LLAA 5HDQH 2ZCHL 5J3HC 1YJDH 3GMLB 4L4VA 4NC1E 1C1EH 3GKZA 3O8XD 4MA7H 3D69B 1IBGL 1BF8A 3ARZA 3CXDL 2ERJB 4HG4K 5LQBL 1H5BA 3T0DA 1OGAA 1NQBA 4XBGA 3EYFA 5JMRA 5F7HA 4L3EB 5FV2A 5HYFA 1MVUA 4PRDB 4MJ2A 5EZJA 4Q97A 5DRZA 3RVVC 1CLOL 1N5AA 4HIEA 3HC3L 3BGFB 1T1ZA 4JFFA 1K3ZA 1S9WA 5E6IA 3CH1A 3HI5L 1FZKA 4FXKA 3WO3B 4LPUA 4K94H 1XGUA 1X7QA 1GGYA 5I8EB 5B3NA 5IUSA 4MWFA 1FL5B 1HILA 3WJLA 1PLGL 4HMCA 5FK9B 4OCWL 1OGTA 2E8YA 1UWXH 1TQCB 4R4FL 3B83A 3F7VB 3MRHB 4X7SL 5D2NE 3MRPA 4E9LA 3IVKB 1CI5A 1JGEB 5JW4R 2Q3AA 1FN4A 1RK1A 4NP4L 4KWUA 2EDWA 2VLKB 4M7LT 1NDGB 4NIKB 3GKWL 2A0LC 1QLEH 1CL7I 4YXHL 1IGIL 2VKWA 3LKSB 1NC2D 1GHFL 5GZOC 4AM0B 2HN7B 3MV9E 5I2IA 1DANU 5ABDE 3RZWA 5ECJE 1WQVT 1QBAA 5IFJA 2H2SD 4OGYL 2R1YB 3REWB 3K4AA 3TBTA 2XICA 3KLHD 3MGTA 2G9HA 3KYKH 2ED9A 1BFOA 4KK6C 5K59F 1HSBB 4OZFA 1NGPL 4G8FB 3LV3A 3IJHB 4MS8C 4QTIL 1ZTXH 2V9QA 5C0JA 4P3CL 1LP9B 5DMIL 2MKWA 3O45B 2LE9A 4HCRL 2YHGA 3TC9A 5B3JF 5IHUL 5ENWA 5IBTL 5IW1A 1F3DH 3PNWA 3BIAX 4XAWL 1JZ3A 4TUJA 1MY7A 1PEWA 1CFTB 4JY5L 5FIEA 5L2KE 4JPKL 4WU5B 5C0FB 3DX9B 5BZWA 2VXVL 3VFGL 4NQXA 3FFCB 2P5EB 4G9FA 4LARH 1T7XA 1DLHB 1FLRL 3CSYB 3LEYH 2AJVL 4A6YB 1BZ9B 3CXDH 3VXUD 5E5UB 3MX0A 2OJZL 4U6YB 3TBYA 3FQWA 1ZHKA 2Y25A 3OR7B 4IBLT 4MJ6A 2YUWA 3OGOE 1CG9B 5INCB 3SDCA 5C3LD 3O41B 4UDUA 2Y36L 4Y0GA 2IAMC 4HK0A 4XP1H 1B0WA 2Y4SA 4RNRA 1CLZH 2KZ1B 4FFWC 4P2RD 2YPLB 4JFDB 4O2FB 4YPGA 3GSRA 3MA7A 4ZS6D 1FFPB 1NAMA 5E6YA 3C5JB 1IZKA 5DRXB 1JWUB 1SEQL 3LS5L 2VWEE 3DROA 4HF5L 4PJ9C 2W07A 3BP4B 3HE7B 4G8GD 1WIPA 5LAXB 1BEYH 1A7RL 2OJEA 3OKNA 4X6EB 1TTFA 4CJ1A 2R2BA 1T1YB 4GBXB 5DMKB 1NGYA 4HPOL 4PB0H 5JA8B 2UZIL 4L9LB 5C07A 4DGVH 1TJGL 5CILH 5FM5M 3ZO0A 4M5YH 5IHZB 5KVEL 3V95A 4LLYA 4YDJB 4X6BA 1RK0B 3BZ4B 1IM9A 3L9RB 1L0YA 4MJID 3GMMB 1J0YA 3SEPA 1L8JA 4AENA 4NO0A 4MQXC 3K1DA 4APQD 1AGBA 3HNSL 5C2BL 1PY4A 4HJJH 1FPTL 3GSXA 5H37H 5F1NB 3RWCB 1Y6MR 5DSCA 2IADB 5H35A 4OF7A 3BZEB 3ULUL 1TJHH 2GKIA 3BPCA 4H1LG 4L5FL 1CIUA 4C83B 4YC2C 3SN6N 1UYWL 3RVTD 2ENSA 1HQRB 5GJTH 3RL1A 5J06A 4Y1AB 5F72S 1NAMH 4Z0XA 5IHUH 3TBWB 5TGBA 1B3JA 4UB0H 4ZTPL 1BAFL 3TT3L 1JNHA 1XGQA 5SWQB 2ATPA 5TDOA 3CUPA 3O6FB 1QFUL 4L3ED 1F3JB 3GO1H 3S35L 3MLVL 4W81A 4JPKH 3HC0A 4M9OA 2F5BL 5B8CA 1ONQA 1NCAH 2PF6A 5C9JB 1T21A 2VXVH 4M3JA 1MCLA 1KNOB 4XPFL 1I7UA 5FDWA 5DD6B 3VW3H 2NYYC 4PS4L 2IMMA 5HHOB 4RZCA 2GJZA 3BKMH 2BNQE 2OJZH 1DVFB 2YBRA 3VD4A 4NC1C 3LKOA 3QWOA 5L88H 3GSVA 3G9AB 4MVBC 4HIIA 1CGXA 4Y19B 3EO1A 4LLMB 1YMHA 1OQXA 1YPZB 3SKJH 4ZOBA 4QT5A 1I9JH 2BVPB 5F9OH 4HHAA 1SEQH 3LS5H 1RIVH 4LBEA 4HF5H 1R3IL 4YIQA 3CXHJ 4PTUB 4PGDB 4J8RB 2VLKD 3VFOA 5MEPB 1A7RH 5IW3A 4F9LA 1X5IA 2DQUH 3UTTB 1FZMB 3TT1H 2I9TB 4PTTB 1LNUA 3RGVB 3V0WH 4HWBL 4HPOH 3AXLB 2UZIH 3RAJL 1W8NA 2X7LA 1A3LH 4ISVB 4FHBD 4NFCA 2XA8H 1AC0A 4U31A 3S4SB 1ZHNB 4WNQB 4MD4A 4QCIB 1P4BL 5HHVH 2DKSA 4CKVX 4HFUH 4PJGA 4W4NA 4OCMC 2KPNA 1S7XA 5GRZA 4ELME 5D2NC 1J0IA 4MQ7A 2FSEA 1HH9B 4BM7A 3EDEA 1GJIA 4ZFGL 1ND0A 3SE9L 2YC1B 1QPXA 1UQSB 5F7UA 3H9HA 2XQBH 4J3WA 4X6FB 3SKMA 4HW6A 1OAQH 5IW6B 5C2BH 1BJ8A 2WIIB 5LKNA 1XH3A 3MNZA 4DFIA 5HSFA 1RZFL 4LEXH 3T1WA 1EAPB 5B38G 1CFQB 4LSRH 1A9EB 4LVHC 4N5UA 3U9UA 1FP5A 1C08A 1N6VA 2AW2A 1MCFA 4ZQKB 3FFCD 2P5ED 2UWEE 3OAZH 3PXHA 4IDLA 2G5RA 1NEZG 2M8XA 1NGZB 1AO7A 3IU3B 2GEEA 4OCSH 1BBJB 3TYGL 2OK0H 4XCFH 4ZD3H 5B39G 5DK2A 1QFUH 1U91B 4DN4H 1JWMB 3HG1B 1CD9B 1KCVH 1VFAB 3F12A 3QFJB 1NBZA 2YXFA 4JVPA 4XPFH 5DFVD 1N8ZA 3D25A 4PD4K 5GJSH 5BV7H 1IILE 3H7BB 3O4LA 4Z7WB 5BS0E 1SBBA 4FFZL 1K6QH 3HE7D 3GJFA 4EOWH 3TFKA 3S37X 5KVGL 2Z93A 4H88H 5F3HA 1XFPA 2NY5H 5JUEH 4J4PD 4LAJH 3BT2H 2X42A 2DWDB 4GRMB 1NPUA 2MCG1 4XVUC 5E70A 2HJLA 2FWOA 4LLUA 2LABA 3HMXH 3OJDB 2HTKC 5D1XB 1HEZB 3BJ91 2C4XA 1H3XA 1RZJC 4LSPL 2Z31A 1FFOB 4UOW0 4G43B 3QCVH 3QIUB 4TRPL 3HUJB 3OB0K 1NKOA 5C71A 3RDTB 1JE6A 2VWEC 1ZA6A 2WBJA 3S5LB 3VXTB 5JPNA 1SBSL 3VD9A 3UTPD 3QRGL 4JGMA 1TITA 1JV5B 3FO9B 3F62A 4UDTB 5I15H 2PTVA 2F5AH 3WNOA 5CEZL 3RAJH 4PJ8C 1R3KA 4UU9B 3Q3GB 4YWGL 4LPWA 2A6KA 4OFYD 3QUYB 4AL8H 4NQVA 4AEHH 5ANME 2N1KA 2P4AB 3IT8D 4LNVA 1UFUA 3QXDA 1L7TL 1MUJA 1YECL 4JDZB 1MCOL 1SYVB 2FO4A 1NAKH 3CFEB 1CXIA 4HIHA 3ARRA 4QTHA 1QZ1A 2P5WB 3VXPB 5GS0H 1IEBA 1A4JB 1UA6H 3BQUB 2DL2A 4EVNB 1OSPH 1H15A 2ZZUT 5F6IB 3ESVF 5A43C 4YX2H 1G7HB 1Q0YL 1UEMA 4KRLB 1ZT7B 4NQDA 2W59A 4K9EL 2FHBA 3TJHA 3O6FD 3GJFH 2G5BA 4RGOL 4XB8A 4UTBL 4P2QB 1PDKA 1R5VB 4YH6A 3WSQL 2H32A 3MREB 4YE4H 1EXUA 2GHWB 3HZMB 4DCQB 5FYLE 4YHNA 2YPVH 2C1OA 1JNLL 3VCLA 4CW1A 4OIBA 5IOPB 3AREC 1DVFD 3MA9H 3MLYH 1J05B 1F6FB 3D2UD 4MDJA 5KVFH 4Y19D 3O3AB 3W39B 5A1AA 2H6PB 2VZ1A 2Y5TB 2BNRB 5DJDA 3TIDA 4PRAA 3FTGA 4M93C 4OZHE 4HX1B 1ZLUH 4M02A 4J23A 4LAQL 3EZ8A 4FZEL 5C09A 3T0EA 4RSVA 3Q6FB 2DQGL 4YBQD 2CUIA 3OKEB 4FFZH 3LKQB 4BSVB 3FT3B 1S3KL 5IG7A 4KGJA 2H2PD 4X6DE 3B3IB 5EUOF 5EO1A 3GB7B 2XTJE 2I60H 4ZXBA 1KFAL 3UTTD 2DQCL 4HZLA 2NY6B 4XNXH 4RMVA 5DQJB 5HGAB 3RGVD 1UM4H 3AGVA 2XWTB 4U6VL 1LD9A 4ZDHA 3C5ZD 1FE8H 3O3DA 4E41B 1JZ7A 1FGVH 2R0WH 3VXMA 4P0DA 3BHBA 1MCIA 4MA8H 1BOYA 5I9QC 3MV8B 3CNKA 4N90E 1FORH 1DQTA 3NACL 3PWNB 5IT2L 1A2YB 4NQEA 3LS4L 4S1RH 1U8KB 3GSNL 4KKAC 3RNQB 3OBAA 3VG0L 5D5MA 1BX2B 4D9RE 5MI0C 1EHLL 1BVZA 2D2OA 4KXZI 1SBSH 2FB4L 4XMPH 1J11A 3EO9L 4WW2C 3NAAL 2BVYA 4HXAL 4LF3A 5MENE 3MRIA 3BDYL 3OXRA 4CADB 2DYPA 4PLJD 1YY9C 2GI7A 3KPPA 5HGBB 5HHME 3U4EB 3QUXA 3H9SE 1MCEA 4ZUVA 3CFDB 2JJTA 1OB1A 1L0XA 1MNUL 3LPWA 3BWUC 3JWOL 4NRXB 5DEGB 4G8IB 5CHNB 25C8H 2AI0L 1MCOH 4GQ9L 1IFHL 4KDVA 1CICB 4P2OC 1KYOJ 1KULA 5KSAC 5E94B 2GJ6E 4Y8DC 3SDDA 4PJFE 1S7QA 5D4QA 4O51A 3KWWB 2VLJA 4XCCL 4PJBE 3BYYA 1UXWA 4M62H 1TNMA 4TVSa 5JLZB 2NQCA 5T5NF 1HINL 1UB5B 1DEEB 5K9JH 3J8F7 1M6OB 1BD2E 3BVNB 1G1CA 1KPRB 3FQXB 4RGOH 4UTBH 3VU2A 3HG1D 3I50H 5ALCH 3QH3A 5F89B 2AGJL 1DLFL 1S5IH 3QFJD 3ZHDA 4U6HA 3HZKA 1Z0MA 4GW4B 3PWVB 1H3PL 1XF2B 3PWLA 1FGNH 2PR4L 4YK4B 12E8H 1X5YA 1GZPB 1CD8A 4WY7H 4NUJB 4DVRL 4HUVA 4V2BA 5D9SB 5ACZB 5FYKL 3NTCH 5JW4M 3ARFA 4OQTL 2OL3A 1UC6A 3W82A 1SY6H 2UYLA 5C0AA 2VDRH 3BX7C 3EZJB 4ZFOA 5D1XD 5ITBL 4NN6C 2X4NB 1AI1H 3GJEA 5D71H 3RIAK 1C16B 4X5XA 5SWSB 3QIWA 4JRWA 3CX5J 3PHQA 3QIUD 2ICWB 1G6RA 2P8MB 2LV4A 1D5ZB 4QRPB 43C9A 5I71B 5DHVB 2CR6A 1C7TA 4C56E 2FD6L 4MDIA 5CZVH 3RDTD 3ARDA 1A02N 1PX3A 3S88L 5AAMA 3MC0A 2B2XL 5C0DA 1IAOB 1XAUA 1JTPA 2AJXH 4RMQA 1MF2L 4YDIL 3BMVA 4ORGA 2D0FA 3O0RH 5D7IA 1JFQL 4WV1C 2NX5A 1AXSA 5EO9B 4ESKA 3VXSE 1S7UA 4LCCC 4EIGB 3QUYD 5KG9A 1IJ9A 4PRNB 4PLKC 4WUUE 4GRWH 5IF0B 3C9NB 3OV6A 4LLDB 3BQUD 3QQNA 2JELL 3I2CH 1EHLH 4R97B 4C58B 1FNSL 4TUKH 4HWUA 1UKTA 5FYJL 5MEQA 5TH2B 5E6ZA 4PJGF 3OWEA 4RRPG 3TO2B 1RUKH 2DDQH 1P84J 4PRIA 1SYSB 3QSKB 5FA4B 1TVBA 5EFIB 4P2QD 1ED3B 3BSZL 1ZLWK 3MRKB 4XP9H 4L4TA 2JB5L 3PGFL 4RMTA 4IIQA 1Z9MA 1F90H 1IFHH 4LPXA 4H25A 5DEFB 3ZKXB 4CU6A 1D5MB 3OR6B 1V7NL 3MODH 4ODSL 5AUMB 5DK0B 4L8CB 1URLA 1RHFA 4Q9RH 4BZ1H 1R3LB 3EYUL 2V9RA 4NNXB 1HINH 1G6RH 3BD4A 4M48L 1A1MA 2B1HH 3SGJC 4ONGL 4P23A 2BNRD 1UJTA 4NJAL 1Q9LA 1DLFH 2C3VB 2IQ9L 2ZUQC 4NQTA 1QKZL 2G60H 4M7LL 4S1DD 1XR8A 1QSEA 3MCG1 4L4VB 4OCRH 4U3HA 3KLAA 4JO1H 4LKCA 3UTSE 3MUJA 4M61A 4WFHD 4ONFH 1JGLL 1H5BB 4N9GB 1MCPH 4DVRH 1U58B 3H8NA 2EC9T 1OGAB 1X5JA 3UJIH 4XBGB 3AVEA 3EYFB 5GGSA 1KEGH 3FN0L 1U6AL 1BFSA 2NY6D 3MLSH 1CE1L 2ZCKH 1RZ8A 1MVUB 3TWCH 2KKQA 5E99H 3VGAB 4U1HA 5EZJB 4UMGA 4W6XB 1KLUA 1N5AB 4HIEB 4JFFB 1T1ZB 3OKLA 3EJYC 5E6IB 2J6EL 3CH1B 3RZCA 5EH1A 2YD8A 4FN0A 3DVIA 3MV8D 1L6ZA 1XGUB 5E8OA 4QEGA 4MWFB 1YMMB 3U6RA 1HILB 2WQRA 2JCCE 3V8OA 1OGTB 5DQDL 1O7SA 1YN6A 2HA1A 2BHZA 3I84A 1S9YB 5KVDL 3F8UB 3VFMB 5CSGA 3QUZD 3BN9C 1F45A 4RFNC 2D4DA 4NWTH 4YR6A 5CBAA 3O2WL 3LHPH 3MRPB 3NA4A 5F6HJ 3LDBB 1RK1B 4LMQI 2XACC 5DMGD 1WCBA 1ADQL 3L7FA 1CICD 1NCCL 2Y6SC 3BD3A 3GI9L 5AZEH 5HGDA 4ZYKA 1J5OL 3MLTA 5C2UB 1QBML 5FYJH 4JO4L 3CLEH 4PYHA 1NMAH 5I2IB 1JK8A 2J88L 3NOIA 1YC8A 4QHUA 3MLZH 4FABH 5IFJB 2CMRL 3AMKA 5GRVK 3MV7E 2OM5A 1B0GA 2XXCB 2YPKA 3TBTB 5J1AA 3MGTB 1RMFL 4IJ3C 1BFOB 4OZFB 2EICA 3LV3B 3GSOA 3ELAT 5DA0B 1MCNA 2BOCA 1BLNA 4KK9D 1XCQA 1ZGLA 3DYOA 3D85A 5IW1B 5C9KA 3PNWB 2QSQA 5D1ZC 2ADIA 2ZKHL 3EYUH 3QUMA 2DIBA 4TUJB 4X6CE 4P2YA 3GMQA 4J3TA 1YC7A 4N5EA 2XOTA 1KB9K 3PP3K 1DJSA 3ZDXE 1T3FA 4Z7NF 4QRQA 1H0DA 5BZWB 1I4FB 2IQ9H 1JF6A 4NQXB 4KKNA 5C0GA 2CIKA 1JHKL 5SWSD 1AE6L 4G9FB 1O7VA 1YEJH 3E1F1 4OI7A 1TTGA 4X7CC 3QPXL 1WWWX 4QRPD 5JXEA 3TBYB 1NCWL 4CN4A 4DZ8A 3QPQC 3FQWB 1ZHKB 2FR4B 3NIFF 1BPVA 4F15C 4MJ6B 2DAVA 4NPYA 3SDCB 1MFNA 5GIRA 2ICES 4UDUB 4MYWB 4HK0B 3IFPA 4PRHA 1CE1H 4B53A 1F13A 3DMMC 2ORBL 3KYMB 5IIEA 1RZ7H 2DIAA 3GSRB 3MA7B 1NAMB 3WIHL 2ZJSL 5ACLA 3NH7L 2OMBA 2IJ0C 3I6GA 1HNGA 3SO3B 3NIDF 1CGYA 5F7WC 3MUGA 4PDCE 1SMOA 4HWEH 2OJEB 1FVEA 3GK8L 3OKNB 5KN5A 2BERA 1IAIL 2R2BB 4POZC 4JQIH 2WW8A 5DGRA 4AEEA 1UM5H 4XVJL 4C55A 1NGYB 5EWIL 1HH6A 3A6CH 3PGCA 5C07B 1CFSA 3K2UH 3NCCB 2VQTA 4OGXH 5BOPA 5DR5H 2OZ4L 2B5IC 3QUMH 3JTSA 4KGLA 1IAII 4X6BB 2CLRA 5TE7L 2CUMA 1XGYL 1IM9B 2BHYA 1FNHA 3WDJA 2WUCL 4PY7A 3JWDC 1T7ZA 3CMOH 4JO4H 4S11A 4AENB 3IGAA 1NANI 3FB5A 1BQHB 4G80A 1AGBB 3QG6B 3GSXB 3BH9B 3V7AG 5DSCB 3T0AA 5H35B 3VGHA 1DZBA 4KJQC 3P3YA 2D31A 5AG9A 1KN2L 3BPCB 3FO1A 5DZLA 4Q6IB 1W72L 2X5PA 4JQVA 3W11D 5I1HL 2P7TA 3PJSA 5CCKL 3ROLA 4YBLC 4MVBA 2R2CA 3F7RA 5BRZE 4JLRA 1JNHB 1XGQB 4OLXH 4FMFA 1OGAD 1GAFH 1OAYL 1X44A 2ATPB 3LOWA 1HXMA 5TDOB 3CUPB 3VFNA 3WLBA 2YWYA 3HC4H 3HC0B 5CJOL 4X4XA 5B8CB 1ONQB 4LFHD 4QXUH 4PREA 3VXUE 3CVHL 1T21B 4LVOC 3HNVH 1E6OH 2XZAL 3LAFA 5IBUG 1I7UB 2N56A 4JFFD 5FDWB 5E6ID 4BYHA 4LRIA 5C6WH 4WHTA 2GJZB 1QYGH 4P2RE 1NCWH 3FCTA 1YMMD 2YBRB 3HE6C 3LKOB 3QWOB 4ZAKB 5TE4H 3CFIC 1B0RA 4JVWA 3C8KA 3MTRA 4QXWA 2VN4A 1EK3A 3EO1B 4Z7UE 5BJTA 1YMHB 4KKLC 3V9FA 1YEKL 4G8GE 4X4MA 4QT5B 1E4JA 4S10A 1ZA3A 2IFFL 3WIHH 2FJHA 1C5BH 5CZKA 4HHAB 3VRJB 2IEPA 4OZ4B 2WNGA 2EKSA 2GT9A 3LEVL 2DQEH 2BXYA 4YIQB 2O5YL 5LXGL 1A0QH 5IJVA 3SPVA 4X5LA 2X4PB 3VFOB 1A9BA 4H20L 3BPOC 1CVSC 3QEHA 3GMNA 3JSSA 3TF7C 1I8LC 5BV7B 2DQIL 1B2WH 5DD3H 4UOW1 3DX7A 1AKJA 4MJIE 5D2LE 2YOCA 2VLRD 2DQHH 3KPQB 5DUML 3AAZA 4P49A 3UBXG 4PP1C 3PDOA 3PG2A 1KN4L 2GJJA 3U30C 1S7XB 5IP4A 4FQIH 3BEWA 5FO8A 1C12B 2H9GA 1NCDL 2QV2A 1ND0B 2PXYA 4UV7H 5DK3A 1J0ZA 1TETH 4J3VA 1YEGH 4FP8H 3SKMB 4M7KL 4JN1L 3RJQB 1XH3B 1N0XL 2P45B 3MNZB 4BSWA 3S97C 5ADPL 4NNPH 4OFDA 1JPGA 3BESR 5CWSA 5AEAA 5E8NA 3U9UB 1V3MA 1C08B 5C92A 4DAGH 1QPPA 3G5VA 4F58L 4G9FD 4KVNH 5KZCB 4L3EE 5GHWH 5DTFA 1G7MA 1UCBL 5JTWA 3E3QA 3N1PC 1S5HA 5GGTA 15C8L 2AK4B 3QZWA 4GH7B 5DK2B 4KJPD 3D39A 2QHRH 5D8JL 2NLJA 2DLEA 3ZT6A 3HI6L 4JCMA 3F12B 1WAAF 1NBZB 1KF9B 3N85H 2CRZA 3D25B 2FYYA 4IMLA 1G7JA 3OPZH 5I75B 3O11A 5IHBA 1YQVL 2E7CA 4AEFA 1JWSA 5D70L 3GJFB 5IMKA 3GFUA 2E8ZA 5F3HB 4OB5L 4HBCH 2BHUA 2R0ZL 4IRJA 3LN4B 2QQLH 2HJLB 2FWOB 2QSVA 3GSUA 1P7HL 3HLAA 1BMGA 4LLUB 1I3RB 2DQFA 3BKYL 4GS7C 2VLKE 3OGCA 2E7LA 4TSBL 1L0QA 1MIEH 2CGRL 2Z31B 4BA8A 2QKIA 4QXGL 4B7LA 1H3UA 1FYHB 5E2WL 3ARUA 1F4WH 1OSZA 4MCZA 4XP5H 3MRFA 2Z9TA 4H20H 3UX9B 4PUBL 1HYSD 5JPNB 4Z76A 1UJ3B 5I19L 2DJ4A 3CAFA 2QBWA 2D0HA 3T2NH 1MWAL 4OLVL 4HKXA 2XI9A 4BQBA 4QRSA 1VGEL 5I73C 5FEBA 2A6KB 3LVEA 3UTOA 2GY7B 1Q0XL 1RZKC 1LP9E 4JE4B 5EIIA 5DUMH 4GG8A 5DJCA 3GRWH 1FVDA 4AH2A 1MUJB 2X41A 4O9HL 4QTHB 1NGXA 2BVEA 2GIYA 2R56L 3AS1A 4QXTA 1T22A 1PG7X 1RZJH 4WI9A 1H15B 1MEXH 4GO6B 3RU8H 3U79A 3HKFA 2EIZB 4QNPE 2H2SC 2P5EE 1INQA 3FFCE 5E9DA 2A1WL 5FUCE 1AGFB 1K4DA 2G5BB 4K7FA 3KYOA 3ZKNC 4G6AC 3SJVA 4EXKA 4B0MM 3N50A 5E2UL 1EXUB 2C26A 1XZ0A 4KC3B 1RFDH 2HKHL 2VL4A 3PWPD 4TSCH 5CJBA 1MIML 4FQXD 4L8SC 4YHNB 3QXWA 3MNVA 2C1OB 1OAKH 3VCLB 2V2XB 2YPLE 4JFDE 4HS8H 5D7JD 4ZAKD 1J1PL 2R29H 1AD0B 2XZZA 4M03A 5HY9A 5FECA 4MDJB 4KTEH 1CZ8L 3KJ4B 5D8JH 1EGJL 1KIPA 4LSVH 4F7CA 4G6ML 5DJDB 3TIDB 3SDXB 4PRAB 3UYRH 5F3BA 5I74B 4KI5E 1K2DB 2EDFA 5I16A 1A7NH 5C09B 3T0EB 4I3RL 3RVWD 3KPRA 3GM8A 4KY1H 1CTOA 5E56A 1J87A 4XPBH 3QNXA 8FABA 4JRYB 2W65A 5IG7B 1G0DA 1HQ4A 1QRKA 3WUWA 5EO1B 3VI3E 4M6OH 4ZXBB 3VWKD 4HZLB 4LLVA 2BFVL 5L0QC 4MAYA 1HHJA 2DTSA 2CIIB 5HJ3A 1NBYB 1LD9B 4ZDHB 1CL7H 1LO5A 1JNNH 1VFBA 2CRYA 3WXVH 3VXMB 3B5HA 5T1DL 5GRJL 2WWMC 3WE6A 3JXAA 1P7QD 3CPLA 1JIBA 4YEFA 4NQEB 3QUKA 3L5XH 1Q9WB 4DN3L 4WEUD 2Q8AH 2J8UA 5I30L 1N5YH 5C70A 1BFVH 3SDAB 4V3EB 3MXWH 4CU7A 1T5XA 1A6AA 1MWAH 2VXUH 4LF3B 2WV3A 4OLVH 4H0IA 3OXRB 2DYPB 4M4RA 2OI9B 2VH5L 4Y5XB 1JHLL 3QUXB 1Q0XH 3GIZH 2OSLA 3VFUA 1CU4H 4PJ5A 1OB1B 4CUCA 4OI9A 4Y1AE 3K2MC 4K2UL 1U2HA 4PRBA 1MCWM 4O9HH 5KS9A 5IVNA 1CK0H 2CJUH 2Y07L 3DLQR 4LEOB 2IH1A 5LBSL 1TENA 1T0NA 5KZCD 1IT9H 2GK2A 1S7QB 5HI4D 4O51B 2R23A 3LRSA 2VLJB 1MJJA 3V4PL 3BKJH 1A6VH 1S7SA 1UXWB 3NZ8A 1S7VB 3GMRA 5CD3B 2AK4D 1EO7A 2VDQL 4HBQA 4KTYA 5FHAL 5GS0D 5D72H 4NBYB 5HHOE 3QH3B 2VAJA 3O9WC 5D1QB 3S3PA 5K9OB 4PJEA 3GUTB 1N4XH 3O2VL 3HZKB 2VDPH 5GGVH 4L1DA 2ERJC 3FQNA 3MBXL 4PV9A 2C9AA 1YPZE 1GXEA 3GI8H 3TFKD 1IRAY 5JQHC 5IHLB 4HUVB 2WP3O 1FDLL 1JGVL 3C8DA 2VSCA 2QHLA 4JO2H 2HVKA 3RKPA 3O2DL 2UYLB 4ENED 5C0AB 3HCVA 3X3GL 5M7QA 4X9IA 4ZFOB 1DL7H 2A6JB 3D0VA 2MPAH 3BGFC 1UWXK 2NY3B 3GJEB 3T77A 4LVNB 4X5XB 1B90A 3QIWB 2Z31D 5JW5A 3ZDYE 3UTTE 5E8PA 2PO6A 2YUVA 3CD4A 1MRDH 2F15A 4KJYA 1G6RB 3GBLA 3DPBA 43C9B 4Z8FL 4E5XA 1CF8L 3B2VL 4MDIB 3ARDB 3BGAA 1EZVX 3UJJL 4N0UA 4WUKH 4O00A 2Z0BA 4TPRL 4POUB 2BFVH 4UNUA 4ORGB 1MHEA 4NSKA 1U8QA 5D7IB 4P5TA 4DQOL 1AXSB 3HB3C 1S7UB 1HWGB 2AXGB 5FYLL 2R0LL 3BXNA 4R9HA 5KG9B 5KSBB 4HMEA 5T1MA 1MI5E 3D6GA 1E4XI 3Q2CA 2Y5EA 4M1DH 1JZ5A 1G0XA 5D7KD 3PV7A 5KBNC 4HV8B 4Y4HC 1U3ZA 2IF7A 4R26L 4PJXA 5MEQB 5E08H 1RURL 1SVZA 2HT4C 4HAGA 4IMKC 3MV11 3P9MB 3D18B 1QRNB 1TVBB 2H26A 2VH5H 1M05B 1E6JL 2N4IA 5DZNA 1X4XA 5F6HI 4L4TB 1EV2E 4IIQB 4U1NA 1HXYA 4N0YL 4H25B 2EO1A 5JNYA 5E4IA 2Z35A 3DBXB 1MCJA 2OR9H 2VC2H 4HWBA 4RFOH 4ACPA 2BSTB 1EA9C 1FCGA 1UH2A 3UTZA 4BFIA 1L6XA 2EZ0C 4LGRB 3QFJE 5EU4B 3NZHL 1MPAL 1WF5A 5FHAH 1OP3H 4D8PA 4P23B 3SGKA 1QFWI 3W9DA 3L95A 5FUCC 1IGFL 4ZSOA 1VADA 1XR8B 1QSEB 2MMXA 4KTDH 5C09D 3T0ED 2E3VA 4LKCB 3QT2A 4M61B 7FABH 1NLBH 1G9MC 4NWUH 2YK1L 1BQSA 1BM3H 4JRYD 2XQYK 1R3HA 1GSMA 4OF5A 1VPOL 3ZTNL 1PZUB 3EGSA 2C5DC 4ZXBD 5AWNH 5FGCB 2AEQH 1RZ8B 3HUJE 4U1HB 4R96A 4I77H 2XKNA 1KTLA 4YFEA 5FKAA 2Y23A 4S1QH 1CT8A 3GDBA 2DF3A 4JDTL 3RZCB 1I7ZA 3EHBD 2MHAA 4PJCF 4PJIA 5DHYA 2V2TB 4NQED 3MOQA 4KI5C 3U6RB 3IJSA 5EBLB 3EJZC 4YHMH 3SDAD 2XZQL 4GBXC 2IANE 4TPRH 3N1GC 3RVUD 2QADC 3K80A 5BXFA 1YN6B 1A22B 2D7NA 4MXQC 3QQ9D 3HS0A 4W4OC 2DYPD 2P5WE 1JL8A 3BZFA 2D0GA 5GGUA 1Z6JT 3QUXD 5CBAB 5L6YH 5L9DL 2PTTA 4MQSB 5DT1H 4GG6B 2VOTA 1OAZH 1IQWH 1WCBB 3L7FB 2VSDA 5DJ6A 4FQCH 5HGDB 1WSST 4KZDH 4HZAA 2YRPA 3MLTB 5DD1L 4P2QE 3O6ML 2VLJD 1REIA 2YD2A 4OT1L 2F54B 1JK8B 2X4OB 1JZ8A 2WMPA 5CGYC 5IM7A 2KZWA 2FBOJ 4TSAL 1DSFL 1B0GB 1RV6X 2UV3A 5D1QD 1OPGL 2HLFC 5C6TL 1ZVYA 2JF1A 3GSOB 2FX8L 5I1GL 2BOCB 1BLNB 4YHOH 2BNRE 1B4JL 1XCQB 4KDTA 5I18H 3DV6A 1ZGLB 5AZ2L 5EA0H 1HHHA 3D85B 2IAMB 2ADIB 3O6FC 3U0TA 3VA6A 3QUMB 4ZNEA 3GMQB 4G42B 3ILPA 4F7EA 3PP4L 2CUHA 4WFHE 5C0AD 1SJHA 1T3FB 2W0KA 1H0DB 4MNQA 4RGND 4PGEA 4S0UC 2NY3D 5C0GB 2CIKB 5E8DH 1MRCH 1WICA 3TBSA 4HH8A 1U36A 3S96A 3DGGB 1DVFC 4ALAL 4RQQA 1Z5LA 4DZ8B 4JGJA 4EKXA 4HKZA 4E41E 3ARDD 4XC1H 2ADFH 2ZWLT 3ME0A 5EU6A 5GIRB 1J8HA 4ZUTA 3I9GL 5IFAL 4GW1A 3IFPB 4PRHB 4G3YH 3LMJL 2F19L 4GAJL 1QHOA 3U82B 2IBZX 3QXVA 1MJ7L 1W8OA 4JDTH 3I6GB 3W2DL 1EZVY 1BREA 4UT9L 1JGUH 3MUGB 5EZIH 1FVEB 3RVXC 5KN5B 2XFXA 3FO0L 3TGXA 4AG4H 2EE9A 2HT3D 5ALBH 4UT7H 4KAQL 1ZEAH 4J6RL 2JB6A 5EOCJ 1AHWA 4UIMA 4K3HA 1A14H 2WBWB 5FCUL 3RI5F 1CFSB 2ZUYA 1QRND 2H3NA 5J3HD 4XTRD 4OF8A 1FJ1A 2ZNXA 4Y16A 4P9MH 3MRLA 1TZHA 3P4NA 2P44B 4PY7B 3UBXI 1UEYA 5I1KH 3IGAB 3OAZK 3ARTA 4TULH 1F42A 4YXKL 4NKDB 3OAUL 1T04A 3OJ2C 4MB4A 1I3VA 5BO1L 2WZPD 1EVTC 3RVVD 4JZJA 3AS2A 3D3VD 1I1AA 2D31B 5FYJD 4FQLH 4KZEL 2W1NA 4AQ1B 4HIXH 1CGVA 3FO1B 4RMUA 3DI2B 3THML 4C4KT 1FH5L 4QRTA 4KHTL 1PSKH 4IEFB 3LZFH 3P0VH 3Q48A 2P7TB 3PJSB 1T4KB 3ROLB 5D6DA 3IFNL 4XNMA 4JLRB 5CP3A 3SCMC 1LDSA 4IRZH 5ITFA 5SWSE 1HXMB 3VFNB 3WLBB 2EE3A 3CMGA 3MLUL 3JWDH 4QRPE 4PREB 4S0TD 5L7XH 2DL9A 5F7FA 1S9VA 3X12B 1PW3A 4RMWA 1T03L 1NUGA 3RZCD 1QSFE 1I9RL 2CKBA 4NZTL 3ULVE 4D0BA 3ULUF 1JPFA 3NABH 4NKIH 2A0LD 5C08D 3X11A 5T1KA 2EDHA 3I6LD 3WFBL 2I5YH 3SBWC 3WUZA 1INEH 1B0RB 1RULH 4GUPA 5IFAH 1D5XA 2ESVD 4DGIL 1KV3A 4OLYL 4KXZH 2HYMA 2FX9H 3KJ6L 4QGTA 4XPAH 3VXOA 3QIUC 2EKSB 1CLYH 2GT9B 1RI8A 4BK4A 5IQ7H 3B9KA 3R0NA 4LCWA 4MS8D 3RDTC 5IJVB 5F9JA 1A9BB 5B22A 1XIWA 3QEHB 3L3HB 2VISA 5DVLA 3L3OA 3LIZL 4D0DA 4RWYL 2F54D 2FZ3A 2W0LA 3WV0A 3QUYC 2DJUA 3BKCL 1YZZA 3DX7B 3ETBF 3SGEH 1JPTH 2EH8L 3VFWB 3A6BH 5CP3H 3AAZB 3GJFK 3PDOB 1Z9LA 3BQUC 1I1YB 3KXFA 1QR1A 3RPKA 5IB5A 4UOJA 2H9GB 5GRUH 1MRFH 2PXYB 8CGTA 4XNZC 3D85D 2IAMD 1FRGL 2OXHA 4OM1H 4L4VE 4KKCD 2CKBH 4S1SL 1JMZA 3OAUH 4BSWB 3QNYA 3DX8A 4N5ED 2FBJH 3NPSB 4GT7A 5A3ID 3E8UL 1HHGB 1JPGB 5CWSB 3WDIA 4HPYH 3U46A 3O3EA 5EU3A 3G5VB 5E95B 1OGAE 3S5LG 2ZSWA 1FH5H 2WANA 1ZLUK 1RZKL 1G7MB 4LHJB 4J7RA 2DMKA 5MERA 2Z92A 1S5HB 1WFTA 1EBPA 1WBZA 2LQRA 3RWJA 1GGCL 4JFFE 3QZWB 2GAZA 3QHZH 3D39B 4PRHD 3K4ZA 3ZT5A 5I66A 2YN5A 4KH2A 1YMME 2BVUA 2X05A 2X9XA 2Q7YA 2AJZA 4IMLB 1G7JB 1L7IL 5HHXL 3O11B 4GAGL 2OXGA 2E7MA 4BELD 1Y6NR 3V52L 3S3SA 1JWSB 3CH8A 4LPYA 1LEKA 4CU8A 5IMKB 3BUYA 1RSFA 1K3IA 3OKYA 3SQOH 4BFEA 4ERSL 1GIGH 3CDCA 2NY6C 4K55A 1T1WB 2FNBA 4Z7VF 4MQXD 4BJLA 4IRJB 1MJ8H 5F7YC 4DGIH 1EEZA 4PJ8B 3GSUB 5TE6H 3OB0H 3OMZA 4GSDL 2DQFB 3V2AR 1JVKA 4D9LH 2E27H 3IETA 3OGCB 1RUPL 3MOBL 1EHAA 5KAQG 4X80L 5ERWA 5DJXA 2C4FU 5IMMA 5C0RL 4HKBB 5LGHH 4MCZB 3MRFB 4FTVA 4PRPA 4I5BA 4Z76B 1ZT1A 5FA3A 3G6JF 2F74A 5IJKC 5T3XH 3VI4F 2YKLL 4CAGA 3B6SA 4HKXB 5DFWH 4QRSB 3H6JA 5EC2A 3MJ9A 4V1DA 5E5RB 2M2DA 3S35X 5EIIB 3KPSD 1FO0A 3CFKA 5F93C 4GG8B 1CICC 5DJCB 1FVDB 5CUSH 2I25N 4XP4L 5T5FL 3TA3A 4AH2B 2NYYD 2R4RH 3LQAH 1NGXB 4ZMAT 2DM4A 4N8CH 4PJDA 1YNLL 3AREB 1HKLH 1LO2L 2EEDA 4I0KA 1T22B 4WTZG 1NUNB 2R69L 1FQ9C 4OZGA 3HFMH 4MVBD 1TZGL 1MCHA 5FB8A 2K7PA 1FG9C 1RUQL 4BK5A 1INQB 1KJ2A 5E9DB 4G9FE 1RUMH 4LASH 4FFYL 5HYJA 3ULSA 3KYOB 4M93B 3V4UH 1ADQA 3SJVB 2X2YA 4LKXB 4MB3A 4N0CC 4JKPL 3WJJC 5EOQH 1XZ0B 1KB5L 4RIRA 1GGIL 5DWUL 3MNVB 3SDYL 2XY1A 4H1LA 1RZKH 5J1TC 3G5ZA 1Q72H 1OT1A 2IMNA 1IC7H 2ZUXA 1LDPL 3JV0A 2XRAH 3CC5B 1T0PB 1NLDH 5HY9B 5FECB 2KH2B 4IOSD 3SDXF 3V79C 4K3DH 3UDWC 4FQ1L 1DBKH 1KIPB 3VMNA 4F7CB 2P49B 1RVFL 4TOYH 1JHTA 4L8BA 4PP2A 3S34L 2A9ML 1DFBL 1MREH 3FQRA 5F3BB 5I9QB 5I16B 1OP5H 4CVWA 3NFPA 3KPRB 1J9CT 3QNXB 3MJ9H 4FQJL 2P47B 2W65B 4XC3L 1IGCH 2EEAA 1HQ4B 5C0BA 1FZJA 2WINA 3WUWB 5C07E 1RU9L 4U6XB 5F7KC 1QSVA 1FO0H 4IRSA 3ULVC 4LLVB 3NFSH 4YHYC 3T3ME 1PG7W 3EFDL 4P46A 1B6DA 2J5LC 4MAYB 1HHJB 1LE9A 4XMLL 1VFBB 1GCFA 4ODUB 5I1JL 3F6IA 4G7VH 3MOAL 5BMFH 4HS6A 2AS5M 3WE6B 3CPLB 4P2OB 5JR1L 3DARA 1KJ2H 3QUKB 2ADJA 2J8UB 2K9UA 4WWKC 2ZNWA 32C2A 4NHUA 4JM4H 5I1AA 5FUOL 1T5XB 2PXYD 1A6AB 3MUZ1 4K94C 4ODHH 4ZFFB 4QHMA 3BE1L 1HIMH 3MRJA 3RTQA 3DV4A 3O9WA 4O2EA 2OSLB 1YEHL 3TVMA 4D3CL 4PJ5B 4CMMB 2CQVA 4PRBB 1I3UA 4XH2A 5E1AA 2DRUA 1UB6A 1YNLH 1G7PA 2IH1B 2C7UA 1T0NB 4R7NA 1CDIA 2UWEB 4GRWF 4JR9H 5JHDA 2R23B 3LRSB 2BNUA 1MJJB 5DRWA 3MQIA 1T66C 4XVUD 1S7SB 3GMRB 3NZ8B 3SE3C 3HA0A 4D0CA 1JI2A 1T89C 2A6DA 4EN3A 9CGTA 2HTKD 3DO7A 4NN6B 1P4IL 2D7QA 1EJ6A 1RIUL 5KSVA 2YZ8A 4X98A 4YO0A 4JKPH 4PJEB 1GC1C 4UILH 4DW2H 4NRYA 2P48B 3W11C 4WGVB 1GGIH 2CXGA 5DWUH 3OKMA 3FQNB 4KRMB 2J7LA 4PV9B 4ZS7H 1YDPB 2FEDC 1H5BC 3U0WH 2WIMA 4NKOA 3EOAA 3AB0B 3ALPA 1CXEA 5D7LA 1MFAH 3K3QA 3MLWH 4RWHA 4YDVB 3O4OB 2HVKB 1ZGLP 4IRJD 1MAML 2HFFA 4PJ8D 4WENB 3VGAC 3ZZ1A 3HCVB 4LCCB 3ZE2E 1DQDL 3D0VB 4JHZA 2A9MH 3S34H 2BRRH 1W72A 3T77B 3NFNA 5JW5B 3ZLQC 5E8PB 2PO6B 4FQJH 3LN5A 1IMHC 3ARBC 4E5XB 1JN6A 5ESAA 1MQ8A 4N0UB 1D5IL 4OF3A 1VA9A 3EJJX 1Y18A 2BK8A 3CVHA 2O5XL 1DBAH 4A6YL 2C3GA 1KENL 1MHEB 4NSKB 4HUWB 1U8QB 3BPLB 1TDQA 4P5TB 4XMKL 3IFOA 4WIQA 1AFVH 2AERT 5FDYA 3H9YA 4JANA 5HHPA 1WWBX 3AS3A 3LDBC 1VKXA 4KVCH 3MV9A 5T1MB 2DLHA 2VB5A 2J4WH 1KC5H 4M1GL 1GGUA 1WV7T 2VKXA 3ARED 2ILLA 5GRVL 5TF0A 3IKCA 1ZVHA 4PJXB 2EEBA 4YPJA 4LFHG 3TESA 2X89D 3HRPA 1KT2A 4WWID 5E9DD 2OBGA 4D3CH 1AO7E 3SJVD 1HN1A 1WFUA 3ECBA 4HWZA 4U1NB 5JW3L 1ZT4A 4DFHA 3QDJA 5JNYB 4GKOA 4HSQA 4FQQB 1CFNA 4JPWL 2Z35B 5HDBE 5IEKB 4HC1H 3VXQA 1AR1C 4XNYL 4BFIB 1NCBL 2D7PA 1UWEH 1FIGH 1FYTA 4Z95L 2R1XA 3CIQA 2PYEA 1J7VR 4LOUC 1A6ZA 3ORJA 5DMYA 4JM2A 3O4LE 2WY3A 3CFCL 1N2RA 4Z0BH 4DUWA 4D8PB 3EOYG 1QLRA 3BPNB 4DK3A 4KHXH 1JF5A 4LLWA 5I8OH 5J6HA 1P7KA 4FFVD 4ZSOB 1VADB 4TVPH 1BP3B 1KCSL 2CK0H 3KPRD 4PB9L 6CGTA 3ROOA 4KKAD 4Y4KA 2XQYG 4K23H 2H1PL 4K8RC 3SDCC 1FG2A 1CVRA 4OV6F 2GY5A 3SHSA 4MXQA 1A6WH 2XWBA 5DFTA 2MCPL 1MAMH 1YY9D 4MAYD 1G1YA 3X14A 4R96B 4PJ7A 3EDKA 3WYRA 2XKNB 1KTLB 4M43H 4ZUUA 4M3KB 1LO0H 5FKAB 3QBTB 1E4WL 1S7RA 2ADGA 1I7ZB 2GCYA 4P2OD 2MHAB 4PJIB 5DHYB 2VLLA 1MOEA 1M7DB 1QFHA 5CP7A 1PVHA 2IBGA 2W60A 3IJSB 4OI8A 4BZ2H 5DDHB 3GIVA 3I75B 2O5XH 5BXFB 1U8NA 1IC4H 3LEXA 3VMPA 1LEIA 1G9MH 1GOHA 1CGSH 3HS0B 1QEWA 2R15A 5D7KE 1G7IA 3TBVA 4B50A 1ULVA 4X9HA 4GG6F 5E4EC 3BZFB 3MYJA 3ZL4H 1NC4B 1BIIA 2C3WA 4ORZC 4K7PH 5DD5L 4W68A 3E6FA 1DBBL 4GLRI 4HQQL 3U7WH 4HLJA 5SX4H 4R90L 4PJ5D 1KOAA 5IK3A 3M17A 3QCUL 4QRRA 2XT1B 3IJYA 3DVNA 3MLXH 4PJHF 5H37G 1IGTA 1HYSC 4NQDE 2HWZH 1KPVA 3D87B 3CDGB 4ZFZA 2DQJH 5EOTA 4RFEA 2FGWL 4OFVA 5IM7B 3RPIA 1IKFL 5JO5A 5IGXH 4PGCA 4JKLA 2QQQA 1BD2B 4U1KB 1C5CL 3SE8L 3RL2A 2YA1A 1AXTL 3QEGL 4OZIA 5JW4N 4FQPA 2X1PA 4XNYH 1NCBH 1PEZA 4MB5A 3NIFE 3DV6B 1Z3GH 3PHOA 1ZLSL 1OAUH 3U0TB 3DMMB 3RY4A 3F58L 5C09E 3T0EE 3ILPB 4F7EB 1SHMA 2WP3T 4P4KC 4JRYE 4MNQB 4PGEB 1F2QA 4PLKD 5EB9A 5JIHA 2A77L 1W0VA 3TBSB 4GMTH 1DR9A 5HPMA 3U9PL 5TPWH 2PO6D 3S96B 5JXAH 1UACL 4XXDA 4RQQB 2FJFB 1BQHG 4MXWH 3VRLF 1Z5LB 3PL6C 4LDLB 3L3JA 3DHJA 1ZHBA 5L8JB 1MFCH 3VXME 3BEVB 4EIZC 5DURB 1WITA 5EU6B 1J8HB 3OB8A 4ZUTB 1TCMA 4GW1B 1T83A 2W9DH 2AJ3A 4XBPB 5EPMB 1SJEA 3W81A 4P5TD 5ID0A 1Z9OA 4NQEE 3FMGH 5IMOA 3LKPB 2BDNH 2JK5B 5D5ME 4YHKH 2Q1EA 3VXSB 4YUEL 2BJMH 4HUXA 4Z7QF 4WUUB 3IFLH 3V4VH 5C0CA 5DHXB 4F9LC 3KLDA 2YRZA 4NZDA 1EGJA 2XFXB 4ONOA 3CDYA 5BV7C 5FUZH 4ELMA 3AUVA 1I7RA 2WK2A 3WS6A 4NRZA 4UIMB 1NCTA 5IVXF 1R3JB 4KI1A 1MELA 1U2CA 2B0SH 4FQ2H 4R6UA 1KLGA 5KOMC 1WTLA 1V3JA 2H3NB 2AJYH 3SE4A 2P42B 2YD9A 2FATH 2VLJE 2VDLL 5TQ0H 1FJ1B 3B2UD 3NA9L 1LO3L 3MRLB 1TZHB 3P0YH 2NMSA 1CYGA 4YBLB 5EU5A 3P4NB 5FOJA 1FL3A 2XIDA 4LL9A 3EDJA 4EDWL 3TZVA 4U0RB 4KMQA 4E42B 5I76A 2X4QA 1A7OH 1T04B 4L3CA 4Z7OF 2Q6WA 4LVOB 4JZJB 2GW5A 2F9BT 4RRPA 1C5CH 1I1RA 5F7EH 1U8OA 3ISWA 1I1AB 3G5YB 5KJRL 1AXTH 4LVEA 5FYKU 2GUOB 4QRTB 4JRXA 5F9DC 5JOFA 4NFDA 3BP5A 1N6QL 3RY5A 3M1BB 4Y89A 4DOHB 3DETC 4EBQH 5C0AE 4GRLC 4IHOA 5I0DA 2YUZA 4XNMB 4NZUH 4NM4L 4QLRA 4JDVA 1ZMYA 3PIQA 1CBVL 4P3DB 2APXA 1V7ML 1T6VN 4P9HC 5I75C 1WEJL 1KJVA 4G7YL 4WEBH 4POYA 1S9VB 3U9PH 3TFKC 4KUCD 1IEAA 2Y6SD 2CKBB 3C6LC 4D0BB 1JPFB 5D7IE 5BVJA 2NX5E 3X11B 5T1KB 4N90D 3B43A 3AMLA 1UWGL 4R0LA 4AMKH 3RWEA 4G6JL 4OLZL 4ENEC 5KSBE 4GUPB 4D9RD 5CAYB 4UAOC 5DD0L 1VESA 4HT1L 2AABL 3GM0A 1KXTB 5MEND 1NC4D 3CLFL 4Q2ZA 3FO2A 3TIEA 1A47A 5HHMD 1ES0A 3U30B 3SKUD 1RJCA 3B9KB 4LCWB 3LB6D 5FGSA 1SM3L 2DLFH 3TCLA 1PZ5A 4MQTB 2EDJA 2WBJC 3O2DA 4WFFE 3MGOA 2VR4A 4WO4A 1XIWB 2RBLA 3W9EB 2VISB 1B6UA 3GGWA 5D1ZD 3L3OB 4UTAL 1G7QB 4D0DB 4L4TE 2ID5A 2FZ3B 4OSUL 3U7YH 3KPOB 4X0KA 2OTUA 3QCTH 5LG1A 3ZKMD 4AQOA 1A5FH 4Y8AA 1VEPA 2FGZA 1BD2D 2YSSA 5LWYH 1U8MA 2BY2A 3PE9A 1W2KT 3KXFB 1QR1B 4PG2C 1PD6A 3SGDI 4LU5H 1EMTL 2V17L 1RIHH 5IB5B 3QPQD 5SX5H 4DVBA 4G8EA 2EXYC 5BVPH 4CGTA 1MHCA 2CDEA 5MHSD 3RHWF 4O2CA 1INDH 4N1HB 3TJHC 3K7UA 2R8SL 1EDQA 1QSEE 3DMMD 3M8OL 4J2XA 3QNYB 3DSFH 3DX8B 2R4SL 2X1OA 3U46B 5C8JA 3O3EB 4I2XA 1FFRA 3HPJA 5CIPA 1Q1JH 1NFIA 2ZSWB 2X10A 4U2YA 4EQ3A 1CR9H 4MNGA 2QJDA 4TTDC 4NN5B 4ZTOH 5FGCE 4MLIA 3N0PB 5MERB 2Z92B 1D9KC 1WBZB 1IKNA 5C0EA 5DURD 5EU6D 4Q7DA 1J8HD 5E2JA 5F97E 1UM6L 4J3UA 4JY6A 3CK0L 3GHBL 3V6ZA 1LQVA 1U92A 1I9IL 2CO7B 5I66B 5I74C 3K4DA 4RISH 1ODAA 2Q7YB 2AJZB 3T0EC 3UYOD 1OP9A 3REVA 4FNLH 4MGXA 3BIBX<