5HGBA

Hla*a2402 complexed with hiv nef138 8mer epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
total genus 70
structure length 274
sequence length 274
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgbA01
1I8IA 1QPXA 3FT2A 4JHWH 5IBUB 1EERB 5GPRA 4X80H 1SY6L 1U95B 3OKLB 3QCTL 1G9MH 2X5PA 2FX8H 2XG4A 4UQ2A 1N5YL 1G7LA 3AXLB 5EZJA 1JPGA 5IGXL 3QIUB 4RZCB 4WY7L 1W0YT 3NFPA 1GGUA 3IS1X 4F58L 3OHXA 4RGOH 2YD8A 4FHBD 4PJ9D 5GRUH 3ZTNH 4MA7H 4PLJC 4G7VL 5D7JA 2J8UA 1HXYA 2BRQA 5DHYB 3IF1A 1UM5L 3FL7A 4JPWH 3N1QC 4LGRB 3RUGB 1INQA 2JK5A 3PJSA 1SVCP 1EAPB 1J87A 5HHVL 4HSQA 3IJSA 4GMSL 3EYUH 4F9LA 4PJFB 5EUKA 4HWBL 2VR5A 4Z0BL 4HWNA 1W72L 2ICWI 3BKJL 1N7MH 5GGUA 2VLME 2J8UE 4JPIB 4KI5E 4S2SB 4ZPTA 2Z8RA 4AL8L 4G9FA 1QSFD 2GFBB 2OMBA 3PWNB 2GK2A 5IFHL 4HKJA 1J05A 4M03A 2DDQH 1GGCL 3NFSL 2VL4A 4HLJA 5LQBH 2DQGH 4AM0A 3JWDL 4Z5RA 5LGKA 2F8VA 4K7FB 5D72L 3MV8A 2F8OA 4QF1B 1ZV5A 5F8RC 3QUZB 1HOCA 3WDJA 1BZ7B 3PGCA 4D8PA 2DLIA 4G9FE 1EJOL 3TYFA 2Z91A 3AAZB 3TN0A 4PLKD 4M7KH 1ZLUH 4MCYA 1BD2B 5JXEC 3DHJA 4ZXBD 4PRBB 1GGBL 3MV8E 5CJ5A 4MNQD 4QXGL 4WFGD 5E5MB 1XF2B 2IPKB 1KTDB 4JRXA 4H0HB 4OZHB 4DGYH 4KJWD 1LO3L 4KRLB 3WLWD 2V5TA 4OD1H 1QVOB 3SCMB 4FXGA 4XXCC 3MA9H 4IJ3C 5KZCD 5IK3A 5JPNB 2D3VA 1NDGA 5IR1B 2WMPA 1YEDB 4RA0C 1F90L 5T3ZL 3VFOA 1T03H 4YLQT 3FQXA 2AEPH 4KDTC 5I1JH 4JRXE 3R06A 4NO0B 1KLUB 3ZSSA 4K94H 3QNZB 3MGOA 2GHWB 4NZUH 1KT2A 5IBUG 2YSSA 4J3VA 3G6JF 3U4BL 3O6LH 3P77A 3C2SA 1N6VA 1KULA 4PJHB 5L0QC 1CDIA 1WBXB 5D2NA 4OIIL 5I1DA 3SQBA 2Y9RT 1YPZB 4N0RA 4XCEA 2AXHA 3VXMB 4M7ZC 4HKXB 3IRZA 1AFVH 4PGEB 4QXWA 1ZT1B 2YXFA 5KVDH 3FOMA 4MAUH 4JHAH 5BVPL 2QBWA 5D2NE 3OGCB 1OT1A 3L3JB 4JFZH 3MLXL 4FQPA 4QTHA 5C0FB 4U6HA 4P0DA 4M7JL 4KKCD 3HNSL 1MCJA 3HC0A 1X4YA 5FYJE 5ESAB 4QGYA 5INCA 4UTBL 3TLRA 3MRNB 5I16A 5J6GB 3NA9H 4QXTB 2ZCKH 4WNQB 2W0FB 1FIEA 1YYML 3GB7A 5E24E 1FLTX 4ETYA 5JIHA 1NANI 3DROB 1RZ7L 4CVXA 4HDIB 1WFTA 3MTRA 2ENYA 2VXSL 2Q3AA 1DSFL 2AV1B 4I0PB 1FNSH 1YEHL 3H7BA 3MRRB 4O51A 5LAXA 1TETH 1XCQA 3UP1A 3OKOA 2P5WB 1N2RA 3V0AC 4N1HB 5JHLH 3KPQA 1KPVA 3E8UH 5F71A 2SEBB 4Q9RH 1F3JA 2NY1D 1NC2A 5F6HJ 3DNKA 3KWWB 5MP6H 1T04B 1XGPA 2R2BB 3CLFL 2XY2A 4JFHE 5C09A 1AP2A 5JQ6H 4MVBC 4ONHA 2V9RA 3MREA 2CLZB 2YOCA 3FKUS 3HS0B 2W9LA 3QFDA 4JRYA 4O4YH 4BM7A 3L3GB 4G6KH 2B0SL 4ZOCA 5F9WB 1KYOK 3RVWC 3UX9B 4GAYB 4I3RL 5GS1C 4XCYA 2QKIA 3FRPA 3CPLA 1KTLA 2J3SA 3OZ9H 5FYLE 3H42H 3P30H 4PJCA 5C09E 1XR9B 1FH5L 1RUMH 3FHAA 1IEBB 1F4WH 4RRPG 4BFGA 1IAOA 3O41B 4JRYE 3GK8H 3LEXB 3LB6D 5CZKA 3OKDA 1CFNA 4A6YL 1KN4H 3JWOC 1CL7H 4KY1H 4JFFD 3UTTB 5IT2H 2BXYA 4OFYD 1DLFH 4B41A 4TVSa 1FNLA 3DX6A 4EI5C 4OLUH 1MF2L 1I7RA 4P48A 5DD0H 1IAKB 4G5ZL 3FQNB 4G43A 3BO8B 5JA8B 1SYSB 4PP1C 2P5EA 3O6MH 5F7EH 3QG6B 5FO8A 5L9DL 5GGQL 4XP4H 4RFNC 5JW4Q 5CD3B 2W92A 2F54A 4OLYL 4OFIA 1U8KA 4PV9A 4JZOB 2AABH 3FQRA 2BNRB 3ARFB 2P5EE 4KZEL 5FUOL 1VEOA 2CDGB 3DTXA 4HUMB 4O2EB 4AYFA 5H35B 1JGUH 1MCWW 1TLKA 4FP8L 5HYEA 1EFQA 2UUDK 2F54E 4F2MA 3H8NA 3NPZB 2IAMB 4HEME 4K7PH 3P11H 3QNYA 4K9EC 1AI1H 3EYFA 5GS2D 4Z7WA 5E6IC 2VABA 3VD4A 1E4XH 1CICA 3MV9B 4PREB 2Q8AH 3C60B 4L8DA 3RHWF 3GFUA 3ROLA 2HH0H 5C2BH 2YHGA 2W60B 3B6SB 3WMSA 4LASL 4LVHC 4HPOL 5FM4A 1RURH 1NEZB 3U2SB 3B9KD 5C3LD 2EH8H 5DURD 4MJIB 1JNHB 3BKMH 1U91A 4Z7WE 2FL5B 1OAUL 3V95A 4J23A 2R29H 1UKTA 1SQ2N 1DBKL 5A16B 4Z7NF 1CGUA 3O2VL 2AQ2A 4BFIA 2R2EB 3K4AA 3UO1H 1CDJA 3SO3C 3FB6A 5IJKC 2HP4A 3VWKB 5KSAD 5J11B 1V7ML 1T0MB 5AUMA 3TVMD 1SY6A 4Z78B 3D0LA 4F3FB 1Q9WA 4PBXA 4PJAE 2X4NB 3EDEA 1CT8B 35C8H 1AGCA 1IT9H 2APBA 2B2XH 3MRBA 5JXAL 5JW3H 1JZ5A 2HWZH 3A6OA 3T2OA 2W9DL 4PJXA 1KENL 1MIEL 1HYSC 1IGFL 3HG1E 2VXUH 3U7YL 5EU3A 5JIIA 4QOKA 4FFVC 1L6ZA 4ODSH 4DEPC 4P4RA 2V17L 4PJ5A 5F88A 4ZFOL 4WTWA 1BGXH 1XCTB 3BESR 1YMMD 1X3DA 4HUVA 1B9ZA 1IGCL 5DA0B 3HHRB 4HJGB 3CLEH 4FTVA 1ACZA 3OB0H 1T4KB 3QIWA 4QOKE 2C7UA 4HWBA 2KKQA 3D5OF 4NQVA 4UV4H 1MQ8A 2V7NA 2VLLB 3U0WL 1RIVL 1FG2A 4EN3B 2XTJB 3RAJL 4YFDB 5EBGA 5JOPD 4PLOB 3WO4C 3EYSH 4YO0B 2Q8BH 3VE0B 4JM2C 4FTVE 1J0KA 3A6CH 5C0GA 2JCCB 3BRDA 3FB8A 5IB2A 1RVFH 4D9QD 1A9EA 5F3HA 1FC2D 1B6DA 1GHFH 1NFDB 4YBLB 5ID1B 3KLHC 3H9SD 2D7MA 4BYHA 3O3AB 3KPRD 1FSKC 4XWGL 4LSVL 1GZQB 4BH8A 5GGRA 4B5EA 4X8XA 5IVNA 3S88H 1BFOB 3BE1L 5EC2B 5BXFB 1BWMA 3RWEB 4L8BA 1RPQA 5E99H 2C4FT 4MX7A 3BZEB 4FQHB 4XVTH 4YNYB 1CBVL 3V8OA 2PCPB 2ORBL 4EI6B 1CDUA 3SE3A 5EO9A 4YGVA 3S35H 1JGEA 1RZ8B 4XNXH 3GBNH 2FX7H 3CH8A 5IW6B 2YD1A 3TV3L 2R69L 1NEZG 2P8PA 2R2CA 2WUBL 4J1UB 3T2QA 4GRLA 3QDJB 4P2RD 5KG9B 4MZ2A 3HNTL 2WWMD 1LGVA 2OXHA 2R56H 1YY9C 3KPLA 1QLFA 4RISL 3G5YA 4DZ8B 2BRRH 5B3JE 5JTWA 3RHWK 1OF2A 4P23D 4F57L 3NH7L 3T2NL 5JNYB 3THML 4NUGL 5I71B 2DQHL 3ALWA 2GEEA 4M3JA 3TBVA 1DQJB 3RBSA 2FD6H 4PYGA 2HYMA 2IG2H 5IQ9A 3WXVH 2AJSL 1G7IB 5FKAA 1VA9A 4ONGL 4B53A 3WFEL 1LEGB 2P8LB 4NWUL 5FYKD 3REWA 5JO5B 1ACYL 4J4PD 1PKOA 4U0RB 3HMXL 2DTML 1CXKA 5H8DA 2XQYG 4LCUB 4YHNB 2Y7QB 4Q74A 1AGBB 4Y5VB 4ZPVB 1N64H 4Y19D 3VXOB 3MRPB 2OYPA 2X44D 4LCCB 4WFFE 1NCDH 3OR6A 3GMNA 5CHNB 4HIHA 4UZGA 1U2HA 5D1QD 1E28A 4P4KB 3QI9D 4KK6C 5BZDA 2JB5L 3QIBC 4JQIL 2YEZA 3IKCB 3HLAA 4WWKA 1BIIA 4NO5A 5HDBF 4DN3L 5AZ2L 1VADA 4HUNB 3EO1B 3E3QC 4L4TA 3QO0B 4BH7B 1EVUA 1A7QH 2DD8H 3MLUH 3W82A 3CMOH 2BC4A 4WTXA 1I4FA 4JKMA 1CE1L 1PFCA 3UYRL 3AGVA 1CWVA 3OXSB 2EYTB 1XGYL 1KGCD 4PRNB 5HPMB 4TUKH 3Q1SL 5DVKA 3WO3B 3EZJB 4JE4B 1XF5B 1S5IL 3U4EB 4OGYL 2AJYL 4PJEA 4L4TE 4ODVL 4ZUWB 4NJ9H 4YQXL 1CI5A 1LK2A 4X8JB 1V05A 4XH2B 4BK4A 4KJPC 5C07D 5B8CA 1JUFB 2L4OA 3HE7A 2BJMH 1PYWA 4HF5L 1BEYH 3B5GA 4IRSA 3ULVE 3C8DA 2CMRH 4ORGB 3CSGA 1CTNA 2PO6B 1I3RB 2R9HD 1FDLH 1RZJL 2GK0B 1FNEB 4NP4H 3BZFA 1I8MA 3QXUA 3IDNA 3WE6A 3DLQR 5ADOL 4NDMA 4R8WL 1Q38A 1MLBA 1J1PH 1RMFH 4XMLH 1NMCB 3QJFB 1WZ1H 1MFEL 3D85D 5HD8D 4JFDD 3GEWB 4ZQKA 3OJDB 1UFUA 4GLRH 1TJGL 4LLUB 4A6YA 3GMQA 3ECBA 4NJAH 4O9HH 4O00A 4PTTB 1U58A 4J6RH 1KB9J 4MD0B 5MEQA 1NBYB 4E5XA 5HI4C 4NSKA 4P5MB 5A2LH 3EFFA 3IJHB 4F7EB 2ZSVA 3F7RA 3ZHDA 5JR1L 5DO2D 3IT8D 5I9QC 3ARBC 3O3BB 4KHTL 4HZAA 2XRAH 5CBAB 5IB4B 5C6TL 3WNLA 4OLZL 3ULUL 2HLFC 3QDGB 4OZIF 4KQ3H 2VSDA 1T83A 2DMCA 2WY3A 1B4JH 3VG0H 5D6DC 4MQ7B 4EVNA 3WSQH 2YD4A 4HIJB 4DCQB 3WHE0 1F4YL 4M5YH 2CLRA 4NKMB 3ARVA 4OFKA 3B9DA 1QACA 4P59H 1DEDA 4YHYB 4L9LB 2LU7A 2VWEE 3QFJB 5K9JH 3MROA 4LKXA 5IP4A 5D71H 2NY6B 2NY5C 2OJZL 4ZO7A 2XN9D 2IGFL 1XAUA 3SQOL 2ADIB 3CGTA 3T4AB 1E0OB 4MA8L 5HHMA 3AS2A 4X6FA 3RGVB 4DGIL 4NO3B 3IVKA 2IANA 3EOYG 1R5IB 5D70H 5FM8A 4M6ML 4K23L 3UEZA 3PQYA 4Z8FL 2ZUVA 3U48A 4KRNA 4GAGL 5D1XD 3QDMA 3GMOA 1F11B 3OWEA 3KNBA 5C6PB 3F65A 5JPMB 5BRZA 5HHME 1MHCB 1JK8B 4R0LA 3SE9L 3I02A 3MRHB 3RI5F 4CADA 4MMZC 2R1WB 4GKNB 4JO4H 5FGCB 3O4OB 4XPHL 2D9QB 2ZUWA 3ARDD 5CP3A 5H37H 3H0TA 1R3LB 3BGFC 1XF4A 3PE9A 5DYOA 4HHAA 3GSRB 4HS6B 2CIIB 1UH3A 4KFZC 5DZNA 2JB6A 1K4DA 1H8OA 2F19L 2A1WH 2HTLD 4POZD 2OTWA 2GTWA 2BNUB 4UOW0 3DETD 3FO1A 3KVQA 1ZWIA 2DQUH 1DVFB 3G6JA 4PJBF 4PJ8A 4JFXA 3L3DA 3TO4C 2NX5D 4RMUA 3IXTB 1BIHA 3S96A 4JO1L 5ENWA 2BY3A 3IDGB 1QNZL 5KW9H 4X5XB 3VGDA 1UG9A 5D7IB 4G9DA 2EH7L 4JY4A 3VWJC 4ZFOA 2HG5B 3FFDA 5JDSA 3G6JE 1G7JA 1GH7A 2RIKA 5F1SA 1OP3K 1HSBB 3SDCD 3FT3B 3NBNA 5F1KC 3GUTA 4JJ5A 4HC1L 1CD1A 1FFRA 3HCVB 1MCDA 4Y2DD 2AAVA 1D5BA 2HA1A 1D5ZB 5EU6D 1IVLA 4HIXL 4DKEL 3IFNL 3U9PL 1DEEA 3T3PF 1FCGA 1TQCC 2EIEA 2QQNL 4YGAB 1KB5A 4NQCB 2XFXA 1AJ7L 1S78D 3VFNB 3P0VH 3V0VA 2OSLA 4LLWA 1DFBL 2XZAH 4NQSA 1FFOB 1O5DT 2YZ1A 4YDKH 4JQXA 5DJ2A 5D4QA 3VA2C 4QRQA 1U36A 4HIIB 4PGCB 2BFVL 2I9TA 1A3QA 4IRJD 4YHZH 5GRZA 5IFJA 1CLCA 3HRZA 1MIMH 1I1AD 3FQTA 3IU4H 4G3YL 5F1NB 4Y4HA 3MJ9L 3VXTB 1LO2H 2UWEB 4YEFA 4PTUA 4GMTL 4ZODA 4JHWL 2HN7B 3I6GB 2OI9B 2NXZC 1Y18B 3P0YH 4X80L 1KTKE 1XGUB 1G9ML 2V2XB 5IEKB 1LO4H 4YBQD 1VEPA 3HZYB 2WBWB 3EGSB 4NYLA 5EORH 1U95A 3OKLA 4DVRH 1X5HA 4UDUB 1CXHA 5FO9B 3KLDA 3QNXB 5DJCB 2F53B 5J6HB 3AXLA 4RGOL 5E5UB 1JL8A 5GRUL 3QHFH 5T5NF 3QIUA 2KUTA 4MA7L 4RZCA 3W9DB 3ZTNL 3QWRA 3L3HB 4Z7UB 3LQMA 4OGAC 2BY1A 2YKLH 2J1KA 3QWOB 4MS8D 4M8QA 1M71A 5DQ9B 2NW3B 1JRHL 3EYUL 1T1XA 3UTSA 1CLYH 1YUHB 3LOWA 3RUGA 1MJUH 2C4XA 1LD9B 3L6FA 4P2QD 1N7ML 4PJFA 1NCCH 1IEAB 4JEGB 4D9LH 1K8DB 1OPGH 5IMOA 4TVPH 2DDQL 1UEYA 1NLBH 3UTSE 2GFBA 3PWNA 1IQWH 3BIKB 1HIML 2DQGL 5LQBL 3VGHA 3RL1B 3S3PA 2DF3A 1N5AB 2JJSC 4ONFH 3OXRB 3HMXA 3U1SH 3HUJB 4XAKD 1Y0LB 2MPAH 3CU7A 3PHQB 1JZ8A 4QF1A 2YPLD 1TTGA 4M7KL 3QUZA 4FZ8L 4BSWB 1BZ7A 1B2WH 3B2VH 5KTEH 5C8JB 4HT1H 2WLYA 3T08A 3AAZA 2AS5M 1MJJB 3LN5A 4KRPB 4U7KA 3BIAX 5CD5C 1BD2A 2EEDA 5GXBB 1FO0H 2R4SH 3PWVB 4PRID 4LPUA 4PRBA 4DGYL 1P4IH 1CK0H 1AXTH 5E5MA 4OD1L 1IKFL 3MA9L 2IPKA 4MYWB 4Y89A 1XF3B 3MRLB 1KTDA 4JKLA 2OR7A 3ALXA 3BDBA 3ZTJH 4OZHA 1FVEB 5TQ2H 3T4YB 3WJLC 1JZ6A 2ZNXA 5ETUB 3RPIB 1T03L 2GAZB 3BGAA 5J56B 4DFIA 1KCLA 1BD2E 1G7QB 2EDEA 5I1JL 5IR1A 1MCPH 1YEDA 3O6FC 2J2ZA 3KAAA 5ACZA 1ZA6B 5IVXB 3RX5A 4WHDA 1VACB 4K94L 4NZUL 4O2CB 3EJYD 1UJ3C 3O6LL 5JHDD 4NO0A 1KLUA 4RRPA 4LSTH 3QNZA 4DKAA 4JFED 4BZYA 2A0LC 1RJLB 2GKIA 2E5EA 4NKIH 1BWWA 4WU7B 4PJHA 2JE8A 2GTZB 1WBXA 2APXA 1S7WB 1AFVL 1HHIB 1FV1B 1YPZA 3VXMA 5KVDL 4HCRH 1OTSC 4MAUL 4HKXA 1MLCB 4JHAL 1MFCH 3JZ7A 1FLRH 4OCXH 4WTZG 4G8FB 5SWSA 5JW4M 3WIIH 4JFZL 4PJHE 3UXFA 1IC4H 1NFIA 2V5MA 4NQEB 4MXVF 2D7PA 4Z7NE 1YEJH 1YPZE 3L3JA 3O2WH 3VXME 4PBVC 5C0FA 1QR1A 1IZKA 2JF1A 3CSYA 3NA9L 2ZCKL 3OG6B 1I7UB 3NPSB 1TMCB 3SGJA 5SWSE 2EICA 5ESAA 3MRNA 5J6GA 3A6BH 5DHXB 5E6ZA 2W0FA 6FABH 4G6AC 2VLJB 5DHVH 2BERA 2VL5B 3GMRB 4YX2L 1N0XH 3SDAA 5EPMB 1FNSL 3MNZB 2FEEL 1NLDH 1TETL 1JFMA 4TPRH 1UXSB 2AV1A 4I0PA 4WFEE 3DPBA 3MRRA 4NWTH 3E8UL 4JCMA 4P2OC 5I74C 2P5WA 4PJGB 3MNVB 1FG9C 3N1FC 4X9BA 5MP6L 1YDPB 1L0QA 1LEIB 2Z31D 2P49B 3MOAH 5JQ6L 2X1XR 4X4ZA 5DJYB 1T6WA 3KWWA 1T04A 5SWZE 2R2BA 2ZOKA 2VDQH 4O4YL 3QISA 1BJ1J 1EPFA 4WUUA 1ZANH 1B0RA 1GZPB 3RY4A 2ICCA 3HS0A 3OZ9L 4HS3B 3H42L 3LKOA 1J0YA 3P30L 4GAYA 2BHYA 1RUML 3EJZD 4Z7UF 1FC1A 1W0VB 1A3LH 4EJ1C 3CXHJ 5BCAA 1F4WL 3I84A 7CGTA 1P6AB 2HJLA 3BUYB 4UNVA 1CQYA 1IEBA 4WUUE 5K9OB 4GG6F 1KN4L 1CL7L 3O41A 2NW2B 4KY1L 1G9NC 4MSWA 3LEXA 1VFOA 1DLFL 4DUVA 1JHKH 2NPLX 1UJTA 4OLUL 3S9DB 4Q6YA 1OAQH 2N4IA 3UTTA 5DD0L 2PYEB 4GBXD 4JR9H 5EDXA 2GITB 3BN3B 2NY0C 4WW2B 1H8NA 3PL6C 2WW8A 4F8QA 1XF1A 3O6ML 5F7EL 1YYLH 4ZYKB 2XPGB 1IAKA 2W07A 2HLAB 3FQNA 1PKQB 4U1LB 4XP4L 3KYKH 1SYSA 4WGWB 4NKQB 4AIOA 3QG6A 2FEDD 2OQJB 5J4MA 3HUJF 3UTTE 4XNZC 4GT7A 2AABL 5I8OH 1J0HA 2B8OT 5CD3A 1FJ1A 3M45A 1CXLA 2H45A 3UAJC 4PLNC 4X4MA 1JGUL 3ARFA 3OTTA 1F6AA 1HN1A 1WSST 3HR5A 1CFBA 1NQBA 5CBEA 2ZG1A 4O2EA 3FTGA 3AMLA 5EIIA 1J1OH 1FPTH 3R8BB 1AY1L 1T66C 2Y07H 3P11L 4K7PL 1YMMB 2CSPA 4V1DD 4TOYH 1AI1L 3F7VB 3ZKNC 5CEZD 5FGRA 1ZGLM 2XNAA 3ES6A 3W11C 5K9KB 3C2AH 1MCCA 4X4ME 1ZLVH 4ZUVA 1E4XL 3CX5K 4XPBH 2K7QA 1CFSA 4ZNCD 5E4EB 2Q8AL 1HDMB 1QO3B 3CVHB 2UY6A 5C2BL 2HH0L 4NZJA 5DEZA 3I2CH 3MV9A 5I6XC 2EH8L 3C60A 3BKML 1SBSH 2VO5A 2W60A 3B6SA 5TPWH 1MI5A 1EHLH 1NEZA 2R29L 4U1HB 4MJIA 1JNHA 3PGFH 2FL5A 4Y5YA 1QFWI 2DQEL 3MJ9A 2DQFA 1PZUB 3UO1L 1P84K 5I30H 1DQQB 5A16A 3DMMD 2N7BA 4YJZL 1XIWC 2LQRA 2R2EA 1MI5E 2NY5H 1OSZB 4XBPA 4M4PA 35C8L 1DUYB 1IT9L 2B2XL 4LNRA 4PRPD 5JW3L 2HWZL 1T0MA 5IUSA 1JV5B 3QPQD 2CUMA 4F3FA 1U8OB 4Z78A 2X4NA 1CT8A 3FQUB 5H37G 4PB0H 2VXUL 1P1ZB 3AFLA 4ODSL 5D2LF 5D7JC 3F7PC 1X7QB 2H8PA 2VLKB 4PY8I 1BGXL 1BLNA 2ZUUA 3QUXA 4QRTB 3HB3D 3DVGB 3CLEL 1XCTA 5DZOA 3JUZA 5AG9A 3K2UL 4MGXA 2DKUA 3RZCB 4HJGA 3U4AA 5IMKB 1JN6A 3W5MA 1BBDH 3TJHD 1EEQA 4U31A 5IG7B 3UZVB 2Q8BL 2VLLA 2QSTA 4EN3A 4KROB 2VC2H 4I2XB 2ESVD 3A6CL 3U30B 1RVFL 5C3TA 5FDWB 4PR5B 5F7WC 2W59A 3BP5B 4YO0A 3VE0A 1GHFL 2AV7A 5KANI 1VB9A 3TN0C 2C26A 3KXFD 1NCBH 3MUGA 2AW2A 5ID1A 3S88L 2WBKA 2XTJE 4CW1A 3O3AA 5E99L 3SDYH 5E5RB 3U9UB 4XVTL 1GZQA 1FO0B 1P69B 4PLJD 1E6JL 1BFOA 5EC2A 43C9B 5BXFA 1EXUB 2VAAB 3RWEA 2NY3B 4Y19B 3S35L 2BY0A 4XNXL 3WNNA 1YEEH 2FX7L 2KZWA 4YNYA 1QSED 3TA3D 2PCPA 5EU4B 1DN0B 3S35X 5D1QB 1RZ8A 2M8XA 4MDJB 5DJ8B 4OZIE 5IW6A 5A1AA 3B5TA 2BVQA 2JIXD 4GUPA 1QFOA 5EBLA 2Q3ZA 4XHQA 1R3HB 2ARJA 4J1UA 1JZ4A 4E41D 2R56L 3QDJA 1MCWM 2I07B 3CFEB 5KG9A 3K46A 3P73B 4NKOB 4C57C 3FFCD 1I75A 3T77B 3S36X 2QTEA 4JFQA 4NNPH 4GRMA 4U7MA 1A6TB 5D2NC 1F5WA 1LVEA 1JI2A 4I4WB 2AK4B 1CFQB 5DTFB 1ZEAH 1FZOA 4HJ0C 2FD6L 4QCIB 4ERSH 3WXVL 2IG2L 4WRLA 3OKMB 3DYOA 4X98B 5IM7B 2EEAA 4PY7B 4XNUH 4L1DA 5DMYA 1JGVH 4UIMB 4N1EA 2ZJSH 1G7IA 4OGZA 1K5NB 3ULSB 1QR4A 3KYNB 2UYLB 1LEGA 3HI6L 5DGQA 1J1XH 5JO5A 3MZTA 4M6OH 3K4DA 3QEQE 4LF3A 1S8DB 1U8MB 1QRNA 5HGBB 1N64L 3LDBC 1E27B 2IBBA 4UT9H 3V4PH 2FX9H 3SE4A 4LCUA 1NCDL 2Y7QA 1AGBA 1KEMH 1HILB 4UB0H 3FQWB 3VXOA 3L3KB 3MRPA 5DHVB 4KPHH 3PWUA 2P24B 4M1GH 4K2UH 4DOHB 5CHNA 4LP5A 4L3EB 3GIZL 4P4KA 1QRNE 4S0UC 4PJBE 4U2ZA 4NBYB 1NCAH 5IF0B 3W0WD 4PJIF 1WBYA 3IKCA 1JPSH 1A7QL 3QBTB 1AXSB 3MLUL 4BQCA 3CMOL 7FABH 3EO1A 4EIGB 1R3JB 4GFTB 4TUKL 4OFPA 1ND0A 1LE5B 1NGPH 1N8ZB 3FZUC 1FN4B 5E9DB 4PRNA 5HPMA 4NJ9L 4FQCH 5AD0A 1XF5A 5F97E 3ARGA 4LL9A 3ZTJG 2DIJA 5T3XL 2BJML 3P9MB 4ZUWA 1YY8B 1BEYL 1U42A 4X8JA 3T3PE 4XH2A 2CMRL 3BDYL 3GO1H 4U0QB 3U79A 1FDLL 2ZUTA 1A7NH 5HGHB 3BMVA 4NC1E 5MHSD 3QQ4A 3MRJB 2PO6A 3QHTC 6CGTA 1KF9B 3BWAB 1RMFL 1J1PL 3TIDB 2GK0A 1CN4A 1FNEA 4XMLL 4KRMB 1WZ1L 3VGAC 4GXUN 2Q7NA 2PW2B 1BVLB 1FQ9C 3QJFA 4NJAL 2EKSA 5KAQG 3IDMA 4O9HL 3AU1B 5D1XB 3OJDA 4J6RL 4LLUA 2C3WA 2I60H 3QQ3B 5D7SH 4XGZB 1WFNA 2EC8A 1V3MA 1VSCA 1ZGLB 4PTTA 4MD0A 2O26U 4YDJB 4P5MA 4WO4C 2DQTH 3NVQA 3TESA 4XPAH 3IJHA 2XRAL 4F7EA 3ZHKA 5C71A 2A6JB 3L5HA 1I7ZB 3O3BA 1RZGB 3Q3GA 5L2KB 4KQ3L 5CBAA 5IB4A 5C0ND 4NRZB 5BMFH 3WUZA 2GCYB 1B4JL 3RVWD 2FJHA 3VG0L 4NQDE 4G8GD 3MUHL 3TBYA 3QO1B 3JV5A 4M5YL 2NX5B 4LLYA 1RSFA 1URLA 5DRXB 1NBQA 3FONB 5AWNH 4DCQA 4P59L 4QT5B 2IPUK 3MRCB 1H0DB 5K9JL 3RKPA 2ERJB 4NKMA 4WI9A 1D5IL 2F5AH 5D71L 4D94A 2HRPH 5DK3A 2VLRB 1HNGA 4YDVB 1U8QB 1BF2A 4YHPB 5FCSH 1CICC 3O3DB 2EE9A 2BNQB 1VEMA 2GJ6D 4EI5D 5D70L 3ARSA 3UTOA 5DFTA 2ADIA 3T4AA 1ZKAA 2R1YB 2XIDA 3RGVA 4NO3A 1R5IA 4HPYH 4F7PB 1OGAD 4F8TA 5J1SC 4UU9A 4FG6C 3B8YA 4WEBH 1F11A 3SEPA 2YRPA 4JO4L 1JK8A 4Z76B 5LCVH 3GKZA 5T1DH 5J8OA 4LHJB 3KYMA 5DMIH 4MB5A 4LSPH 1R3LA 2A1WL 3GSRA 3X14B 5ISZE 4IOSD 4KK5C 5DD3L 1OY3B 5I17B 2X89D 3S4SB 2BNUA 2LAAA 5F7DB 3H3BC 1MCEA 1IM9D 1VESA 2P43B 5FGCE 5E6ID 5KW9L 3AS1A 3IXTA 2V7HB 4FFZH 3VJ6B 4WHTA 4N5EA 4NZTH 3QIWC 4MDIB 5ELIA 2PKDA 2HG5A 4EDXB 2F74B 3LS5H 1LP9F 3MLTA 2HT2C 3FT3A 4PPTA 3RL2B 3CNKA 4HFWB 3HCVA 4QRUB 5FGBA 1RQ5A 4R2GD 2ICWB 5GGSY 3P0VL 4OLWH 1IJ9A 1R5WB 4F33B 3JWDC 2XZAL 4QHUB 4YDKL 4NQCA 3KGRA 1FAKT 3VFNA 5ECJE 4NC2B 4ZDHA 5I8EB 3DIFB 1JFQL 2QEJA 1FFOA 4MXVE 1KXQE 4YHZL 1MIML 4MHHG 5HXMA 3JTSB 3IU4L 1S7SB 4HIIA 4PGCA 5ERWB 1N0LA 3VG9B 1HYSD 4NQCE 1LO2L 1NDMA 3G5XB 1HEZB 2PTUA 4FFVD 5IJVB 3IXAB 1TQCB 4UINH 4K55A 3VXTA 3JUYA 1QSFE 3P0YL 3VI4F 1TPXB 1LO4L 3I6GA 3DX8B 4GRLC 3DXAD 5ANMB 2OI9A 4RWYH 1XGQB 3F62A 5EORL 4ZD3H 4DVRL 1XGUA 2V2XA 1FYTD 4QHLB 1LHZA 3HZYA 3DSFH 4U6YA 3EGSA 4MNQA 2EIZB 1RK0B 4XVUC 4IRZH 3QHFL 5E0QA 4X9GA 5CFHA 1FNFA 4UDUA 4JVWA 4L8SC 5FO9A 3QNXA 4RX4A 5DJCA 2KDGA 2F53A 2J12B 5ABDE 5J6HA 5GZOC 2YKLL 5F6IC 5K93A 4N9GB 1S7UB 3CIQA 5IBTH 1P7QD 1J12A 1LO0H 3W9DA 4KJYB 4FFWC 4Z7UA 5D5MF 1X5GA 1CLYL 5KSBB 3QWOA 4MNQE 4WFGE 5EO1B 1MJUL 4DW2H 3KLHD 5CAYB 3LN9A 4WTZA 4XP6H 2FECI 5DQ9A 2NW3A 5C9KA 5EZLB 4GG6A 1YUHA 1JYVA 3S4SG 4J2XA 1NCCL 3H3PH 5I75C 2WINB 3RWJA 4D9LL 1LD9A 3DWTA 4OJFL 1KNOB 1OPGL 5HDOA 4TVPL 4Z7UE 1NLBL 1IEAA 1Z9OA 3G6DH 1IQWL 4LSUH 1K8DA 1ZLSH 4GW1A 1YN6B 5JW5B 2VMFA 5KJRH 3TT1H 4GG6E 4ONFL 3T0EB 3F58L 1A5FH 4OCLC 4XWOC 1DQMH 3BIKA 4LGSB 3D0VB 3U1SL 1KN2H 3RL1A 1N5AA 2MPAL 4JB9H 5IOPA 3CX2A 3NMEA 1B2WL 1ODAA 3B2VL 3OXRA 3L5IA 5KTEL 4HT1L 1F3DJ 3HUJA 4ETQB 5F3BB 1IRAY 2EXWC 3KG5A 3PHQA 3REVB 4BSWA 5CWSB 5C8JA 4G6FD 4J3SA 5IW1B 1A7PH 1MH5B 2K3TA 1FO0L 2R4SL 4PGDB 2JJWA 1P4IL 4Y8DC 3RJQB 1CK0L 1WCBA 1AXTL 4YXHL 1BFTA 3I75B 4LCIH 1IE5A 1UCBL 5D93B 4CUCA 3HUJE 2B1AH 4MAYD 3PWVA 4PDCE 5TQ2L 4UDTB 1G7HB 2Q76B 2W91A 1WITA 3LRHA 1IAII 4RBPK 1XF3A 3S97C 3MRLA 4L3CA 1GAFH 2Z8SA 3MRIB 1FVEA 2BDNH 2NR6C 2Z8WC 5KOVC 1MCPL 3UTQB 5ETUA 3RPIA 2DS4A 2GAZA 2X9XA 5LGJB 1C5CH 1G7QA 1K4CB 5B8CC 1CU4H 1IGMH 5HHOD 1NEUA 1Q9LB 1YNTB 1ZA6A 5IVXA 3HE7C 2G75B 4IRSC 4M4RA 3TJEL 4ZAKC 3VD5A 4QRPD 4MA3B 5C0RH 4O2CA 1QSVA 3LD8B 3UTZA 3QYCA 2L0DA 4NKIL 1EGJA 5JMOC 3RVVC 1RJLA 2OTUB 4N8VB 5IVXE 1TQBC 2CH8A 4HCRL 4KK6D 4JHZA 4X4XB 1U8JB 3AY4A 1BQLH 1DQDL 1S7WA 5FHAH 3RTQB 1MFCL 2V9TA 3V5KB 1FLRL 1HHIA 2HFFB 3FB5A 1FV1A 2BK8A 2Z0BA 4OCXL 4V2BA 3MO1A 5FA3B 3WIIL 4NRXB 1IC4L 1MLCA 3D3VD 5CGTA 2UZXB 5F7HA 4GKZB 1UJ3B 1UWEH 3VFSB 2C5DC 4G8FA 4OD2B 3OAYH 1HI6A 1YEJL 5E94A 3O2WL 5TDPB 1EZVX 3HTLX 3MMEB 4NQEA 5IVZA 2VQTA 5D2LA 1EEYB 3N06B 1J18A 4R97B 3W81A 3A6BL 4U1KB 3QUYD 1I7UA 6FABL 3GIVB 3ZL4H 1IM3B 1TMCA 3S7GA 3IS0X 1N0XL 1II4E 3OJVC 4OZGB 1INDL 4GBXB 2ITDB 4KJPD 4BK5A 3NCFB 5EBMA 1NLDL 1T83C 4TPRL 2VLJA 3AS3A 1HWGB 2VL5A 3GMRA 4RMSA 5D2LE 5EPMA 2VN7A 3MNZA 1X5IA 3DYMA 1X44A 1NJ9B 3VFGH 1E4KA 2QV2A 4P9MH 2RB8A 4TTGA 1I1CA 2VLJE 3MOAL 4PJGA 2FEEI 3MNVA 4RDQG 3PV6B 4L5FH 2HT3C 4MMXC 1YDPA 5DC0A 1LEIA 3H7LA 3GSUB 2VDQL 3RVUC 1S5HB 5D7KD 2BVTA 4ZNEE 1ZANL 3KLAB 5DJYA 3E6HB 1CGSH 4UT7H 4CU6A 2B5IC 1HH9B 5HI4D 4TUJA 1OQOA 3L1OL 1MFBH 4PJGE 4XXDA 1GZPA 4ZO8A 5K9QI 1A3LL 1HSAB 5L8KB 1KJMB 4OZ4B 1W0VA 3C5SB 4MB3A 1FZKB 1S7RB 3EOBB 5KSBF 4KC3B 2DM7A 2H1PH 1EUTA 2GSIB 5FYLH 2HLFD 2KQMA 1JHKL 3GHEH 4WI7A 3HZVB 1TZGL 4X7CC 2X05A 1OAQL 4JR9L 4N8VG 4CVZB 1V7NH 1VCAA 5C0DA 3QA3A 1YYLL 4QWWC 3F7YB 5JUEH 1I8LA 2MWCA 4PJ8C 2GITA 4WW2A 2AJ3B 3KYKL 1MREL 4RCAA 4TNWF 4UUJB 5I1IL 4ZYKA 1M6OA 2XPGA 5D6CB 1PKQA 3MA7A 1ZLUK 5I8OL 1A7RH 5KSAA 3QJHB 4GKOA 5HVHC 3LSOB 2QSVA 2R39A 4Y4FB 1KJ2A 4R7DA 3ILPB 5IHZA 4QTIH 2FBOJ 4K8RD 1AR2A 1N4XH 4FQJH 1PKQE 4NN7B 4TTDC 5T1LB 2DAVA 1J1OL 1U3HB 2BSSB 2Y07L 5DVNA 3QZWB 4TOYL 3GSVB 1SJHB 2VSCA 1CCZA 3C2AL 5BZWB 1WTLA 5GRVL 2ID5A 1YMMA 1H3XA 1S9VB 3VU2A 2AXFB 5ADPL 2GT9B 4JQXC 2NNAA 4X4YB 5K9KA 4XNZB 2BHZA 4NBZB 3I2CL 4HWEH 1HDMA 1G7PB 1QO3A 3CVHA 4AIZA 5CMAA 4G6JH 1SBSL 2R1XB 2DQIH 5TPWL 1EHLL 3GJFH 1YMME 4Y4HC 4JY5H 3G5VB 3HA0A 1E4XI 2NZ9C 3PGFL 3TO4D 3EJJX 3OR7B 4JO3H 3CFKB 4U1HA 3KXFB 4PGBB 3KPTA 4ZMAT 5I30L 2J5LC 3GBLA 2DIAA 3VWJD 2CD0A 2NY5L 5FM5M 3H9SA 1P6FA 2PF6A 1DZBA 3LMJL 1GSMA 3ABZA 3T0BA 1DQQA 3KPRA 5JOPE 4PJIE 1K3IA 2NY4B 3BHBB 4WCYH 3GRWA 3NCJH 1OSZA 4DTGH 5I6XB 4RNRB 3VRIB 2H3NB 4D9QE 1DUYA 3QIUC 1QSEB 4PB0L 3MV11 5IHUL 3T04D 4QRRD 2X40A 1JV5A 3H9SE 1U8OA 5JZ7D 5E08H 3E0GA 3FQUA 4LOUC 4JKKA 5FFLA 3KPRE 1AD9B 2JIXB 4QXUH 5DJXB 3EYVB 1P1ZA 1X7QA 4E41B 2VLKA 3MJGX 4Y1AD 1LK3L 1NGXB 1YA5A 1GGTA 4QRTA 3WHXA 3DVGA 2RR3A 4OBSA 2AJVL 4LLDB 3B8SA 1W0WB 5GGSB 4OQTH 1BBDL 4EUPB 3NGBB 3ZYZA 3RZCA 3CFBB 2VLKE 4P23A 1G7MB 2H2SC 3SJVD 2VC2L 4P2RE 3RX8A 5EBWB 2X1PA 3DI3B 2J8UB 3H6JA 5B3NA 5HVGB 4RAHA 1DQTA 2VRAA 5DJAB 4I2XA 3PJSB 4N8CH 4M8VA 4TNWK 3QUZC 1NCBL 5FDWA 5C6WH 4PR5A 3GSQB 5L2JB 3RVTC 3QZWG 5DZLA 1OLLA 4WUKH 2WIIB 1IC1A 3SDYL 4ZPTB 4UNTA 2AJUH 3MLWH 1U41A 5J3HC 1E6OL 4HKJB 4I2XE 4OGAD 1Y6MR 1YEEL 3ZLQC 5GISH 4RGND 3U9UA 1FO0A 4QKXB 3VXRD 4XPGL 43C9A 2VAAA 4Y19A 3TC9A 4OQ1A 4FNLH 4BQ6A 5FYKE 2ENSA 3EHBC 5EU4A 3OQ3B 4WEUD 2P1YA 1JWSA 1DN0A 4HIEA 5D1QA 2Z91B 2IF7A 3QI9A 4MDJA 5DJ8A 3CK0H 1U9KA 3VFVB 1SMAA 4C4KT 4Y19E 1UM6H 3GSOA 3BKCH 5GRJH 2YWYA 3ETBF 5HHQA 3QQ9C 2V5RA 4R6UA 3CFEA 4NNPL 3RIFF 3P73A 4NKOA 2A9NH 4JRXB 3SDDD 4AH2B 1KCRH 1ZEAL 1QLRA 3F8UB 4TN9A 1YZZA 1NC4D 4LQFH 4DKFH 2AK4A 3S5LA 2H32H 5DTFA 4M61B 3LKPB 1A6UH 3RA7H 4QCIA 4XNUL 4ALAH 4ZO6A 1JGVL 2ZJSL 4HCRA 3OKMA 4RMWA 2BOCB 4X98A 5IM7A 5JORA 3R06B 1KGCE 4GAJH 5HHPA 3CC5A 3MGOB 1J1XL 2DLEA 2YSSB 5C86A 1GOGA 1YMHB 4M6OL 4X9HA 3SGDI 2YN3A 2UYLA 3KYNA 1RJCA 5IESH 5F21B 1WAAF 2IJ0C 2EDJA 3B3IA 3V4PL 2AK1H 2GJJA 1FVDB 1YNKH 1S8DA 1U8MA 4UB0L 5A3IC 3QUMA 5AAMA 1WV7T 4QHKJ 1D6EA 3LPFA 4M1GL 4K2UL 2F5BH 3FQWA 4Q9CA 3L3KA 5DHVA 2NY2C 3ULUC 1NCAL 1XGRB 4I5BB 2P24A 3WHE1 4F7TA 1JPSL 4L3EA 1MFNA 4I0PC 5SX5K 1KJ3H 7FABL 5BS0B 1ZVHA 5EG6C 5IF0A 3SDXF 4JFDE 1CD8A 1PSKH 1AXSA 1NGPL 1HINH 4XNQB 3CSPA 3G5ZB 4YDIH 2XG5A 4P46B 1PAMA 4LDEB 4HUWB 3ORJA 5DFVC 2EDKA 1CGYA 1LE5A 4FQCL 3LQAH 1N8ZA 2WWKT 1FN4A 4YK4B 1LP9E 4JN1H 1HXMB 3FO0H 4A2MA 4HKBA 3ELAT 3H7BB 4O51B 3GO1L 4PJ7F 5DRWA 1EA9C 3UZQA 3P9MA 1TDQA 1XCQB 2DKMA 2XOTA 3MRGB 3TYGH 1HKLH 3EFDH 1UWXK 4G8EB 8FABA 1EO5A 5GSRB 1KPVB 4NT6B 5HGHA 1I85A 1W8NA 4ELMF 3EYQD 1F3JB 2HTKC 3IAPA 3X3FH 3L3IA 3MRJA 1ROWA 3ULVH 3DARA 1NC2B 2HAZA 1EBPA 5C0IB 2KL6A 5CUSL 3TIDA 5C09B 3ZDYF 3S6CA 1EVTC 4ZFZB 1EDQA 2PW2A 2XA8L 3NACH 1BVLA 3QFDB 4JRYB 2I60L 2BSED 3ZSTA 2DIBA 5CJXA 5D1XA 3CPLB 1KIUA 3VMPA 4C56D 1PW3A 4JO2H 3VI4E 4P2OD 4EZMA 5DS8B 3T0AA 4XRCA 4XPAL 2IBGA 5JQHC 4MCZB 4YDJA 5D5MA 5T33H 1G0XA 3X12B 1RHHA 1Q9OA 4I13B 2A74A 3WFBL 1AC0A 3U36B 5BMFL 4AIXA 4OTXH 2A6JA 4M7LT 1S9KC 3LAFA 5FO7A 4WI5A 1I7ZA 1RZGA 3MUZ1 5L2KA 3ARFC 1NMBH 4X5WB 3DSNA 4NRZA 5KVEH 4N0UB 2GCYA 4MB4A 4LLVB 2GY7B 5D5ME 1IM9B 2NYYC 1FL6B 3QXAA 4G43B 5AWNL 4V3EB 2CKBL 4JANA 3QO1A 2NX5A 2P5EB 3DHMA 5FO8B 2H6PA 5DRXA 3FONA 4L1HA 3MNWB 2F5AL 2HRPL 4QT5A 3ZT7A 4CN1A 5L2KE 1H0DA 1T1YB 4E42A 1VFAB 4BUHA 2F54B 4K8RH 2VLRA 5DWUH 4GW4B 3FQRB 1V3JA 2APFA 1U8QA 4KKAC 4YHPA 2Z4QA 2NX5E 3DTXB 1DBBH 1HNFA 3O3DA 2BNQA 2VXQH 3C60C 1QFHA 4Y2DA 5HI5D 3GJFB 3Q48A 5EU6A 4HPYL 4R2GB 3EIFA 4UBDC 4FQXB 2R1YA 4XI5D 5EOCH 4GG8A 2XTLA 4WEBL 4Z0XB 3VXUD 5A2KH 2VLRE 3MGTA 4W6WB 5I18H 5LG1A 2ZG3A 1B4RA 3SKUD 1UC6A 3QNYB 1OARH 2BNQE 4S1QH 3QCVH 2GY5A 5LCVL 5T1DL 1G84A 5EU6E 5DMIL 5MI0C 5C08D 3ZKXB 3UAJD 1G9MC 3NZ8B 4LSPL 5HGAB 2ZNWA 2E7MA 5J11C 4P3CH 5F8QC 1I1AA 2WSKA 3VGFA 4W4NA 1QFWH 3X14A 5T1KD 2ZCLH 4LHUD 1FE8H 4PJAB 5I17A 2Z9TA 1G1YA 3S4SA 1BP3B 5F7DA 3QUXC 1UXWB 3B9AA 2FR4A 1E4WL 3FRPG 4KMTH 4CGTA 5GQBA 1G9NL 3HG1B 3PDDA 5CP3H 4NZTL 3O11B 2V7HA 1CVSC 1UWGH 3VJ6A 1T0NB 2AXGB 3LS5L 4EDXA 2VDNH 3CFJB 5HYJD 5JIPA 1A1OB 4Y2OA 4EN3C 4MS8A 2XTJC 3RL2A 4QOKB 4OLWL 2E6QA 5F88B 1WUNT 2ICWA 5I66B 1XIWD 5I0ZA 1ES0A 4F33A 4QHUA 4R4ND 4JFPA 1OWRM 3E2HA 5DD6A 4YBLC 2AQ1A 5I1GH 5I8EA 3DIFA 1B88A 4D0DB 3UBXA 4NQVB 3TFKD 2V7NB 3LKRA 2ED7A 2UUDH 2OR8A 5D7JD 2VLMD 3CDYA 4LLMB 1S7SA 2CRIA 4F80A 4LRNH 2GYSA 1FL3B 4P2QE 5ERWA 2J8OA 2X4TB 3U83A 4UINL 4Y0GA 3G5XA 4U7SA 1HEZA 1KB5H 3F12B 4X7TB 2YPLA 3FB8B 5IB2B 1A7OH 2KZ1B 1KBGH 4RWYL 1JGLH 1A1MA 1I1FB 2MMXA 4ZD3L 1WWWX 3EYOB 1VGEH 1CZ8H 1TVHB 3DX8A 4G9FD 3DSFL 5ANMA 3I50H 1XGQA 3V5DB 4IRZL 1H3PH 1GC1C 4PRIA 4QHLA 2FHCA 3BP7A 4K94C 4XAKE 4LKCA 2EO1A 2YPLE 2EIZA 1RK0A 4OF8A 5IBTL 4NPYB 1LO0L 4OLVH 1UB6B 1JGEB 1F58H 4PYHA 2YPKB 1S7UA 4Y5XB 4WEMB 4DW2L 4KJYA 2H32B 4XP6L 5I71C 2P8PB 4PRIE 1D9KB 5CEYA 1EO8H 1NBZB 5KSBA 3H3PL 2AXJA 2WQ8A 5EO1A 1EX0A 3BRGC 3RDTB 4YC2B 5JHDA 1QBBA 1ITCA 2WINA 3G6DL 1QLFB 3L7FA 4LSUL 1ZLSL 1FHGA 2FATH 3UDWA 1KNOA 4OI8A 1BQHB 5KJRL 4QHMA 3TT1L 4U0RC 2PW1B 1A5FL 5CSGA 5KSBE 1JZ2A 1DQML 2HMIC 4Y88A 1KN2L 4JB9L 3KR3H 5JW5A 3SE4C 1PEZA 4M6NH 4Y5VC 4X6BB 5JHDE 2VTFA 4JFEE 3UJTL 4AMKH 1YC8A 3EO9H 1OAYH 5TQ0H 1T20A 3INUL 1SEQH 1A7PL 2L7UA 4P4KC 5F3BA 3REVA 3REWB 2V5YA 3LKNB 4KMQA 4ONOA 3FAXA 5KS9B 1S7VB 1MH5A 2IBZX 2B1AL 4FQQB 3QUYB 4NCC1 4CDHA 3I75A 3U0PB 1A6VH 4HJ0D 1GAFL 5DRZB 4UDTA 1G7HA 1PG7W 2EDQA 5E8OB 5FYJD 1IAMA 4NC1C 1VFUA 2J88H 3GMNB 1IC5H 4Y16D 1R5VA 1C5CL 5E56A 1CU4L 1IGML 1WISA 2ZUSA 3UTQA 3CCHB 3HZKB 4WI6A 2XZZA 3VXPB 4FOMA 4CN4A 4WWKB 1BIIB 4NO5B 1K4CA 1NUDA 2A6IB 5I1LB 5C0RL 2CJUH 1YNTA 2IQ9H 4TSBH 4M02A 2G75A 1U8IA 4L4TB 1JGDB 1R3KB 4HULB 1DTUA 4MA3A 2BC4B 4P5TB 4WIQA 2PO6C 1I4FB 1RUQH 3DI2B 3WL9A 3P2TA 3CXHK 2CIKB 2FCBA 3NCCB 2WK2A 4OZFH 4YHOL 1CFVH 3O6KH 2OTUA 4N8VA 4O2FB 5FHAL 2RBLA 3MPCA 1NMCC 1DANT 4ODTH 4X4XA 2FGWL 4PG2A 5KSUB 2WP3T 1U6AH 1FRGH 4KK9D 2YXMA 1RHFA 4QLRA 5TGBB 3FB7A 5F7NC 3RTQA 1MHHB 2HFFA 1UWEL 3NFNB 4WI3A 5FA3A 4NRXA 2ITCB 4OD3L 1P4BH 3VFSA 5C0CD 4OD2A 2VQ1B 5IMMB 3ARRA 4HH9B 4KMLB 3S34H 1OGTB 3MMEA 1TXKA 3BP4B 4LIQH 3ZL4L 4NM4H 1GCFA 4NKDA 5CZVH 1TQBB 4Q7DA 2IADB 1OAXH 1BQHG 3GIVA 4ZQKB 1IM3A 4E0RB 15C8H 4OZGA 1T7WA 4GBXA 2ITDA 4XP5H 2IPTH 1DBML 1BX2A 4XVJL 4BZ2H 3WD5H 4HXBH 2X1QA 4E5XB 4NSKB 4Z18A 1GOHA 4P9ML 3EFFB 1B0WA 1DLHB 4OFVA 5FUCE 4FFYH 4YHYC 4L5FL 3DVFA 4LFHG 4N0CC 1WGOA 2NY6C 3PV6A 5D1ZB 4RGMC 1CGSL 4UT7L 5C0AB 3T0DA 3GSUA 4JFOA 1KXTB 2YPVH 2VDRH 5MEND 2XWJB 3BOVA 2VKXA 3RGVC 3KLAA 1MFBL 3E6HA 3ARWA 2CLRB 4OF0A 2AEWA 1NPUA 4WO4D 1UEMA 1CE6B 3SKOB 4YFEA 3OV6A 2OP4H 2H1PL 2XKNA 1KJMA 1XR8B 5FYLL 4HUUB 4LKXB 5ACMA 4OZ4A 3ZMRA 1FZKA 3GHEL 2ZSWA 3EOBA 1JPFA 3QCUH 3O4OC 4DN4H 4V1DE 5CEZE 1V7NL 1HHJB 2N7AA 4TSCH 4OT1H 4L8CA 5JUEL 5EU7C 3X17A 5IV2A 1MWAH 3AM8A 3RWFB 4CVZA 4C54A 3GMOB 3HKFA 2AGJH 3KNBB 2HVJB 4NIKB 2J4WH 1DVFC 1U8LB 2VUOA 2PR4H 4R0LB 4UUJA 3T0VA 1A7RL 3DMMA 1JI1A 1CICD 4WFHD 1Z9SA 3MJ8B 2X4RB 1BF8A 2BVOA 4N5EC 2FB4H 4HHAB 3MRKB 4OLEA 2D7NA 5FV1L 4QTIL 4PRPA 4XNYH 1N4XL 4HBQA 3QJHA 3LSOA 3V6OA 2UVFA 3HC4H 3V0WH 4Y4FA 3ILPA 5I8CB 5KS9F 3LN4A 4FG6D 1KV3A 4JFXB 4JZNA 3QRFM 5FGBC 3L3DB 2V2WB 4Y1AB 1U3HA 1JF5A 2BSSA 4O58H 4PRPE 2YD7A 3QZWA 1JF6A 1QLEH 1AKJB 3C6LD 3GSVA 1X5KA 1SJHA 5ENWB 3UYOD 2GJZA 1J8HB 4GRWF 2NQCA 4G9DB 1S9VA 2AXFA 2GT9A 3FFDB 4X4YA 4G6JL 1C08B 3ROOB 2DQIL 4UI2A 2DICA 3ESUF 1VDGA 1WAAE 4KK5D 1CD1B 1TNMA 1G7PA 4JY5L 4NO2B 1D5BB 3PP3K 3TJHA 4XVSH 4Q58C 4JO3L 3PWJA 4D3CH 5GS0H 1YJDC 4PJ5D 5HYSA 1KB5B 3G5VA 4PP8C 3AVEA 2AKRB 3OR7A 3CFKA 3P0GB 2OSLB 3BGMB 3KXFA 4NQSB 2OI9C 5DJ2B 3KJ6H 2DWDB 3QIWD 1PBYA 2RCSL 3TZVB 4WCYL 2ESVE 3NCJL 4DTGL 3MCLH 2I9TB 4YHLH 4RGNB 3OKNB 3BHBA 3HRZB 3DO7A 1OAZH 1OD9A 2DWEB 4Y4KB 2HKFH 3OPZH 1EUUA 3KXFE 1BOYA 2H3NA 4RNRA 5E08L 1QSEA 4M62H 3TA3A 1DE4B 2X4PA 4QXUL 2CUHA 5IWLA 5DR5H 2JIXA 2KBGA 4UT6H 4I9WD 1U2CA 1YEGH 5DJXA 4P3DB 5EO0B 2AEQH 5BV7H 4PJ7E 4KQ4H 4E41A 2CDFB 4NYLB 1QSEE 2FNBA 1NGXA 5L7XH 1W8OA 3FFCA 4OQTL 3IFOB 2E9IA 1ZOXA 3BJLA 4LLDA 3HPJB 3RNKB 1W0WA 3GMPA 4ESKA 2H9GB 5GGSA 4BFBD 4EUPA 5I76A 4E41E 3CFBA 1G7MA 4M8QB 1M71B 3ZDYE 4N8CL 4XAWH 5EBWA 9CGTA 5I15H 3FFCE 4GRLD 1T1XB 3EUUA 4YXKH 3UTSB 3B2UC 3TM6A 3MXWH 3W39B 4HFUL 3QUKB 5DJAA 5T3ZD 1T5XB 2PXYD 3L6FB 1OP3H 4M43H 5KN5B 4XVUD 3GSQA 4OCWH 2AJUL 2AVGA 1TJIH 3MLWL 4W6YB 1VPOL 3WN5B 5L2JA 2MHAB 5IMOB 4KRPC 5GZOD 1J5OH 2WIIA 3MYJA 5GISL 4KKCC 4XXCA 3WFDH 2DQDH 1OW0A 4FFWD 4FNLL 1UH2A 3CFDB 3UBXI 4Z7VB 5ID0B 4QYOB 5F7UA 5IB1A 3OKEB 2GQHA 3BPOB 5KANG 1KIQA 4U49A 3CK0L 2J6EA 2D0HA 4L4JA 4FQIH 1UM6L 3BKCL 2PN5A 5GRJL 3LN5B 3VRJA 3STLB 3VFVA 1I9EA 2E27L 2Y06L 1F2QA 1T7YA 1IAIH 2A9NL 3TCLB 4AT6B 4U6VH 1KCRL 1F45A 4RMRA 4JN2B 4K3DH 3VGBA 2B1HH 4XMPL 3IYLW 5FM5O 4AH2A 4ZUUB 3MOQA 2QQLH 4LQFL 4DKFL 4OZFB 4CVUA 3SKNB 3W0WE 1A6UL 2EXWD 4HGKC 3TIEB 3MR9B 2NZIA 4ALAL 4RAVB 5ACZB 1V8HA 4M61A 3LKPA 4RFOH 3ZZ1A 4Q2ZA 3GI8H 4APQD 4GAJL 4O02H 5LXGH 2WBJB 1UT9A 2AJZB 1T5WB 3KPSD 1VHPA 2BOCA 1NUNB 3RWCA 1GC1H 5FB8B 1RI8A 3EDKA 5IESL 1AGEA 4UTAH 2AK1L 4LVOB 4Z95L 1YMHA 1IAIM 5HGDB 1YNKL 3D18B 2NR6D 2DBLH 5CEXA 4JG0H 5T1MB 3BQUB 5CP7B 3NPSC 4LARH 1FVDA 5LJYH 3Q6FA 4OFDA 3T65B 2F5BL 3HE7D 4GH7B 2BVUA 4IRSD 3MGAA 4C56B 5SWSB 4ZAKD 4NHCH 3CDCA 3KS0J 1P7KA 1KJ3L 2VDPH 4HWUA 4ODHH 1XGRA 4I5BA 1NFIB 1E4KC 1WWBX 1PSKL 3WLBB 1HINL 3RVVD 1QR1B 5BS0A 3JBG7 4TULH 4JPVH 3CSYB 4YDIL 3GMMB 1KCVL 5I73B 3LQAL 4XNQA 5JOFB 2DMBA 3G5ZA 4M1DH 2E8YA 2A6DB 4P46A 3L95B 4HUWA 4C58B 3VFTB 4JN1L 5F1IA 2JJTA 3FO0L 4U4BA 3SDAB 1F6FB 5BS0E 4M7LH 2NY2B 4L29B 4KJQC 3T3ME 1HXMA 3MV7B 1RAMA 3TYGL 4BA8A 1HKLL 1PD6A 4H88L 2IMNA 3EFDL 1NL0H 4ELKB 2DL2A 5SWZB 5IB3B 1TZHA 3MRQA 2W0PA 3MRGA 1MHPH 3RY5A 4LMQE 5TH2B 1JMZA 4P9HH 1C5BH 3X3FL 4G8EA 3ULVL 3M8OH 4ODUB 4G8GE 2AP2A 5GSRA 4NT6A 3ZT5A 3JSSA 3PIQB 2E7BA 1FORL 2G5BB 3K80A 5I1EH 3ARED 4EI5A 3MBEB 5C0IA 5GJTH 3NACL 2ZOKB 4XB7A 2X7LB 4OZFG 4ZFZA 4WUUB 1B0RB 4F15B 1MWAB 1KPRA 4JO2L 1I8LC 3LKOB 2Y1VA 4WW2C 1QPPA 3TBTA 2GJ6E 5E2UH 1QKZH 3R0MA 2L7JA 1M1SA 2VKWA 3EOTH 3OF6D 2IH3B 3EOAB 2HJLB 2KPNA 3FMGH 4O5LH 4PJDF 5DS8A 3RWHB 3FCTA 5T33L 4JFYB 2HT3D 2CO6B 2UZYB 1N59B 4MCZA 3RVUD 4LPXA 4OTXL 4MSWB 1T2XA 1OGAE 5MERA 3V9FA 5EZIH 3X12A 2F15A 1ZSDB 2IAND 4GQPH 4HBCH 4FMFA 3U36A 3PQYD 5E8DH 4EIZC 4KDWA 5T1KB 2Z92B 3QDMD 1UYWH 4X5WA 3OMZA 2X89A 4N0UA 1IL1B 4LLVA 4UIKL 1OCWH 5BRZD 4ENEC 3MBXH 1IM9A 1FL6A 1ORQB 1HHGA 2XZCH 4LAQH 3EDFA 3BPCB 4Z7VF 5I19H 2ARWA 3MNWA 4XPFH 5DWUL 1T1YA 1FJ1B 1VFAA 4N0UE 5E4EC 1DBBL 4M93C 2VXQL 5CCKH 1N26A 1IGYB 4L4VB 3C5JB 3R8QA 4GW4A 1N6UA 1Q1JH 3D1MC 4AK1A 1KCUH 4QWWD 1F6AB 5GHWH 1J88A 3HR5B 4LPCA 1NCWH 4PJ8D 3MFGB 4V3DB 5CBEB 3FTGB 5EOCL 3GJFA 2DYPD 3O9WB 5EIIB 5I18L 4FS0A 5CZXC 4FQXA 3V5HA 2CDEB 2DJSA 1EHNA 3O81A 3HAEA 1OARL 2XNAB 3ES6B 3QCVL 4Z0XA 4NN6B 4HKZB 1BOGB 3I9GH 4ZUVB 3GM0A 1TVDA 1CFSB 4KKNA 3FHQA 1Q0YH 2AEIT 5EIQA 2QSCL 1AO7D 4X0KA 3X13A 4P3CL 5FF6B 4F58H 3T8XB 4I0KA 4LCWD 2AJXH 2IFFH 3GHBH 1QFWL 3NZ8A 5HGAA 5EB9A 1L9MA 1MI5B 32C2B 3NTCH 2ZCLL 1NAKL 3IDIB 2IMMA 4Y5YB 5TDNA 4KMTL 2DQFB 4PJAA 2FYYA 5CINH 1MCQA 2YUVA 3V7AE 5BV7B 3VMOA 1UXWA 1VKXB 4KVCH 1UWGL 5MI0B 2E7CA 3HG1A 1F13A 4XBPB 3B83A 3O11A 4LNRB 2RQ8A 1N3NB 1OP5K 2X41A 3WXWH 4MNGB 1T0NA 2NZ9D 2AXGA 2VDNL 3RZCC 5ESQB 1F97A 3DXAE 2P7TB 4OQTA 4B7IA 2H8PB 3CFJA 1A1OA 1UZ8A 1TJHH 2LFGA 2XACC 4KROC 2EDWA 1BLNB 3U30C 2X4UB 3QUXB 1HCFX 3LEVH 1A02N 1F4XH 4X6EA 4W70A 5I66A 4DAGH 5I1GL 2CO7B 5J7CC 3DX9B 1LQSR 2Q6WB 1J0JA 2XICA 2BMKA 3QIUD 3MC0A 3JTTA 4JKWA 3QWRD 1CQKA 2YD6A 4LRNL 1M4KA 1JN6B 4D0DA 3C8KB 1ZHBA 1KB5L 2NY3C 3CZFA 4LLMA 3BN9C 4FN0A 3WIHA 1FL3A 1F90H 2X4TA 2DLFL 5IFAH 1KBGL 2ZWLT 1T7XA 1OAKH 2AV7B 5D1QC 3WIFB 3F12A 1FNHA 1VGEL 2X70A 4XC3H 1CZ8L 4X7TA 3BX7C 4X7FC 3V6FB 3MUGB 4BJLA 3I50L 4HUKB 1I1FA 4DWHA 3P40A 1H3PL 3EYOA 2D9CA 4ZOAA 3OKKB 1TVHA 4OZIB 4CW1B 4W68A 4UAOC 5D96B 2QADD 5K59F 4S1DC 3V5DA 3RFZC 4OLVL 3TBSB 4MAYA 1F58L 4MQTB 1VENA 5ICYA 1N6QH 4NPYA 1MRDH 1YJDH 2ZUYA 12E8H 1ETZA 1UB6A 1KLFA 3QUZD 1ED3B 2OCFD 2NY7H 1EO8L 2YPKA 3ZYOA 4Y5XA 2BVQB 2EZ0D 4GUPB 5EU5B 5EBLB 2H32A 3J8F7 3DRQA 2VDLH 5F72S 5ITBH 5HHOA 1D9KA 2ARJB 4G6MH 1BD2D 1NBZA 5F44A 4EQ2A 3P4MB 2VE6A 2XV6B 2FATL 2J8HA 3DJ9A 4QRPA 3DBXB 3RDTA 1NFKA 4JFQB 1U8PB 3MCKA 1MJ8H 1TENA 4S11A 4GRMB 3KR3L 3SCMD 1BQHA 1EEZB 5HHOE 3EHBD 1ZLWK 4M6NL 2PW1A 3DVIA 1BPVA 1FZOB 4JAMB 4QRPE 1QG3A 4AMKL 3QEQB 4KHXH 2DMKA 3EO9L 4X6BA 1OAYL 5TQ0L 1SEQL 3SGDH 1A6ZB 1QHPA 3QQ9D 3O4LD 4KGJA 2VXTH 4QO1A 4NO0D 4HK0B 4RWHA 4IOFC 4X6CF 1J0ZA 3EKCA 3LKNA 3C5ZB 5DO2C 5B4MC 4LF3B 5KS9A 1S7VA 4Y7MA 1A6VL 1QRNB 4PJBB 5E2TH 4FQQA 3QUYA 3BPNB 1AIFB 3E3QE 3VXMD 3U0PA 2J88L 3MOBH 1J10A 1FFPB 5DRZA 1JYXA 3IB4A 3NIDF 3PWUB 5E8OA 5DF0A 4X7DC 4CRPA 4ZS6C 5KS9E 4POYA 2CJUL 3CCHA 3HZKA 5CJ8A 2IQ9L 4TSBL 5GGTH 3J7HA 3KPOB 3VXPA 1WBYB 1TNNA 1ZTXH 3NCEB 2A6IA 5FCUH 5I1LA 1RUQL 1JGDA 1R3KA 2W9EL 4GRWE 1I85C 1BMGA 4WFED 1ND0B 4GO6B 5A3ID 4P5TA 5F7YC 1WIPA 1NKRA 4H26A 4A2LA 1U3YA 5BJTB 2CIKA 5AD0B 4ODTL 5MENB 5FEBA 3ARGB 1GOFA 3ULUD 1U6AL 1FRGL 4O2FA 1X5FA 5SV3A 3H3KA 4I0PD 5KSUA 5CJXC 1G6VK 4U1SB 5B22A 2Q1EA 5D1XC 4KVNH 5TGBA 2EDXA 1P4BL 1MHHA 5L9DH 5E2WH 3NFNA 2P5WD 2R23B 1BHGA 2ITCA 5K33A 1CVRA 1H3WM 5D7KE 3QQ4B 1EGJH 1MCSA 3S34L 4X6DB 2VR4A 3H9ZA 2MJWA 5DFVD 4LIQL 5IMMA 2VQ1A 1U3JA 4NM4L 3SGKA 5C2UB 1OAXL 4HH9A 1MEXH 1OGTA 1K6QH 3MLZH 4M1CD 3QH3B 3BP4A 4MNHB 1UGNA 5TE7H 2IADA 3P4NB 2D7TH 4JPKH 4XP5L 2EKSB 2HTLC 2IPTL 1WWAX 3IDMB 4MD4A 1ZMYA 4E0RA 4BZ2L 3WD5L 3IETB 4HXBL 5JW4R 1JPST 4PRHD 5DDHA 3LH2H 1S7QB 4NQDB 1LEKB 2DM2A 1CFTA 4FFYL 2D31B 2MOVA 2CGRH 1DLHA 4EKXA 1PEWA 2ERJC 3AB0B 3HI1B 2OLDA 3V52H 1MUJB 3Q3GB 1CXEA 4U1GC 2I9LA 5A40E 3UTTD 1FZMA 1LDSA 2YPVL 2VDRL 2FJHB 4Y2DC 3TCXA 3DURA 3K1DA 2RJMA 5D1ZA 3TBYB 5C0AA 1BFSA 5E2VH 4LLYB 2IQAB 1PG7H 4LMQI 2XWJA 4RIRB 5JMRA 1ZHNB 1WLHA 1BZ9B 2OP4L 4B0MM 5D7LD 1CE6A 4XHJC 3SKOA 1O7SA 5H2BA 5C0AE 3QCUL 2BSTB 4KKLD 1RJYA 4G7YH 5L8LB 1XR8A 4HUUA 4DN4L 4I8DA 1M7DB 2BNRD 3BAEH 4KKBC 3P9WB 4TSCL 4CU8A 4OT1L 4RGMB 1TCMA 3GBMH 1A0QH 4HV8B 3SKMB 1T22B 2MCPH 2NYYD 1MWAL 3ESVF 3BEVB 1HHJA 4FZEH 2JJVA 4MXQD 2AGJL 2J4WL 3G6AA 5K9QG 1OOAA 3RWFA 2IAMD 4UU9B 2BCKB 2A6KB 3QEHA 5J1AB 3E6FB 2JLLA 2PR4L 5H94B 5HHXH 2HVJA 5ISZB 5GS2H 4YBQC 1U8LA 2FB4L 4NQXA 3DRTA 4XNYL 3KPPB 3MV9D 1F2XK 3KYMB 3C60D 3MJ8A 1I9RH 5F93C 3X3GH 2X4RA 3HC4L 3V0WL 3LIZH 1OQXA 2MKWA 3SGEH 3MRKA 1Z9MA 2LVEA 3QRGH 4CMHB 4MJID 4QRRA 2VERN 1L0XA 4I18B 4MS8C 5I8CA 2IWGA 1RZIB 5FYJU 2PYFB 3I3EA 4O58L 2I5YL 1QLEL 1U3ZA 1G6RA 4D9RD 2V2WA 1R0AH 4Y1AA 1MCNA 1OHQA 3PP4H 3BP6B 4CAGA 1AKJA 2GUOA 3E2HC 4QRRE 2DOCA 4XCNB 5T5NG 4WHTB 1J8HA 3VWKD 1IARB 4PJCF 3U46B 1KJ2H 3SY0B 2ICES 4XVSL 5EFIA 3ROOA 1C08A 3RPKA 1H8SA 3MLTB 4PJ9B 4OAWB 4Y1AE 4G42A 4D3CL 5GS0L 2VB5A 3VG9C 5HVFB 4NO2A 4C83B 4GW5B 4H25A 1J8HE 2LTQB 2C3GA 5IW3A 2PXYB 2ATPB 2O5XH 3D2UD 3B9EA 3D39D 2AKRA 5J13C 3KJ6L 4WU5A 1KLGB 1TPXC 5DUMH 2K1MA 4ZDHB 3SJVE 2YRZA 1YQVH 3BGMA 1U8HB 4JVUA 3MCLL 5CJOH 4YHLL 2DWDA 1QSFB 2HVKB 3TZVA 1WCQA 4RMTA 3CVHH 1OAZL 4ZFFB 1WEJH 2HKFL 3OPZL 3OKNA 2XTJD 1NDMB 4M62L 4K3EH 2N1KA 3VXRA 4NUGH 4KH2A 2DWEA 4CN6A 4Y4KA 2DQHH 4DUXA 2FHFA 5DR5L 4X6DF 3HN3A 4UT6L 1DE4A 5HDLA 1YEGL 5EH1A 4KK8C 2AJSH 2AEQL 2EDFA 5BV7L 4KQ4L 4RGNE 3WFEH 1J8KA 2Y4SA 1HK6A 4P3DA 5EO0A 3VXRE 4Q9QH 2FX8L 5L7XL 4ZXBB 1K9TA 2ED8A 2CDFA 2M26A 3K8MA 4U6YB 3GRWH 4MNQB 2X4SB 2YK1H 1WICA 1RZKC 3ME0A 3UDWC 2DTMH 5DEGA 4MLIA 3SDDA 2FECL 3ERYA 4Z7WF 3IFOA 4JM4H 1MRFH 5KZCB 3HPJA 3RNKA 5A2FA 4ZSOE 2H9GA 2R15A 4XAWL 5I15L 1NC4A 4OCYH 5F9AC 4POUB 4YXKL 3T0EC 2XXMB 3MXWL 4JPWL 2MQ3A 4PJDA 4MQXC 4APQB 1V3KA 3QDJD 4M43L 4GG6B 2B4CH 4JGUA 3W39A 4OCWL 3QUKA 1TJIL 1T5XA 2ADJB 3RWJB 3G9VA 1KIPB 1J5OL 5KN5A 2DJ4A 3WN5A 1H5BA 4PJDE 2MHAA 3LV3A 3LS4H 3WJLA 1MY5A 4GW1B 2VZTA 3TH4T 3TT3H 5D93C 1BREA 5IOPB 1NCTA 4OGYH 3AMKA 4LPYA 1NMAH 3CFDA 4Z7VA 3BFOA 5E8PB 5ID0A 1XMWA 4QYOA 5AEAA 3X11A 2VOTA 3OKEA 4PJXF 3TH2T 5FYKH 2CXGA 1DN2A 2VR9A 1IAIL 3SO5A 4U6VL 1WCBB 4ZS7H 1RZJH 1TCRB 2B1HL 4K3DL 3STLA 1OTUC 3M17A 1MCIA 4Z7VE 2ZCHH 3LD8C 3TCLA 2QQLL 4AT6A 5TFSH 4PGJA 4JN2A 4JRWA 5F7LB 3IAGC 4L3CB 3PXJA 3A67H 4ZUUA 3TPUB 1TIUA 4OZFA 3S98A 5IHLB 1TJGH 3SKNA 5HTSA 3DV6B 3VXSD 4RFOL 5DMGD 1AHWB 4R7NA 3GI8L 4HWZB 4PG2C 4O02L 3SE8H 2AEPL 2ATKB 5DC9B 3MR9A 3TIEA 5LXGL 3QEGH 2Y36H 3RTQC 4RAVA 2A83B 1Y6NR 1GC1L 3PNWA 4LK4A 4X7SH 2WBJA 2AJZA 3BH9A 1T5WA 4UTAL 1CIUA 3UTZB 3O2DH 2P4AB 5FB8A 3ZDZF 4LQ1A 2NY1B 1JTPA 2DBLL 4JG0L 3IFPB 5HGDA 1A4JA 1GRWA 4LARL 3K2MC 4OLZH 3D18A 3BI9X 2FH6A 5A2JH 4P49A 4R97C 2R0KH 3CH1B 3QXWA 5KOMC 5T1MA 3BQUA 5CP7A 1WF5A 4TYUA 4BZ1H 3FB5B 3T65A 4GBXC 4NHCL 3MO1B 1AGFB 1PJ9A 2VDPL 2ED9A 4ODHL 4C56A 5B3JF 4QNPF 1OTTC 3V4VH 1HI6B 5E94B 2PO6D 5E70A 3RY6A 4TULL 4LIQE 5HY9B 4JPVL 2G5RA 3HZMB 1M7IB 2K7PA 4OCRH 5IVZB 2FEDC 1ZVYA 4PGZA 1MQKH 3IDYB 3WLBA 5D2LB 1ZVSA 2WV3A 4B50A 2Z8VC 2FLBT 2IGFH 2C3VB 4YFLF 3MLPA 3QUMH 3OBAA 2BZDA 1Z9LA 3DO3A 3GMMA 4C56E 1T7ZA 4JFFB 4U1NB 5JOFA 4M48H 4U2YA 2A6DA 4M7LL 3L95A 5EBMB 3VFTA 1PVHA 5MEPB 5DGRA 3WJJA 1NL0L 1GIGH 4L29A 3WEXB 3MV7A 1H15A 1MHPL 1RUPH 1S9YB 5DK0B 1C5BL 4NM8H 2G9HB 3ZE0F 2EYRB 4ELKA 5JHLL 5SWZA 5IB3A 3DX7B 1T3FB 4RBPH 2WLZA 3O8XD 4LSDA 5TH2A 4Q9RL 5A43C 2MFNA 5TDOB 4ODUA 4KTYA 4LSRH 5I1EL 1BQUA 3TGXA 1X5AA 5GJTL 1ZGLP 1J0IA 1CIDA 3MV7E 3PIQA 3QDGD 2G5BA 3MACH 1ULVA 1HYRC 3MBEA 1PZ5A 5EIVA 3KPNB 4G6KL 2X7LA 3AM8C 3HE6D 4TUJB 4M6AA 4XXDB 5E2UL 3VXUA 1QKZL 1MWAA 2NXYD 3EOTL 2QHLA 5I1CH 1FVCB 3FMGL 4O5LL 4IDLA 4W4OC 5EUOF 4NNXA 4N0CD 3QFJD 1AQKH 3V8CA 2DLHA 2IH3A 5J9PB 3EOAA 3GK8L 3RWHA 4Q6IB 2NY6D 5EZIL 4JFYA 4HBCL 1FIGH 2XZQH 5K59E 3DUUB 4RFEB 1N59A 4YH6A 3VXUE 1PX3A 5E8DL 1EHAA 3V6OC 3RGVD 5IT2L 3QPQC 1ZSDA 3B9KB 4Y4FC 5DURB 4OF6A 1UYWL 3TPKA 2OM5A 2CLVB 4FXKB 5C0DB 3QA3B 3STBA 3OGOE 1OCWL 5T1KA 3MBXL 4NN7C 2Z92A 4LHUA 1LE9A 2EEBA 3L9RB 1AJ7H 1I7TB 2XZCL 4PJEF 4YXLH 4LAQL 1U3HC 1IL1A 5I19L 1SYVA 1M6OB 4NQUA 3MA7B 1CLOH 1ORQA 1NUGA 4XPFL 1KJVA 4HMCA 3BPCA 5KSAB 2WWKO 4KTDH 5IB5B 1X5JA 3N0PB 1L8JA 4CDGC 5CCKL 3TVMB 1ERNA 2P48B 3RU8H 1KJ2B 4R7DB 1Q1JL 4NBXB 5IHZB 3V2AR 5GHWL 1CDYA 1NCWL 4GOSA 4L4VA 1IGYA 3TJHC 3C5JA 4AEFA 3WFHA 5HYJA 2YA1A 3OAUH 1CTOA 4X6CA 5CIPH 5ITFB 4R3SA 1DVFD 2YZ8A 3MYZA 3PABB 4JQVA 3UJIH 2YS4A 3O9WA 5DUPH 3I9GL 1XIWA 2DL9A 2CDEA 4UV7H 2YUWA 1Q0YL 4L4VE 2NNAB 4N5ED 3MRMB 3FN0H 3KLSA 2CPCA 4JGJA 4HKZA 1BOGA 5HYJE 1ZA3A 3U7AA 4X6CE 3R1GH 2I26N 1F6LL 4K7PX 1YNLH 2RFXB 1MVUB 2AJXL 2IFFL 3GHBL 4M93B 2NY4C 4AIZB 5CMAB 4XX1E 3TFKA 5FF6A 3T8XA 2CQVA 3OSKA 1RURL 3NTCL 1MFAH 4RAUB 4LP4A 4NUJB 4PJIB 3TA3C 5HJ3A 5IWLC 3VH8A 3Q5YA 5DUBB 1JRHH 5FUZH 32C2A 3NIDE 2VJXA 1P5VA 5CKGA 4NQCD 4TUOB 3IDIA 5GSVB 5CINL 1K2DB 3MRDA 2X1OA 1IQDB 4KVCL 1A64A 2VYRE 3H9SB 3VGGA 3JWNC 3GMLA 3KPRB 2QADB 4HGMA 5HI3C 5HDBE 4TSAH 1VKXA 5I0DA 3WXWL 1DCLA 4JDTH 1HIMH 2COQA 3CSBA 4M9PA 1BBJB 1N3NA 4XBGB 2OZ4A 3T0WA 4MNGA 3NGBC 2D4DA 5ESQA 1I9JH 1TJHL 3MFFB 2W0KA 5DI8A 2P7TA 3ARUA 3VCLB 4GS7B 5GZND 2XQBH 4FZ8H 3PDGA 4KI5C 4H0IA 2FIKA 3KJ4B 3B9VA 3LEVL 4AQ1B 1F4XL 4P2RB 4DAGL 4WWID 1KTRL 4MJ6B 3BKYH 3STZA 2X4UA 4F9LC 4R96B 4MNGE 2VH5H 3WHXB 4RX4D 3V6ZB 2BP3A 2F53D 3DX9A 2Q6WA 1IKFH 1A2YB 3D9AH 3MLYH 4RQQB 4UV4L 1OW0C 1WFUA 4P23B 1FP5A 3BT2H 2EDNA 2P47B 2HKHH 3C8KA 5IFAL 1UENA 5TJWK 2H2PD 3EYSL 4YDLC 1OAKL 1CDHA 1KACB 3FN9A 2WAHA 4XC3L 1EEUA 3O4LB 5ALCH 2IPUG 3WIFA 5J12C 1JPTH 1YEKH 3V6FA 5E00B 3PHOB 3NCMA 1OLZA 4IIQB 4CKVX 1T7VA 5I1KH 4PRDB 3OKKA 5EOTA 4OZIA 3DGCR 4DK3A 4K71B 5HBBA 1N6QL 1MRDL 4MJ5B 1YJDL 4M3KB 12E8L 3TBSA 2EDLA 4YEEA 2NY7L 3GBNL 1MCFA 2DLGA 3B2UD 2QLVB 2CRZA 4ZG1A 4Y16A 1R3IH 1JWSB 4HIEB 1ED3A 3RWDB 3QI9B 2VDLL 5ITBL 4IM8A 3N9GH 5KVFH 3VI3F 4G6ML 4MXWH 5EU5A 3WNKA 4ZUSB 4KRPD 3GSOB 4LSSH 4ODXA 5HHQB 1CGXA 2NTSP 4UAOB 3P4MA 3W5NA 1MJ8L 2Q86A 2BRRL 3U0TB 2CK2A 3DBXA 1CGTA 2A2QT 4JY6A 1JYWA 5E7BA 1U8PA 4YHMH 1HKFA 4UNUA 1QLRB 5HYIA 3TO2B 1WK0A 1EEZA 3S5LB 4KHXL 4YX2H 1W2KT 1Q9KA 2NTFB 4JAMA 5C07B 2VXTL 4U1MB 3QEQA 1XZ0B 4WVRA 3VFWB 5JXED 2Y5EA 5JORB 2R8SH 5T3XD 2Z93B 1CG9B 5HHPB 3CC5B 1A6ZA 4UOJA 3UPRA 2UVEA 1RZKH 4HZLB 4HK0A 5C0CA 5IROA 3HFMH 1G1CA 5E2TL 5E1AB 3B3IB 2O61A 1Z6JT 2X2YA 3C5ZA 4K7PY 3MOBL 5E7FA 1HQRB 2VIRB 4PJBA 3QUMB 5IIEB 1UH4A 4P46C 4F37F 3D85B 3GSWB 1DBJH 4JFDB 3K8KA 5C0NC 1AIFA 1D6EB 1IZJA 2DI9A 3AC0A 2JJTC 3L7EB 5C0CE 1FFPA 1B90A 4JDZB 3FT4A 2E6JA 4YK4C 2BXZA 4PRHB 5GGTL 4F7TB 4LVNC 4Q9BA 2V2TB 1JMXA 5EOQH 1ZTXL 1KSRA 5FCUL 2OJEB 4NQED 2O5YH 4ZO9A 1LP9B 2IFGA 3KPOA 3RUGF 2DD8L 4PD4J 4PUBH 2K9UA 2MNUA 4PJFF 4WENB 4LDLB 4PJCE 4IOIA 3WFZA 2CKNA 1GYAA 2VLJD 3QXDB 3VXQB 5BJTA 1T89A 5JOEA 1OSPH 5MENA 1SJXA 2VZ1A 4HKBB 5E8NB 5EN2A 4KVNL 5DRWB 1REIA 5E2WL 2FLRT 3G04A 3RQ3A 4WO4A 3MX0A 4U1SA 5D7LB 1EGJL 8FABB 3U82B 2C1PA 4HQQH 5KSVA 2R23A 1MEXL 4NP4L 4OM1H 5MENE 3L3IB 3BYYA 2OX5A 2EE2A 3GDBA 4X6DA 4XC1H 1K6QL 1A1NB 3MLZL 2XN9B 3MLVH 3L5XH 5TE7L 2D7TL 4JPKL 5CS7A 1KUMA 3K7UA 3QH3A 4KJQD 4MNHA 5TF1H 4R9HA 3P4NA 5DD1H 4OZHF 3TEUA 3S5LG 1A8JH 4X6DE 1JTOA 1AY1H 3LH2L 5DJ6A 4XMKH 3IETA 3KDMA 4K3JH 1A4KB 4XRCB 2CGRL 3FRUB 1P2CB 1JZ3A 1S7QA 3GI9H 4NQDA 1LEKA 5D5MB 3V52L 2D31A 3ARDB 1RHHB 3PWLB 3PWPD 1Q9OB 2A74B 1YQ2A 1RUAH 3PDOB 1QBLH 1TZIB 4NNYB 3HI1A 2X9YA 2EXYC 4U6XA 5CGYC 4I3SH 5FO7B 4FQ2H 4MVBD 1MUJA 4BFEA 2W1NA 5E2VL 4CMMB 2PYED 5SX5H 4PJHF 1KEGH 2VDMH 1PG7L 4WFHE 3EAKA 5CIPB 1WVZA 3QXAB 4RA3A 3WSQL 1AQDB 4JANB 4R2GC 1YPZF 2YBRB 1RK1B 3S37H 2DQEH 5M95B 4FQXC 2IQAA 1PG7X 2H6PB 4QHNB 3C6LA 4RIRA 1ZHNA 2Y23A 4J3TA 4ZTOH 5CJQH 1BZ9A 3M07A 1IKNA 4E42B 1OD7A 4N5UA 4G7YL 4X99B 5A2IH 4U1IB 4KGLA 3BD5A 3BAEL 4OF5A 4WV1B 3EZ8A 4FABH 4U1GB 3SDCB 3GBML 1A0QL 1WT5A 2Z4QB 4F37K 2BSTA 2NLJA 2WP3O 3C9NA 3O0RH 3ZKXC 2FH8A 2MCPL 5C0BD 1M7DA 4Y2DB 4FZEL 4HV8A 4OLXH 5EU6B 3SKMA 2XWBB 1UWXH 3BJ91 3P9LB 5AYUH 4ENED 1T22A 3N1MC 5E95B 3BEVA 2EDHA 2YN5A 3D2UB 3H9HB 4GG8B 3D39B 4PP1D 2HFGH 3MGTB 5CEZH 2KQNA 1WBZB 1KCSH 5HHXL 1MCKA 1I9IH 2BCKA 1MPAH 2A6KA 1BM3H 4PJXE 5J1AA 3E6FA 5DJ0B 5H94A 3ULUF 4R4BB 5ISZA 3K2UH 1A9BB 1W72A 1I9RL 3X3GL 1LWRA 3EDDA 3LIZL 4PJ5E 1SVZA 3Q6GH 4HD9A 3DV4B 4FQ1H 4IRJB 1MJ7H 3KPPA 3WKMH 3QRGL 3MJ7B 1I1AB 3VFMA 3ZKMC 5IEHB 3MCG1 4LBEA 4AEEA 4HUXB 5CZXD 4YZFF 3BH8B 2ICWJ 3JXAA 4Y8AA 5GRWA 2DQUL 4I18A 1RZFH 1OB1A 1WQVT 4D0BA 4JKPH 1RZIA 2ZUXA 2UZIH 1R0AL 2PNDA 2PYFA 3PP4L 1IEHA 1MAMH 4NFDA 2FR4B 3TBWB 5EWIH 4F7CA 4TNVF 1CS6A 2EDTA 4CBPA 1WIOA 1KJ2L 1C16B 3BP6A 5FIEA 3RWIA 4XCNA 1YC7A 4P5KA 2LE9A 1E6JH 3ZDZE 4Z77B