5HHPA

Crystal structure of hla-a*0201 in complex with m1-g4e
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hhpA01
4OT1H 2GTZB 4MAYB 2VLKB 3U9UB 4I9WD 1FFNA 4K8RD 5BO1H 2BVUA 1A1NB 1YY8B 4UILH 3SGKA 3QDME 3MGAA 4P3WA 4IHOB 2NY6B 3SE9H 3G5XA 4LVOB 1RZ7H 4PV9B 5HDQL 1HHKA 3VGGA 5DQDH 2EO1A 3V6FA 3HRZA 5HI5C 1T0MA 3GRWL 3UTPE 4B41A 2NY4B 1MCIA 2VIRB 3TCLB 5KSAA 5CZXC 5FO8B 1R3LB 4HUVA 2ZUSA 3ZLQC 3M07A 1LO3L 2ADFH 4Z8FL 1MFDH 1R5VB 1G9NH 4OJFL 2YXFA 1U8JB 1N4XH 2ICWA 3LS5H 1U3ZA 3KDMA 2WUBH 1S78C 3PP4H 3OWEA 3EZJB 5EC2B 4Z0XB 5DI8A 4XTRC 3OQ3B 4PYGA 2WP3T 1G7HA 4NFCA 1T1YB 5L2JB 3L3HA 5DK3A 4GRWE 2XXCB 3AY4A 1F8TH 1IEHA 2EDRA 4YAQB 1I85C 3MLYL 1W0VB 3ESUF 1S9XA 4G9DA 5BV7L 1SBSH 3IETA 4GRMA 4LSPL 5BZDB 2VERN 2ZUXA 5J8OA 2HAZA 4Z95L 2P48B 5MEQB 3P4MB 5JHDE 1B0GB 4KVNL 3ULVD 1KPRA 5EU5A 2AXGB 4RMVA 3NCJH 1G9MC 1Q9OB 5DURD 2O5YH 1JFMA 4NHCL 2V5MA 4Z7NF 5IESL 3MNWA 4GO6B 43C9B 2O5ZL 1RIHH 1NDGB 2ITCA 4X6EB 1FNSL 1WFTA 1EXUB 4NQEE 1OCWL 5C07D 4HIIA 5C70A 4JHWH 1NFIB 5C0DB 2MQ0A 5EBWB 4EN3B 2DLHA 2CGRL 3LEXA 2QHLA 1KIRB 3CMGA 4G6FD 5DRNB 5BOPA 1TQBC 1NL0L 1OP5H 1AO7A 3O6FA 4OGZA 5F6IB 4S1DD 4O51A 5J13B 1DJSA 5INCA 4DEPB 4LSSL 5BRZB 1FAKT 3UZVB 4WTXA 2F19L 4LARH 5L2KA 1QNZL 2Q6WA 1A1MB 1CGSL 2IGFH 1NANH 1RVFH 3CXHJ 3MRFB 1ZT4B 4CVXA 4E42A 3MOAL 3S5LG 3R0NA 1QLRA 5GGRA 3O41A 4YDJA 2XWBB 2DWEB 3QDGA 3TH4T 5CSZA 1IGJA 2Z92B 5DDHA 3QQ4A 4OQTL 2FHBA 4QTIL 3STLB 2NY0D 4Y4FD 2VC2L 3ALXA 4P4KA 3V0VA 4FXGB 5E6IC 5I0ZA 3OBAA 4JZOA 4X4MA 3D25A 2AI0L 2BSED 4IIQB 3I6KA 3C6SA 5CIPA 5JOPE 3QIUD 1FNGB 1EAPA 1KCRL 5D6CA 3H42H 1G9ML 1XR9B 2ZP0T 3PWPA 1WBZB 3QXAB 1NCWH 4O2FB 1RUQL 3JUYA 1FV1A 1P5UA 3NN8A 1WAAF 4OZFA 1FZKA 4HPYH 2W59A 3UTTA 3RI5F 4FP8L 5D70L 5B3NA 3U46B 1S8DB 3T09A 5EIQA 4XP4H 3HUJA 5E2UH 3MV9E 1U8MA 3SDYL 1CDBA 1JWSB 4PJBA 4QXGL 4JRYB 4OCYL 3MRLB 4H5SA 3EUUA 1UWGH 5CIPH 1TTGA 5IWLC 4UUJA 4UB0L 3O3AB 3RX8A 1EVUA 1FG2A 3MLRH 2WSKA 5CINH 2VXVL 1RUPH 4L5FL 5KOVC 4XPGL 2NPLX 1T2XA 1X6LA 5DD5H 4OZFH 5D8JH 4EDXB 1NSNH 4PP2B 3X17A 4RMTA 5T33L 4PJ9D 3L6FA 2V2XB 3BP7B 3IRPX 5FGBA 3JV5A 4L3EE 3V79C 1A2YB 1NGZB 5ICYA 7FABL 4FQXC 1GGIH 2AKRB 1KB9J 5D1QB 2C4FU 2NZIA 4PR5B 4OLEA 3ARFC 2EZ0D 2ED7A 1AD9B 4OIIL 2DD8L 4JFEB 1AHWB 2Y06H 2UVFA 4P5TC 4KK6C 4UU9A 3EYOA 5H35B 3VFWB 1BQUA 4BKLB 3LKNB 1KXVC 4DGIL 4L9LB 2QSTA 1Q0YL 3FCTB 1UWEL 2QQKL 5F89A 3QDMA 3UJIH 1CGVA 2EDWA 2XXMB 4HWUA 3LSOA 3KPOB 3QUXC 2EE2A 3LB6D 1NMBH 1DDHB 1IM9D 4TSAH 2YD3A 4IDJL 4G8GD 5I1JL 1UADC 2VUYA 3EOTH 3TVMD 1EFXD 4TTGA 1HXYA 2UZXB 1TFHA 3VMOA 2OP4L 4QRRB 1BVLA 4ZXBD 1NLDH 1ZT1A 2F8OA 1XGTB 1W0WB 1KN2H 3D85B 5GSVB 1KJ2L 2COQA 4Y5XC 2CD0A 3ZMRA 1MY5A 4HUMB 1MCDA 1I7TA 4QXUL 2NY2D 4U1KB 3NZ8A 1P5VA 5ERWB 1L0QA 3RAJL 4UTBH 4HFUH 5JIIA 3BN3B 1T0PB 3VXPA 1IC5H 1U2HA 1CFNA 3DSFL 5I1GH 5DRZB 4JN1L 3GMRB 1RZGB 5J7CC 4PJXE 1DLFL 4ONGH 4HK0B 3AS2A 5T3ZD 1CFBA 4XPAL 3Q48A 3FRUA 3QUYD 2V9TA 3RDTD 3MA7A 3EGSA 5ITBH 1ZT7B 4AEEA 3H7BA 2NXYC 4KWUA 1YY9D 4WHCA 3LN5B 3HNVL 1IEBA 4U6VH 5SX5K 4MQSB 4I1NB 4L3AA 3MRRA 2BSTB 1OD7A 4MMZC 1V7NL 5EB9A 2LVCA 5JHDA 4JFHD 1T1ZA 3HHRB 1KGCD 1T7ZA 1P7KA 1IKNA 1FFPB 3WXVH 4F58L 2K3TA 3UTSE 2XWJA 2HLFC 4JFOA 3ALPA 3C87A 3TBWB 4JZNA 1E28A 4YDIH 1CICB 5FO7B 3RZCB 4GRWH 3VFPB 4HBCH 1D5BA 4ZFGL 4M6NH 4NQEA 1AXSA 5FDWB 1OM3L 1KBGL 2FR4B 5EU4B 1QR1A 1EHLL 1IEAB 5KSUA 4QTHB 3O8XD 1UB5A 2Y5TA 2HFFB 3F7YB 2DL2A 4RMRA 5EZJA 4OD1H 4C54A 3FQXA 4JFXB 3KPSB 1XCTA 5FUZL 4QHMA 5I6XB 3WXWH 3G04A 2PO6A 1E27B 1ND0A 3CFBB 3TPUB 3KLHC 1Z3GL 2G2RA 3CCHA 4ZFZA 3SKUD 3QO0B 2HG5A 4KTDL 2J2ZA 5DR5H 1T2QH 3WL9B 4Y2DA 1YN6A 3HB3C 4PJ5D 5K9KB 4XWOC 1KCKA 1TVBB 4UZGA 3DNKA 3LN4B 1NCNA 1MNUL 4I5BB 2EKSB 1N64L 3R1GH 2IAMB 2X4SA 1CR9H 2CO7B 5IVNA 3RNKB 1H3VA 5TDPA 2BVOB 1MCWW 1FVCB 1D5IH 4KDTC 5C0FB 5AYQA 4Y5VB 4MDIB 1LDPH 3OKNA 2FSEB 2FNBA 2VLJB 2LTQB 2HA1A 5IHBA 4V1DD 4X4YA 2EKJA 1PGRB 4NQCD 1J9CT 1WBXB 5EU3A 1C1EH 4HMCA 1SYSA 5C0AE 1CT8B 2CDGB 4FFYL 5JIHA 3BPOC 5FYJE 3DMMB 4WUKL 5I16A 5HVHC 5JPNB 2AVGA 2DLFL 3BHBA 4JM2C 4O5LH 1ZLUH 1U8NB 1RUKH 3PWLA 4PRNB 5CCKL 4PFEA 1WK0A 1LD9B 1XGYH 1JCKA 4JDVB 1HCVA 4CADB 1DBBH 5GHWL 2DN7A 4P4RA 3HI6L 3WUWG 4TNVF 3MV9A 3FQTB 4Z7QF 1BIIB 3EDKA 4JPIA 5KSAD 4J3WA 1KCSH 4Q0XL 2VWEE 1NAMB 3EJZD 3QNYA 4LCUA 3AS3A 1CXFA 2V17H 3B3IB 4XVJH 1IQWL 1T5XB 1XIWA 3CIQA 5EORH 1N8ZB 3QFDA 5HI4D 4WFGE 6CGTA 1G7IA 1ZA3B 2EC8A 2AV1B 1CF8L 4OCWL 4FQ1L 4QHNA 5J3HD 2H26A 3ARUA 3E6HA 5CGYD 1J12A 5C0GB 1H5BB 4LEOA 2BJML 1FZMB 4AH2A 3THML 3WS6A 3QG6A 1OAZL 3GGWA 5GZNC 1KG0B 4MJ6B 4X98B 5IVXF 3V4UL 4BZ1H 4L3EA 4O4YH 2GT9A 3PWJA 4KZDL 2D7TL 4JG1H 1JVKA 1AQDA 3IFNH 3G5ZA 3SHSA 5HYSG 2KQNA 3S9DB 2NLJB 3TO4B 1UM4H 2E3VA 3T3MF 2YD5A 2VQ1A 4HKJB 3O3DA 4XMLL 1MCEA 4QHLA 1KTLA 5IVZA 4DN4H 4GKNB 1D6EA 3B9AA 5JW4N 3I2CH 5SWZB 2X6MA 2GITA 4ZFOB 1A3QA 1C16A 1P4LB 4WEBL 2RFXA 4JQIH 3OMZA 1HZHL 3C9NB 4HW6A 5JTWA 4OD3L 1AI1L 4ELMF 1KJMA 4Z0BH 1V3JA 4XCYA 1IARB 1RURL 2IBZY 2AJXL 4WI3A 3V5HB 3H2WA 1FGVL 4M3JA 1OGAB 4XNUH 1MH5A 1AO7D 3VE0A 3O6FD 1AP2A 1HIMH 5F1NB 3DETC 3S35L 5INDB 3QCTL 1DBAL 3IGAA 4LSUH 4FZ8L 4P3CH 2BDNL 1A0QL 4J3SA 5L2KD 3B5GA 1CTNA 4JO4L 5ITFB 2FLRT 1BEYH 4V3EB 3OXRB 1QFWH 2LVEA 5HHME 3FONB 5J6HB 1PZ5A 4PJ7E 2Z31C 1ZVSA 5IVXB 4PJGF 1TCRA 3QDGD 3ZTNH 4E0RA 3WHE1 3ORJA 2YKLL 2YD9A 1DBMH 3O9WA 4PRBA 4PJXA 5FM8A 7CGTA 5A43C 2J8OA 2J5LC 1S5IH 5AAWA 4AT6B 4OZGE 4H25A 4EI6B 2CRMA 2EIEA 1GZPA 1MJJA 2LU4A 4LSRL 4P4KD 3GB7A 3KPNB 5KSVA 3MFFA 25C8H 5BVJA 1EHXA 3MA9H 5DFWH 1I8MA 5IMLA 4YC2B 4H0HB 1GYAA 5IG7A 2DJUA 2ED8A 1ZEAH 2R2HB 1XZ0A 3MRGB 4X7TA 3PWPD 4Q6IC 3UTSA 2WUCH 5CSGA 4P23B 3DUSA 2XA8L 4DVRL 1Z6JT 1FO0H 4D9RD 2APFA 4JZJA 4KTEH 2ZCKH 4ELMB 3E3QA 2EE3A 2PXYA 3ETBF 4XBEL 3UTTD 1H3XA 1V7MH 4YZFE 4KPHH 4GMTL 4A2LA 3QQ3B 1HNGA 2EXWC 5KZCD 4RGOL 4XP9H 1OPGL 4M1CD 4BH8B 4G6KL 1OTTD 1N5YH 1RK1B 3MZTA 1KC5L 4MD0B 1A6TA 3L3JB 4Y5YB 1ZTXH 3Q5OA 2MCPH 4EQ3A 2HTKC 4YHMH 1L7TH 2XNAA 1JGLL 4X6BA 2LU3A 4PLKC 3GSWB 1JN6B 1I9EA 3FO1B 5JXAL 2A74A 4MXWL 4HQQL 1JFQH 3HE7A 3VXOA 4I3SL 4PJGB 2DQEH 3JV4A 5DMIL 3R8BB 3TYGL 1EEYA 5F3BB 2DTML 1FCGA 3X11A 4WWKC 1GAFH 2B7DT 1FCCA 2J4WH 4I3RL 4RGND 1KIPB 2ZUWA 4NN5C 4WW1A 3U2SA 4IRZH 5AWNH 3VG9C 3AS1A 5TE4H 3VG0L 5HVFB 4HGWA 2DWDA 2H6PA 4O58H 3KNBB 2N56A 2F5BH 3MOQA 3IDXH 4FQ2L 3MCLH 2Q86A 4LPCA 4HS3B 2DIJA 3ZT5A 3DX7A 1DP0A 1XGQA 5EPMB 4FQJH 2E7CA 4KU1A 5GS2H 3FQNA 5DHYA 5C0AA 3RGHA 4MA3A 2L7UA 4XRCA 3PL6C 3MRBB 2CKBA 2XKSA 5CP7B 2DQUH 4FABL 2NY5H 5IJVB 1FGNH 1PJ9A 5CS7A 3GMOB 5BW7A 1BBDL 1U8IA 3QDMD 1S7TA 2IG2L 5IQ7L 3ERYA 5IHZB 3MPCA 1ZHBB 4HXBL 1JYXA 1T20A 1ZGLB 5HGHA 3RWCB 1HE7A 1NH6A 3SDCB 2DQTH 1CBVH 3NOIA 3UTPD 1S7WB 4GT7A 5EBMA 1VB9A 4JVPA 2XQBH 4XZUA 5K9JH 1OT2A 2ZPKL 3HNTH 1W72L 2CKBH 2I9LB 5FYJH 2FH8A 3VWKA 3IDGA 4NRXA 3VXRE 1VFBA 5C09E 4N8VG 5GRUL 3VFGH 3DOSA 4X0KB 4HWNA 4F7PA 3LV3A 1PFCA 3HZVB 4NC0B 5GIRA 3L3DB 4G7VL 4NQDE 1KYOJ 5ANMB 4N9GA 4ZUUA 5I9QC 2QR0B 1K8IB 3K2UL 1VESA 2IPTH 3EOAB 5E95B 4ENEC 1F4WL 5DVLA 3P0VH 1FVDA 2R8SL 2MKWA 3VW3H 3IXAA 3FO9B 5MI0C 2CH8A 5D96B 2FB4L 2YD1A 4U7MA 1MCRA 4LVNC 3AXLB 2X1WL 3REWB 1HYSC 4XX1E 2IH1B 4YWGL 5I8OL 4FFEX 3GBNL 3MJ9A 1YYLH 3V6BR 4AMKH 3NACH 5CBAB 4LCYB 5JHDD 2AXHA 4ODSL 5CJ8A 4MDJA 5IMMA 3SJVB 2CRYA 5DLMH 1SHMA 4ZUTB 2G9HB 3LCYA 4HUWA 1P4BL 2Q20A 4G6AC 1A3RL 4PTTB 5J56B 5GGQH 3PWVA 2WK2A 1I9JH 1QSFE 4RISL 5SWSB 4NO3A 3MYZA 2C7UB 4PRHB 4LRNH 3QA3A 4NQED 4AIZA 1WSST 1OAXL 2FGZA 2D03L 2N4IA 3UJTL 3QEGH 3UTQA 5HDOA 3X3GL 1JPSL 1P84K 3MJ9H 2IEPA 3I50L 4R4BA 1NGYB 1T80A 4JCLA 3V5DA 4M93B 3MGTB 2OYPA 4WFFD 1DN2A 1MRFH 3WNKA 2H32A 2PO6D 2MHAA 2WW8A 1AD0B 4YXHH 3FRPA 1FAIH 2XRAL 2J7LA 3P0GB 5HD8C 1WF5A 5HHMA 4D8PA 4Y2DD 3SO5A 1Y0LA 3OJ2C 2J88L 4OF3A 4LLMA 1A7OL 1B9ZA 4PJ7A 1MCSA 4TUJB 4ZS7L 2W0FB 4J3UA 5FGRA 1JGUL 4HT1L 5IMOB 5DK2A 2WZPD 5H37G 1GOGA 4EI5C 4PGEA 3TBSB 4HHAB 4U49A 2WBWB 4GW1A 2HT2C 1EDQA 1VEOA 2XY2A 4OZGA 3IFOA 3DBXB 5F6HI 2V6HA 3T0EB 4XXDA 4M9PA 3IKCB 1KACB 3BQUC 4PJIE 2QV2A 4BFGA 1EVTC 4CMHC 1I7RB 3WN5A 1MIEL 3DURB 5JOPD 1S9WB 5I1DB 3TV3L 2V7HB 1PBYA 1G1CA 1LGVA 4YHKL 2EH7L 3PGDB 1CCZA 1F4XH 4UIKH 3HN3A 4X4XB 3CH1B 4L4TE 4TUOA 3HCVB 4XT1C 2NYYC 1KLUA 1YEGH 3QI9C 1NJ9B 5IOPA 1K9TA 2A6DB 3MV9D 3SE4A 4WO4B 3TJEL 2HT3C 3NCFB 2XPGA 1Q9LA 1YMME 4M8QB 1OF2A 1AFVL 1N0XH 1G7PA 4B7LA 3UAJC 4HWEL 1VDGA 3MNVB 4LFHD 1Z9MA 5D7IF 1XIWD 4K07A 2NW2A 5HI3C 3DUHA 5E5MA 1UZ6E 4HH8A 4YFLF 3U4BL 3TT3H 1MEXL 1CDYA 1I1AB 4H1LG 2R0WL 4GBXA 1CQKA 5GISL 5JLZA 3KPMA 1XF2B 1S7SB 4WY7L 3LPGA 5GGVY 2BHZA 2JCCF 1SM3H 5TGBB 3TYFB 2DB8A 1A7RH 2EDEA 4K71C 4HFWA 4L3ED 5EOQL 5IB2A 4R97C 5I15L 2X40A 2YHGA 1B3JA 4OGXL 3P30H 3WKNA 3O81A 3UPRB 3LEYH 3NTCL 3S96A 2YSSA 3QIWA 3KLAA 1NC4A 2MKLC 3T1FA 4IOIB 3RTQA 4LLDA 4H0GA 5CLTA 5I1AB 1AQKL 5HJ3B 1QEWA 2EDNA 3PHSA 4G6FB 1CDUA 3ULUC 3WO3B 2DM3A 1RIUL 3QUMB 1TDQA 4P2QE 4C83B 2YWZA 1T4KB 1AR1D 1E4WH 3OKLB 1PYWB 3L95A 5EU6B 3PHOA 1NGXB 2AQ2A 5J57B 4XCFH 1OB1A 3H3BC 2F54E 2R0KL 1B2WH 3Q1SH 5KVFH 1GGCL 2OJZH 3U4AA 3UTZB 4LRIA 3ZKXC 4EDWL 1OHQA 4PLNC 3TFKA 1YNTB 5D7IB 5EFIA 4XGZB 2DQGH 1AKJB 1T89A 4HIHB 2PF6A 3PGFL 2E8ZA 3UZQA 1RK0B 1T5WB 4HZLA 4JFYA 3MCKB 3VXRA 1KXTB 5C09A 1F11B 2HWZL 4WGWB 3OKKA 4Y4FB 3S36X 4HJGB 5C6WH 1T21B 2ADJB 3NCMA 2DI9A 1ITCA 1PZUB 2JCCB 4FS0A 3MRMB 4NQDA 3REVA 1TZIB 4Y0GA 2NX5B 5KSBB 3AREA 4QRSA 4G3YH 3T65B 5IV2A 2VN4A 3QIUB 3O9WD 3Q2CA 1WJ3A 4EUPB 2NR6D 3EJYD 3EFFB 2NTFB 1KJ3H 2C26A 2EYSA 3QXDB 4JY5H 2LABA 1SBBA 2KUTA 1BQHA 2Q7YB 3VRIA 4DFIA 2FWOA 5CILL 3E2HC 4OKVB 1FSKB 3A6BL 1YECL 4OZIE 3C5ZA 2Z91A 4DOHB 4OGAC 2OR7A 2ICCA 2X9YA 4WDIB 1A9BB 4QCIB 3SE8H 2AXFA 4LIQL 5EBLB 4M7ZB 3IJYA 4M7KL 2B4CH 5CJOH 2XIDA 4WUUB 2ZCLH 4F9LC 4NO5A 4N1EA 3MBXH 1LVEA 4IMLB 3SDDB 2KBGA 3UTSD 4HF5H 3ULUL 3DPBA 5FYKE 2Z93A 3BOVA 4IBLT 1C8PA 1EEQA 5F7YC 1QSFA 4XP1H 5LAXB 2ZUQC 2PXYD 5J12B 1A6ZA 5KVMC 3DI3B 4N1CA 2IWGA 4RBPH 1LK3L 4PGDB 1N2RA 3BGMA 2CRZA 5F93C 2F5AL 2LAGB 5IB4A 4U33A 2PNDA 1A7BA 3P9LB 4CVZB 3EOBB 4NZTL 3GMNA 2I60H 2O61A 5EA0L 3VXTB 3LD8B 1I7ZB 2OTWB 5IB3B 5ESVB 4ZUWA 2MPAH 1CFQA 5J4MA 1YQVL 2AK1L 1NEUA 5E8DL 4GFTB 5GS2D 5C9KA 1BFSA 5H2BB 3HE7D 4ZAKC 3PWUA 4I2XB 2P7TA 3QCUL 4GAJH 2AK4E 5E9DE 3HG1B 2Q8BL 3WIHA 3RWDA 1PG7L 1CLZH 4QKXB 5HHQB 1QRNE 4Z5RB 5C0RL 3BH9B 2VLME 1QBLL 4GW4A 5ILTL 1WIOA 4KRPB 1NC2A 2WINA 5DO2D 5DEGB 4AENB 1FE8H 3B9KA 1AC6A 2UWEB 3RHWF 5MEOB 4JKLA 4LK4A 1DVFC 4PJIA 2V2TB 5C0AD 5LCVH 3O4LE 4APQC 3CXDL 3P9WB 3CC5B 5KW9L 2X9WA 4UOW1 5FYJD 1CFSB 5IQ9A 1CU4L 3QSKB 4FTVA 3WJJC 4ZXBB 2O5XL 4PPTA 3MO1A 3D69A 1HI6A 3WIHH 3U0PA 4JR9H 1OWWA 4L8BA 4UDUA 3BKYL 4PJ8C 4L4TA 1QLEL 5D9SA 1YJDH 2WM0A 5T1KA 1RJLA 3CSYA 1N0LA 1XGUB 3GSVB 4TULL 1QPXA 4TUKL 5ID0A 3NA4A 2DTSA 1C5CL 2DMCA 3BGAA 4TSCL 5DMJB 3WKML 1YMMA 2Q3AA 3O0RL 3DGGA 1KPVB 1F13A 4N0UB 4BSVA 1OAQH 1PAMA 5EWIL 3VWKD 4AM0B 3PUCA 4FA8A 5DFVD 4JDTL 1ZLSL 3OXSA 1NBYA 4L29A 3FTGB 1TZGL 4HIEB 3ARYA 4PG9B 4WFGD 5LWYH 3WSQL 3FQWA 2GFBB 4CGTA 3QUYB 5KAQF 3K4AA 1YC8A 4X7SH 2X4RB 4LQFH 4R96B 2R29L 4OZHE 3M8OH 5JW3H 4WEMB 5DZLA 4XH2A 1T04B 4CUCA 5F7DA 4MVBA 4H1LH 4GAYA 2HJLA 3I6LE 1H15A 4XAWL 3ZL4L 5SV3A 1F90H 3D3VE 3H7LA 1PY9A 1G7QB 4RIRB 5EZOH 1KCUL 5C0NC 2V2WA 1MCOL 4CW1A 3WFDL 1OLLA 1DFBH 1SYVA 1U8QB 4RWYL 4XI5D 5D2LF 4DN3H 4U1LB 3MLPA 2W60A 1GPOL 3MROB 3QAZC 4LSQL 2R0LL 2AEPL 3V6OE 3GRWH 3CUPB 5EU7E 2AAVA 5I18L 1S3KH 1MREH 4WHDA 3O8XB 3SQOL 2G60H 4KGLA 1F3DJ 2F53E 1W8OA 4YHPA 4P2QA 1WC7B 2GSIA 4OF8A 4PBVC 3QFJE 4OF5A 1RU9H 1U8PA 1R24A 1MRCL 4LGRB 1FJ1B 4O2CB 4CMMB 2R23B 4MD4B 4M9OA 4PJ5B 1A6PA 1IKFL 1NMAH 4KROC 3BX7C 2OK0L 3U4EB 3T4AB 3ALWA 2AJYH 3QDJE 4X7CC 2GIYA 4IRSC 1KEGL 3SY0B 5K59F 3SCMB 2IFFL 4Z7OF 5I19L 4NN7B 3GIZL 4P46C 5BV7H 5JQHC 3U36A 2G5RA 2O26U 4OF7A 4V1DB 3GMMA 1QFWM 5HHMD 3NFNB 4JREB 4J4PA 1MFCL 3IJHA 4OCSL 3IRZA 1F4YL 4FQLL 1HN1A 3M45A 4HXAH 4J6RL 1TENA 1JF1B 4NN6C 1ZLWK 3LMJH 2OR9L 4Z76A 5ECJE 3TH2T 5KJRL 2R39A 1FFNB 4ISVB 3TEUA 1CE1H 5D2LB 2H2SD 5E1HB 1FNSH 2B0SL 1WZKA 4OZIA 2VDRH 4PJFE 1OCWH 4CDGC 4JO2L 4YX2H 1EO7A 3MV7B 3G5XB 5E7FA 5KS9E 3FQUB 4S0UC 2QJDA 3V6FB 1OVZA 3WBDA 2HKFH 2HFEB 4ZPTA 2FX7H 4OLYL 1HOCA 4HUVB 4M3KB 1D5XA 1VFUA 4FMFA 2D0FA 2A73A 5C7XH 3FFCE 3QWOA 4LLAA 5B38B 3KDMB 2F19H 3JXAA 5B4MD 4WNQA 4G8IB 3MACH 1F6LL 4E9LA 3EYFA 4MS8A 4IEFB 4NFDA 1JZ3A 1Y6NR 4JJ5B 3PP3H 3MRHB 4LAJH 1Q72H 5DT1L 1WZ1H 3T3PE 3MLVH 2OM5A 3KS0J 1T1WB 1OOAA 2VLKE 2D9CA 1YMHB 3NFSL 4HS8L 2VXSL 1I9IL 3GUTA 2X4UA 4U1NB 1OAYH 5FYKH 4RAVA 4H0IA 5F7NC 3ARBA 4HIXH 5GGVH 4GBXD 4NQXB 4JY4A 2APBA 2AI0H 1P7QB 3T0BA 4YJZL 1EJOL 5D1XC 3IFLL 2AK4A 5E9DA 5EIVA 1QLFA 3TN0C 3BPNC 1C5BL 4RA3A 1QRNA 4PB0L 4M48H 4JPVL 5T5FL 3K3QA 5TQ0H 4IRJC 5ABDE 1MSPA 3N0PB 3QIWD 2YN3A 1VHPA 4R7DA 4U7SA 1NC4D 2DQCL 4QHKJ 2WBJB 3B8SA 3MRPA 3SDYH 3RTQD 3O4LA 2W38A 3P4OB 1GZQA 3BZDA 4QXGH 1LEIA 5B3JF 2P43B 1QBMH 2ZOLA 3HUJF 4QHUA 3BXNB 5E08H 1Q8MA 4IOFD 3QH3A 4POZC 4I0PA 1YEDA 4UB0H 1AO7B 3GI9L 3ARWA 1GJIA 3NPZB 2GUOB 5I8CA 2HJKA 3VD4A 3IXTB 4JO3L 2FJFA 4X6FA 3DX6A 1MAML 3NIGF 1KENH 3BSZL 3BYYA 5JHLH 1MCKA 1H0DB 2EYTB 3RA7L 3CFDA 2OR8A 1JUFA 2OSLA 3EYUL 2MFNA 2XZAL 3TFKD 5CSZB 3MREA 3GSNA 3QQ4B 2QSQA 4MZ3A 3JTTA 3VXRD 5C09D 3IAPA 4X7DC 4F7EB 2GQHA 4GG6F 2E8YA 4RAHA 3V7AE 4P4KB 4OZHA 3OTTA 4F9PA 4JZOB 5E4EC 3EAKA 4WI6A 3D25B 5IF0A 4NQDD 5GGSA 3ARED 5IP4A 3I6KB 3GSRA 5DD6A 1Y18A 4KJYA 2CLZA 2XT1B 5CIPB 2UY6A 3RGVC 3C5JB 4MNHA 5D6CB 5ICXA 2IQAA 3D3VA 3SGDH 1HHHB 3FB5B 5GSRB 4JG0H 1HINL 3BUTA 1WWBX 1UWEH 2QQKH 4HWBA 5E2JA 3GSNH 1TTFA 4KHTL 1S7VB 3BD5A 3NN8B 5BRZE 1JHLL 1MI5E 2H41A 4OZFB 4GXUM 3C5ZD 1JE6A 4K7PH 5E8OB 4QNPE 4CJ0A 3HUJB 3V6OA 1AXTH 1U8MB 1BBJB 4KY1L 4NDMB 3HLAA 3G6AA 3EO0B 4HULB 1HWHB 4U1HA 2DAVA 4HSQA 1NEZB 3O6LH 2VR5A 4MXQC 3GKWH 2F53A 1J0IA 5DEFB 4YK4B 3S34L 1FG2B 4X80H 1QSFD 3ZE2F 3D0VA 1QYGL 2VRAA 3QFJA 1FL6A 4HWBH 1F2XK 2XN9B 5I1LA 5FKAB 5D7JB 1MJ8L 2Z8RA 2Z35B 1FIGL 4OD2B 1T1XA 4JN1H 5L6YH 4GKZA 2IQ9L 2QQLL 2J8UF 3QDJA 4LNVA 2C1PA 4Z7NE 4GG6B 1BJ1J 5FEBA 5JOFB 2QEJA 1EH9A 1FNFA 5JORA 3S36H 1JTPA 1A6AB 4R0LC 3W9EA 1IGYA 4UV7H 1BOGA 3C60C 5IFAL 4MA8L 1G6RA 1UM5L 3WEXB 1A6WH 1BAFL 2X4OA 4YDVB 2GI7A 1L0XA 3KJ4C 4YHNB 4JRYE 3PE9A 4L1HA 2HRPL 4M5ZL 5F9JA 1NC2D 2N1KA 3ILQC 3MZGB 3LKRA 5C3LD 2H2PC 3O2WH 2DQJL 4PJFA 3B9KD 1IT9H 1M05A 4NWUL 2CIIA 5KS9A 5KTEH 1KBGH 1U41A 3EDFA 3SKJL 3QIBC 1G6RH 4P2OC 3DROB 1BQSA 5FF6B 2P5WB 1HXYB 2NW3B 3HR5A 4FTVD 1YC7A 3LKQB 4Y4KA 2DQFB 3DJ9A 3EHBC 1ZT1B 3FFCA 5J1TC 3HS0A 4L4TD 1U92A 5T1KD 3OR7A 1MCCA 1JNLL 4FQIH 2A1WL 5T1DL 4NNYB 5CMAA 5C0BB 1S7QA 4K2UL 1WCBA 3IJSA 1YMMD 2R9HC 2J8UB 1J8HB 3VXPB 5IIEB 3D18A 4P9HC 4JFEE 1N64H 2FRGP 1P7HL 1U95B 1U8KA 3CSGA 3RL2B 2ORBL 3O3BA 3NH7L 2GTZA 4MAYA 2VLKA 3U9UA 5CKGA 4YE4H 4UAOC 4DUVA 2R2CA 1A1NA 3OKMB 3TWCH 1YY8A 3MA7B 3ZDXF 4WW2F 4EZMA 3BRGC 5FUOH 5ADPL 5J13C 3K7UA 5EBGA 1V5JA 4IHOA 4DEPC 1U3YA 2XKNB 2VDOL 1IEBB 3P3YA 3T2OA 1J1XL 4PV9A 3MRRB 4GH7B 4MVBD 1XCQB 2OJEB 4FFYH 1A7QH 2AJVL 5IT2H 1T1ZB 4EVNB 5FO8A 5EOCJ 1P7KB 5K9OB 2H9GB 4QRRE 1QRKA 5F70A 2WY3A 3MSPA 1R5VA 3BPLC 4JPWL 1U8JA 1BIHA 1XAUA 4TPRL 3FO0H 3EYVB 3JWOC 4NQEB 5EC2A 4Z0XA 3HI6H 4YNYA 1TETL 3RVUD 1JGVL 1UGNA 2YOCA 4C56B 3S5LB 1QR1B 3VD7A 3AFLA 3WLWC 4IIQC 5KSUB 3L5XL 3NABL 1UB5B 2Y5TB 3P77B 2DJSA 5EZJB 1WITA 4NGHH 4G7YL 1ZOXA 4P2QD 2FDBP 5L2JA 3C09C 1BM3L 3CFKB 1UEYA 4J12A 4QRQB 5C08B 4YAQA 1ZHKB 4LVEA 3A6CL 5HHNB 2XZCH 3QUZA 1JNNL 2OL3B 3N1QC 5J9PA 5BZDA 3K0WA 4HS6A 5L88H 5BCAA 1OTUD 4MLSA 5MEQA 4P9HL 5A2LH 4CNIB 3P4MA 3V4UH 5JNYB 1B0GA 5MHSE 4JRXB 2VISB 4KZDH 1YDPB 2A38A 1Q9OA 4WW2B 5SV4A 5C2BH 1S9VB 3IDIA 3OKNB 3VXSB 3MLSL 43C9A 2YXMA 1G84A 5SX4I 1NDGA 4M62L 4X4YB 4X6EA 3S37L 1R3KB 2E9BA 1IFHL 2UZIH 2YZ8A 1WWAX 4J4PD 4K3GA 3P9MB 4XMLH 5EBWA 4EN3A 5D7SL 2AS5M 1JYVA 4YHZL 3IAQA 2H1PL 5DRNA 3BP4B 1XGRB 1KN4H 2XOTA 4M1GL 2E27L 3FAWA 3N50A 3HNSH 2PYFB 3PWLB 1A3LL 2BXZA 4WEBH 5IHUH 5BRZA 3TPUE 1MI5A 2YS4A 4OD3H 2VITB 3DRTA 4KHXL 1E4XI 1K3ZA 3ARTA 3JWOL 3IT8D 1QQDB 4U4BA 5MP6L 4OZ4B 3U83A 4JQVA 1RURH 4OI7A 4JKWA 2AJXH 2A83A 4Y2OA 4R4ND 4AG4L 4K3EL 1LWRA 1M7XA 4JPIB 1IAKA 1FGVH 3QZWG 5D71L 1EAJA 2BY3A 2XI9A 4LCUB 3ARGB 4IOSD 1LO0L 2FX9H 1VEPA 3G6DL 5FYKD 4I18C 3WNLA 4OLWH 3U7WL 3DARA 1JNHB 4M43L 4OBSA 4XNMB 4JO4H 4H20H 2VLJE 3RIFF 4FG6D 4PB9H 4FXGA 2BC4B 4MS8D 1FP5A 2BHYA 2NY7L 2MSPA 3RWHB 1I4FB 1FYHB 3CZFB 4JVUA 1OSZB 1WT5A 4ODVL 5DA0B 2R4RL 1FNGA 1EO8L 1UM6L 5CEYB 5B8CA 3O6MH 1PG7X 1XR9A 4PJXF 3QXAA 3IAGC 3S8WA 4DGYH 3G5ZB 1EGJA 1FH5L 5JQ6L 4LSRH 3ARBD 3UYPA 4JGJA 3HC4L 2C1OB 2JJSA 3BT2L 3U46A 1S8DA 4FNLH 1PLGL 1E0OB 4P2CG 1P84J 3OKOB 3PJSA 2AK4D 4RZCA 5E9DD 2I9TB 4YBLB 3GI8H 4P5MA 4JRYA 4QHLB 1RZFH 5I74C 3VMNA 1QOKA 1QRND 5MENB 4DVRH 4PGZA 3O3AA 2VLMD 2KKQA 3RVVD 1F3JB 1EGJH 1JZ8A 2OLDA 2WMPA 4D2NA 4O2EA 1KJMB 1ACYH 2E9IA 3CZJA 5FM4A 4EDXA 3O4LD 3TP4A 4PP2A 1OW0C 4G6KH 4Y16C 2V2XA 4I0PD 3BP7A 4HJ0C 2AJZB 3V7MA 1NGZA 3BD4A 1AP2B 5L0QC 3CU1A 3QBTB 3RWGB 3BKCH 2AKRA 2NZ9C 2Q8AL 5CD5C 5FHAH 5IGXL 4X5XB 2D7QA 5D1QA 5JXAH 1N6QH 4R2GC 4PR5A 3FHQA 4I3SH 4Q7DA 1ERNA 4Y88A 2DTMH 2Y7QB 4DUXA 1T6WA 1ZVSB 3P11H 2VL4A 3OG4B 4JFEA 1DN0B 3HI1B 4JVWA 1AHWA 1FPTL 4E0RB 4NWTL 4YHLH 4PJXB 1INQB 4L3CB 1II4E 1IVLA 4W4OC 5H35A 1D9KB 4BKLA 1CD0A 1FO0B 3LKNA 2I07B 5SWZE 4L9LA 2R2EB 3VDCA 3DO3A 2FECI 1GZPB 2FEEI 3UEZA 3KPOA 4EOWL 4Z7QE 4XAKE 1DDHA 3AU1B 5IMLB 4H8WC 5IG7B 5TPWL 1P1ZA 3I6LD 3OX8B 1HXMB 3T0AA 3BJ91 1XZ0B 3D3VD 2KH2B 4WENB 1OGAE 4QRRA 1KTRL 1XGTA 1W0WA 3DUSB 3D85A 3FZUD 5GSVA 2V7NA 3RY4A 4NFBA 4HEPG 3D39E 3MRKA 2NY3D 3ARXA 3C08H 1ZE3C 2J6EL 2V9RA 4YHOH 4Y5VC 3P0YL 4U1KA 5ERWA 2LTQC 3MQIA 4F8TA 3HI5H 2ERJB 2CDEA 2BVYA 2ZOKA 5DRZA 1NUGA 2CLRB 5TQ2H 2ZPKH 4YFLI 3GMRA 1RZGA 1M6OA 4LHJB 1HH6B 2F53D 1PX3A 2X4QB 1GGBH 3DMMC 5EC1B 2ZSWB 3ES6B 5DHVB 4KJWD 4MA7H 2Y5EA 3QFJD 2YK1L 3O11A 1ZT7A 4GRLB 4JB9L 3FN0L 3N1GC 4X9BA 4C58B 3CMOL 4AQOA 2A6IB 3VXOB 4NUJB 1EEYB 3CX2A 1YEJL 2I5YH 3X11B 3QDJD 5DYOA 4IS6A 2XQYK 1JPGB 2X2YA 1CXKA 4BELD 3TBWA 3UTOA 3K74B 3N1FC 4JY6B 4HGWB 5C6TL 4GS7B 5D93B 1CICA 4QLRA 5FO7A 3RZCA 3VFPA 1FLRL 1BFOA 1DZBA 3SKOB 4ELME 1MHEB 4JPKL 3U9PH 2IBGA 5I8OH 3GBNH 1IC4H 2F15A 2YUWA 3RU8L 2PTTA 2A77L 4H8WL 3FQNB 5IR1B 4ODSH 3WUWB 1CGWA 2FR4A 5EU4A 4S0TD 2CKBB 3DVGB 4QEGA 4QTHA 3F7YA 3QQ9C 1P4BH 2EYRA 5IBTL 1A3RH 3OAUH 4JFXA 4PIRF 4M4PA 4J8RB 5E56A 4LBEB 3WFCL 3CFBA 3TPUA 2YPVH 3U1SL 3V6ZA 1GHFH 5GJTL 2D03H 4TTDD 3GSQB 3QO0A 4LCCB 3WL9A 1IL1B 3X3GH 2BX5A 4KKBC 1YPZB 5K9KA 4PJGE 4Q2ZA 3P2TA 5E8PB 3SKMB 3LN4A 4I5BA 2AJSH 4XZUB 4Y4KD 5HYIA 4LCWB 1IGCL 3RKDC 3FFCD 2IAMA 3IDGB 4NRXB 3RNKA 3GJFA 3B9EA 1VFBB 3PV6B 4PP1D 2BVOA 3OJVC 2CIKA 3DIFB 4LSVL 1NQBA 2VLJA 3LV3B 1C12B 5HYSB 1TJHL 4OTXL 2D9QB 1WBXA 2SEBB 4RSVA 5DK0A 1CT8A 4PJ7F 4KK8C 2CDGA 1CL7I 3U0TA 4MAYD 1ZXQA 2B1AL 2VLKD 5JPNA 4BQBA 1FVDB 4MZ2A 1NAML 1UWXK 1U8NA 4ORGB 4PRNA 1PVHA 3IXAB 2X4TB 3GJFH 3KYNB 4M02A 4YUEL 2C5DC 1LD9A 1VACB 3MJGX 4OZGF 2IPUK 2NY6D 4JDVA 1I8KB 1J86A 3LRHA 4CADA 4Q9BA 3KYAA 2EXYC 3M1BA 3PV7A 3FQTA 5D7KE 2NY4D 1BIIA 4GW5B 2DMBA 3EO9L 4ZNEE 2EH7H 4BM7A 1MFAL 1NBVH 3B3IA 4NNXB 43CAB 4ETYA 3ARDC 3GK8L 3MLZH 1MPAH 1ZA3A 3QYCA 2AV1A 4AIZB 3CSBA 5C0GA 3EZ8A 1H5BA 5TH2B 4YZFF 1JYNA 1N5AB 1AFVH 4DAGL 5GJSH 2ZJSL 2FEDD 5ANME 1E6OL 1L9MA 4MJ6A 4X98A 1GC1H 3V5DB 3NZHL 4MHHI 4K94H 4HGMA 4YDLB 2Q76B 3LRGA 4WHYG 3MX0A 2YMXL 5ADOH 2QADB 1CZ8L 1MEXH 3DO7A 5GISH 2DL9A 3QUZD 3VI3F 3TO4A 5HHMB 3TA3C 4WY7H 3IDJB 2VAAB 4NNPH 2IC2A 4PJ7B 3LKSB 5IW6B 3I6GA 3NMEA 4DK6A 3DUUA 1XR8B 5EOQH 3SJVE 2EICA 3I84A 5HYQB 5DK2B 1MCWM 1SY6L 2IMMA 5F7HA 4FFVD 4L8CB 5SWZA 4GW1B 3B2VH 5T5NF 5DFTA 5F96H 4Y5YC 4OZGB 5D1ZA 4PD4J 4ZFOA 4X5WB 1P4LA 5SWSE 2LV4A 4MJIB 5LBSL 4PRHE 4XXDB 3C9NA 2W9LA 3LPWA 4YO0A 3S97C 3WHXB 5JDSB 5TJWK 4EN3D 3V5HA 2VDLL 1AQKH 3N9GL 3VRLF 4BK4A 5CHNA 4BYHA 4MJ4A 1X6NA 2YD7A 3MNZB 1OGAA 5I1EL 1KLGB 5CEZL 3JZ7A 5JDJA 2OZ4A 5F1NA 1GXEA 3U0WH 5BRZD 3D39A 5C8JB 1MI5D 3SDAA 5C0JB 2PKDA 4Q9QL 2Y4SA 5ITFA 1Z5LB 1YNLH 5DRWB 2R0KH 3OXRA 1UA6H 5IOPB 3FONA 1AGBB 5J6HA 4XCCL 2BHUA 3IDYB 1BGXH 1G7PB 1CK0L 3PIQB 2RAMA 1HNFA 4NRZB 3PGFH 1T2JA 4LDOB 2MQCA 5E5RB 2HWZH 2XZQL 1RZKH 2NW2B 3HTLX 4AT6A 2R69H 4KKCD 4EI6A 4KQ4L 2OZ4H 1MAKA 1ORQA 3KPNA 4GBXB 3T0EE 5JLZB 1U3HB 1ITBB 3A0OA 2VABB 3FKUS 3GMLB 3V4PH 3STZB 5M7QA 3I3BA 1X9QA 1FZOB 1AJ7L 5ISZB 4MMXC 1INEL 2R2HA 4KZEL 4W70A 3ARRA 3MRGA 3OAYK 3KHOA 3AB0C 4P23A 3SO3C 4P57A 4ELMA 4N68A 2F8VA 1YEEH 4M4RA 3BIKB 3QQ3A 4M7KH 1RUAL 1FC1A 4LLDB 3RPKA 4M7LL 4BH8A 4JRYD 3R06B 3CPLB 3GMQB 5BMFH 1RK1A 5DA4A 2AQ3A 3GHBL 4MD0A 3L3JA 3RPIB 4EIZC 4AJ0A 4FZEH 4JFZL 1UT9A 3CH8A 1I8IB 1T6VN 3TIEA 1JPTL 5F1IB 5AYUH 4N8VB 2FGWL 3PHOB 1UYWL 3MV01 3GSWA 3W9DB 3FO1A 4LOUC 4AL8H 3JWDC 2OXGA 2F5AH 4PJGA 1BFVL 2ZSVB 5F3BA 3CDYA 2ZZUT 3QJHA 5I76B 3M17A 3K2MC 5DJ8B 2BCKB 1B4JL 1M4KA 2B1HL 3KYKL 5EA0H 5C6PB 3K4ZA 4HZLB 5F21B 3OKKB 4WV1A 2YA1A 1GVIA 3HPJB 5D1QD 4I0CC 2E9JA 2VUOA 3KNBA 1BWWA 4U1SB 3VFOB 3MBEC 2CK2A 3HZYB 4OB5L 4WU5B 4HS3A 1HWGB 4HDIB 5EPMA 4RFOH 4NQDB 4DVBA 4EBQL 2OCFD 3QCUH 3HE6B 4JFED 4HD9A 1S7XB 3MRBA 2Q8BH 2ZG3A 1PG7H 3UXFA 4NUGL 5F9WB 5IJVA 3TZVB 5C0RH 5ILTH 1BLNB 5HTSA 3HR6A 3GMOA 5KVGH 3CJJA 2FWOB 1JZ6A 4URTB 5IHZA 3MJ7B 4XC1L 4PLJC 5EU6E 1ZHBA 1ZGLA 3RWCA 4ZTOH 1IC7L 3SDCA 3CXDH 3IJYB 4KI5C 1S7WA 3QPQC 1HKLL 5F9DC 4P59H 5I8KH 5D7IE 2R56L 4QRRD 4ZNEA 1MHPH 2LU7A 4OFIA 2I9LA 3OKYA 3D85D 2Z93B 2YRLA 1DQLL 3BKYH 4NT6B 4ODHH 4A6YB 1QLEH 2BVTA 3MLXL 3B9DA 4K8RC 1JHKH 1KIUA 4TUKH 1WTGT 1MQ8A 3HZVA 2DYPB 2R4SL 3UDWC 4FQQA 4K3DH 4NJAL 2PW2B 3L3DA 5TF1L 2P44B 3JWDL 4KVCL 2QSVA 3BGMB 2VQUA 2NX5E 3MRNA 5KSBE 3O0RH 5ANMA 1JZ7A 2UUDH 5LGJB 3NCEB 1BF8A 2QR0A 1K8IA 2YEZA 4HCRA 1ZLSH 2CK0H 1RMFH 2HFGL 3EOAA 4S1SH 1N6VA 2O61B 1QSZA 1TZGH 4L1DA 2FYYA 2QLVB 2DQIH 3AAZB 4ONFL 1PQZA 1DBJL 1X5JA 1CFQB 1NCCL 4BSWB 1A7NL 1UZ6F 5ACZB 3AXLA 1B90A 4WHYH 4NKIH 3REWA 4DOHE 1EMTL 1OLZA 3TNMA 5DJYA 1EERB 5ENWA 5CBAA 3DECA 3PWUB 1EHAA 1YYMH 4WUUE 4KJPD 1U6AL 4PY8J 5JUEL 5MHSD 1RPQA 5C0EB 4ZUTA 2G9HA 1INDH 3RX7A 4HCRH 3RL1B 1URLA 4TVPE 1J87A 1CICD 3RZCD 4OLZL 2VR4A 2DDQL 5SWSA 4JFDB 1C7TA 1M7DB 4PRHA 3GO1L 2K7QA 1QTYT 5IB5B 4P3DB 2AEPH 1CLOL 3VGHA 3VCLB 4ZPVB 3HC0B 1I9RL 2C3VB 2RHEA 5DMKA 2HH0L 5DJ0A 2ZUUA 1NGYA 4FTVB 4J1UA 5JPMA 2JB6B 1ZANL 4BH7B 3MGTA 1DANU 5C86A 5HSFA 3C6LA 3ULVC 4UDUB 5JO5B 5F8RC 1AD0A 4K8RL 1J0KA 5IJKA 5ID0B 1NMCC 1N59A 4H1LB 4MD5B 1LE5A 4OI9A 1IKFH 2VZSA 2NXZB 4YGVB 4I2XE 2W0FA 5IM7B 1E4XH 5GGTA 4BSVB 3OB0K 3HG1E 4Y4HB 5IMOA 5GPRA 3EIFA 3LEVH 2IAMD 3OXSB 1NBYB 4P99A 4UIMB 5E4IA 2PTUA 2EC9T 1YEKL 4CN4A 4O9HL 2VLJD 3VGAC 4S1DC 1CLYL 3T0EA 4HKZA 1MFCH 2UWEE 4D0CB 3BDYL 4B5EA 4J6RH 4GAYB 1I7RA 2HJLB 3DURA 1S9WA 1IAII 2HYMA 5CZVH 5I1DA 3UO1L 2HN7A 1FQ9C 4JM4H 1TQCC 2J1KA 5J06A 5GGTH 3PGDA 4CW1B 4NM8L 3KJ6H 2ATPB 4X4XA 1I8LC 3HCVA 3H6JA 4JO2H 2CO6B 2NY0C 4Y4FC 3TH3T 3CVIH 1XFPA 4HMDA 2ATKB 1T83A 2VLRB 3S4SG 1B88A 2Z0BA 4WO4A 4MNGB 1U93B 4M8QA 5HHPB 3VFSB 1JGDB 3VWJA 4N0UE 5HGDA 3DVNB 2ITDB 3QIUC 5T3ZE 5DGQA 3ULVL 5BV7B 2GSIB 3VI4F 4PGBA 1YEFL 5DUML 1DQMH 4FRWA 1R24B 2DBJA 1I1AA 4NC1C 1XF2A 1MCLA 1X5IA 5DWUL 5EOTB 5F9OL 5GRVK 5TGBA 4M7ZC 1IJ9A 1JWUB 5TDNB 5FK9A 1IMHC 3ULSA 5CJXA 4MB5A 4WI4A 4DZ8A 3UPRA 2WIMA 1EX0A 4NQVB 4UQ2A 2ARJB 5ACMA 5B22A 3TO4D 5E2VL 3HMXA 4KTYA 1VPOL 3TJHA 4OI8A 4GOSA 1LE9A 1EJOH 3JTSB 3BUYB 2VH5L 5GZOD 1I3UA 3RKDD 2J12B 3GSOB 5I1AA 5HJ3A 4M5YL 1JF5A 2XYCA 2Y6SD 1DE4B 3QP3A 5F8QC 4PJ9C 4PB0H 1AGCA 5ESQB 1IILE 5L9DL 4JPVH 3QUMA 1NGPL 2OTPA 5SWZD 2N7AA 4XVSL 4C83A 4YXLL 5D1ZD 1BQLL 4G5ZL 1T4KA 3F6IA 2ZNXA 4RGMC 2IADB 3LD8C 1U91A 1PYWA 1U36A 1DEEB 4FQCH 5EU6A 1NGXA 2DQCH 3QG7H 5TE7H 4XAKD 3DV6A 3IF1B 4R26H 4PJ5E 5AG8A 1EA9C 5IROA 1YEHH 2IBBA 5ALBH 2EZ0C 4ZPTB 1YNTA 1KELH 1OGAD 1AKJA 1X44A 3GI9H 4YQXL 3SE3C 3QWOB 1E4KC 4QT5B 1F11A 3NAAH 3QUMH 3D39D 2BRRH 5D6DA 3SDAD 1Y6MR 3MUZ1 5HGGS 5J0BA 4WNQB 5GS1A 1T21A 1AE6L 3KPPA 3BO8A 3LH2L 3MRMA 2FBOJ 4R6UA 1TZIA 5HDBE 2NX5A 2YPKA 5KSBA 2XZAH 4GQ9H 1UFUA 5D4QA 3LB6C 5DD1H 3T65A 4BA8A 4EUPA 1ACZA 5HHXH 4TOYH 2CUIA 1Z9LA 5DHXB 4H88L 3EFFA 2NTFA 5D7LB 4HC1A 5HVGB 1DQDL 3TVMC 1UZ8B 2C3HA 4WJ5B 3QXDA 3MGOB 4K55A 2Q7YA 4ZXBC 5D2LE 4XC3H 4OKVA 3ARBB 3N1MC 3Q5TA 3MV7E 4OZHF 4QOKB 4WDIA 1A9BA 4QCIA 5EBLA 3D9AL 4U6XB 3X3FH 4K23L 1TQBB 2NY2C 4WUUA 2AK4B 5E9DB 1NGWA 1QLFB 2HRLA 3ZKND 3GMPB 2R1YA 1CXLA 5FUCE 3SDDA 2JJTA 4EUPH 4P23D 2XWTB 4XBGA 3Q3GB 1T7VA 4HC1H 4WIQA 5LAXA 3MXWL 3WJLA 3AM8A 4LPXA 3QUYC 3RDTC 4U1GB 4PGDA 4KY1H 1RD6A 1YY9C 3O4LB 4YDKH 3OF6A 4LEXL 5I75B 2DQDH 4JEGB 4I0PB 4UINL 3P9LA 4CVZA 3EOBA 2KPNA 1YEDB 5K59E 2E7LE 1VGEL 3S34H 2PTVA 3DVFA 4PY7A 4Z7OE 3E0GA 3VXTA 1I7ZA 2O93L 2OTWA 1RHFA 1QYGH 5ESVA 4XPBH 1MCQA 4X6FB 1FBIL 2E6QA 4TVPH 4U1IB 3TCXA 4N8CH 4ZUVB 3PDOB 1ZHNB 3LQAL 2HFTA 3HG1A 5DJAB 3ZZ1A 5LXGL 3MREB 2YC1A 4WI5A 3JTTB 2ICEA 3O8XC 3ZTJH 4Z5RA 5T3XE 3BH9A 3C2AL 4LAQL 1P4IL 4ERSL 5IFAH 2UWEA 5MEOA 2CJUH 2CLZB 2PR4H 3V4VH 3V8OA 1KEMH 2B5IC 2D31B 4MNHB 1CFSA 2IQAB 2P8LB 2I27N 1KJ2B 4M5ZH 4DKFL 3K1KC 3BP6B 3GHEL 4W68A 5DJDB 1F3DH 1CL7H 3HC3L 1EEUA 4XP6L 4XVUD 4FOMA 2EDXA 2GYSA 3SCMC 5CZKA 1XGUA 3BESR 4PJFF 1BP3B 1GGTA 3SDCD 3KAAA 2VXUL 1D5ZB 4M7JH 5KS9F 5D7KD 2FX8L 5TE6L 3F58H 5HHVH 3ECBB 2CDFA 5L7XL 2UYLA 4PUBH 3U6RB 1CE6B 3WLBB 4N0UA 3CFEB 1NCTA 1RSFA 4CU6A 4AM0A 4HLZH 1QHPA 1EPFA 3MJ6A 2GFBA 5DC9B 1G9NC 4PS4L 3OZ9H 4HIJB 3CFCH 2PYEB 4AEHH 3SGKC 2V5TA 4K2UH 1UACL 4JLRB 1T04A 4RFEB 3V0AC 3W2DH 1DR9A 3QPXL 1T1XB 4FQHA 1OL0A 4GKZB 5FOBB 2ORBH 5E6YA 1MLCB 2KQMA 3NH7H 2UY7A 2JJVA 1TIUA 4KUZH 1G7QA 3CU7A 2C1PB 5KSAC 3EJZC 3BE1H 3LY6A 3CLFL 1U8QA 3PXJA 4NC2B 1DBKH 5HI4C 1N7ML 2AJUL 5KG9B 5J3HC 5CGYC 5B21A 5CBEB 2BNQE 2F74B 2B39A 5IW3A 1U8LB 3GDBA 4OT1L 3X13B 5E99L 2OMNA 2HJFB 5BO1L 1Q9KB 3LKRB 5SWSD 1F4HA 1CGXA 4PRHD 5FKPB 1Q38A 1G7JB 1TITA 3AY4C 4TNWK 1M05B 4KJQD 2XN9E 5KS9B 1FJ1A 4O2CA 5SX5H 2R23A 4CMMA 1QVOB 1PY4A 3MUJA 1RZ7L 5DQDL 3NIDE 3L5XH 3NABH 2RBLA 3U4EA 3QHFH 3UYRH 1J8KA 5IMKA 3RNQA 1VERA 1OARH 3SY0A 5JW5B 3C6LD 3KS0H 4GG6E 2NXYB 4ODTL 3T0WA 3SCMA 2ADFL 3HS0B 5JZ7D 1MFDL 3MRDA 1G9NL 3BJLA 1MHHB 1N4XL 3LS5L 4PJAE 4UNUA 3A6CH 1VADA 1C7SA 3PP4L 1JNNH 5BOZG 3IU3B 1V8HA 3NFNA 1VFAB 1IC1A 1J0ZA 5JW4Q 1JF1A 1G7MA 1SMOA 1W0YT 5LKNA 2F58H 1EK3A 4ISVA 4F15C 2GAZB 4L8DB 3MLSH 5CWSB 5D2LA 3O6FC 5A2KH 1IFHH 1WWCA 3T0ED 3MV7A 1DL7H 1SBSL 3SGJA 4QF1A 1HEZB 3FQUA 2B8OT 1EV2E 5D7SH 3BZ4B 1MWAL 2P5WE 2HFEA 2ZNWA 4K3HA 1CVRA 3BRFA 3NCJL 1X5YA 4YIQB 4WHTA 2FL5B 3ZE2E 4NQSB 4RCAA 5B38A 3LN9A 2WWMD 5MP6H 4G8IA 5A2JH 4YNYB 2AJ3A 4HUKB 5DRXA 12E8H 3BISA 5C0BE 4P4KC 4WO4D 5EUOE 4QNPF 4ZOBA 1MJUH 4NRYA 2BY0A 2J8UE 1J8HE 1TCMA 4JJ5A 3VWJD 3MRHA 4MQ7B 1C08A 2CUMA 2X9XA 5GXBB 1T1WA 1A4JB 2E7LA 2ZCHH 3U7WH 1YMHA 2OMBA 5E70A 2GK0B 4M43H 4U1NA 5TF0A 3HMWH 2FCBA 4P9MH 1I1AD 3QRGH 1AGFB 4NQXA 3QUZB 2NY7H 2IGFL 2PUQT 1P7QA 5DVMA 1T3FB 2W1NA 3SDXB 5J9PB 3BPOB 5DD3H 4HS6B 1P69B 4MX7B 4ODVH 2I26N 4NZJA 2R4RH 5HVHB 4U1MB 4JM2B 1FORH 2NNAA 4MAUH 4C59B 4ZYKA 4M1CC 4UT6L 1K4DB 1OTTC 1JK8B 1BPVA 3IDIB 4I13B 4LSTL 3DTXB 3UCRA 1JF6A 4FXKB 4Q6YA 3BT2H 3TJHD 2BNUB 2WBJA 1AIFB 1O5DT 1UJ3A 5D2NA 1X7QB 3P4OA 3LKOB 3EJJX 4C56E 4JQXA 1I3GH 5FYJU 5I1HH 3BXNA 5IKCB 4U0RB 3O45B 3BVNB 4WFFE 5FGBC 1F6FB 1NCWL 2GUOA 4RGNC 3F5WA 3IXTA 4K7FB 5C08E 1MI5B 5T3XH 3WHE0 5EU6D 3DRTB 3ILPB 2AABH 4P2YA 2FATL 1NKOA 1H0DA 1A8JH 2EYTA 1BWMA 2A83B 2VDKH 4LHQB 4XP4L 3W11D 1CD9B 1IAKB 2VMFA 1GGYA 1AKJD 2VKWA 1ODAA 1EEZA 4JRXE 4LGPB 3B8YA 4PRDA 3BZEB 4F7EA 3FT2A 3ZDXE 1MVUA 3PWNB 1Q9WB 4GAGL 5IGXH 3MLRL 3HFMH 1A4KA 3VXSE 1BJ1H 5FYLE 1RUPL 1WV7T 1V3LA 4U2ZA 1NCAH 5DD5L 3BFOA 1ZGLM 5D8JL 2NX5D 1NSNL 1PEWA 3C5JA 5B8CB 4X6DB 4R8WH 1MAJA 1HHHA 3BKJH 3FB5A 1ED3A 5GSRA 2IH3A 4NZDA 2DLEA 3I9GH 1JHTB 1GGIL 1S7VA 2FD6L 4FFWD 2QKIB 1TVDA 1TJGH 4EOWH 3W82A 5E8OA 3TNNB 5TPWH 1F00I 3PJSB 1TNMA 1BBJA 4NDMA 5K33A 4WUUD 1RAMA 4NZUL 4MCYB 4RZCB 3EO0A 2BNQA 4P5MB 2ZUVA 2Y06L 3G9AB 1NEZA 3UC0L 5MEPA 3SDDD 3EKCA 5EUKA 1UKSA 5DEFA 4GXVH 3WE6B 4BQ8A 2QHRH 1HKFA 1KV3A 4TVPD 3RVWD 3AMKA 3MRQB 4U0QB 5BZWB 4MXVE 3ZHLA 1C5DA 3SBWA 4LHUG 4O2EB 2UV3A 2XN9A 5FKAA 5D7JA 2ARWA 1NMBL 5LVEA 2Z35A 4OM0L 3W0WE 2DIAA 3OF6D 4WTWA 4OD2A 4RDQG 2M1KA 4AIOA 2GJJA 3VDAA 1CFTB 3LPFA 1NLDL 4GG6A 4JANB 1QSVA 1H3PH 5JOFA 1IKNC 2YK1H 5DQJB 1L4IA 5DUBB 4HV8B 4PJAA 4PG2A 1A6AA 4JB9H 4NJ9H 5TFSH 4WTZG 2P47B 3WEXA 1FHGA 4UTBL 1G7LB 4HFUL 4UT9H 4Q6IB 4YDVA 3BIBX 5I1GL 4YHNA 3HG1D 1AH1A 4OLVH 2ADIA 5FGSA 3BKMH 5F3HA 5MENE 3HZKB 1G0YR 5EOCH 4JHBA 2VDML 5I66A 4KRPD 1FLRH 3DX9B 1ZK9A 5ITBL 4JPKH 5JIKA 4L4VD 4WU7B 2PO6C 2HTLD 3RU8H 3S98A 2A77H 1R6VA 4XWGH 1IGMH 1P1ZB 1W72B 3GM8A 3DROA 4Y2DC 5FF6A 2P5WA 3T0XA 2NW3A 4OQ1A 2OBGA 1FFOB 4OUOA 5IFHH 3LKQA 4R4FL 2DQFA 1I1YB 1W8NA 3WXVL 1MLBB 4R90H 2V7NB 5LGHL 4F37F 1IAIH 2XG4A 3MRKB 4JKMA 3WIFB 5GJTH 1PKQB 5FB8B 4HBCL 4M6NL 1HHJB 4WWKB 4NNYA 5C0BA 3RKPA 3ZKQD 4PY8I 5EUOA 5AZ2H 3IU4L 4LLQB 4I8DA 2J8UA 1J8HA 2CDEB 1AR2A 2ZOKB 4NN5B 5IIEA 3GSXB 1U95A 3RL2A 3VG9B 1IGCH 1M6OB 4ZTPH 1KNOB 5A3ID 1UVQB 2HVKA 2HVJB 3OKMA 4LU5H 4JO1L 3LZFH 3CX5K 3O11B 4OTXH 4TQEL 2G75B 2XKNA 5E2WH 1IQDB 3MXVH 2Q1EA 3PF2A 5DR5L 1T2QL 2VDNL 5FA4B 1XCQA 2OJEA 4ZG1A 4BZ2H 1CD1B 2Z8VC 5DYOB 1BVKB 4UQ3B 4EVNA 4IS6B 5K9OA 2L7JA 2H9GA 4KK5D 3R1GL 3J8F7 1TJIH 3X12B 1R3HB 3OGCB 4IJ3B 4YUEH 3QCVH 1D5IL 2HT4D 3ZDZE 1XIWC 1BFOB 1SVZA 3E3QE 3EYVA 1KT2B 3K8KA 4N0FA 3CDGB 1U8HB 2PTTB 1TTUA 1C1EL 4C56A 3S5LA 3EO9H 4N90E 3WS6C 5I73C 3P77A 5DC4B 2EYRB 2VZ3A 2WLYA 4O5LL 3GK8H 5FXCH 3CFKA 1RUKL 4QRQA 5DEZA 5C08A 4ZQKA 5KBNC 3Q5YA 1ZHKA 3V6ZB 5HHNA 2EIZA 2OL3A 4TSBH 1DBBL 1T66D 4YFDB 5I9QB 1OQXA 5IBLD 4Q2ZB 3PXHA 2OI9A 1E6OH 4CNIA 3IDNB 5KANG 5JNYA 1NUDA 1KCSL 1JWMB 4JRXA 2VISA 2V17L 5MI0B 1YDPA 4XVJL 3GJFB 1JTOA 4LVNB 3SCMD 4WW2A 1S9VA 5EORL 3MFGB 4NCC1 2CIKB 4IM8A 3DRQB 3AROA 3WDHA 3VXSA 3BEWB 2MJWA 4OKDA 1R3KA 1F58H 1AR1C 1Z9SA 3C5SB 3P9MA 3QEQB 3PGCB 4G6ML 2JIXA 2OL3H 5DK0B 1JI2A 5IBUG 1CXHA 3B5TA 1PEZA 3U0TB 3BP4A 4UOJA 1XGRA 4BZ1L 3ZYIA 1WCQA 5IFJA 4O4YL 2PYFA 4GSDH 4JG1L 3IFNL 2GHWB 5LBSH 1JRHL 5F7EH 2VITA 1N6UA 2IBZX 4RA0C 4Y19B 3MV7D 4LDEB 5FYLH 4LL9A 1QQDA 3BMVA 4W6YB 1J05B 4OZ4A 3M1BB 1REIA 3KXFE 3PHQA 3EW3B 1YPZE 1UM4L 3LHPL 3N9GH 4NO2B 1L7IH 4C55A 3ARGA 4AZ8A 5CEZH 4DN4L 4LCWE 1SVCP 2CMRL 5F88B 5KVEH 3O9WC 1HQ4B 3I2CL 2EDJA 2NR6C 3EJYC 1JNHA 4J3XA 4F8QA 4XNMA 1MFBH 1MIMH 5DJ6B 1NCDH 2BC4A 3JVGA 3IS1X 3TT1L 3W0WA 3RWHA 1I4FA 2D3VA 1CK0H 4U31A 3CZFA 1K6QH 3T77B 1OSZA 4EI5B 5CEYA 2XZZA 2BOBB 4XNUL 4F57H 2NQCA 4KQ4H 5CEXB 2FZ3A 1OAKH 4LSUL 4P3CL 5JXEA 3BQUB 3L5WA 3DO7B 1LK2B 1OSPH 4CMHB 2C1OA 3QR2A 2A6KB 3VXNA 1P7QD 4JZJC 1BEYL 3E3QC 2PXYC 1QFWL 1E4JA 5LQBH 2DLIA 3NCCB 3OKOA 5J6GB 3BWUC 3I6GB 3Q0HA 1INEH 3P73B 2I9TA 2VZUA 1PSKL 3DUUB 3TO2A 1KIQB 3ULUF 3ZTNL 1A5FH 5MENA 1OGTB 5T3XD 3FT4B 5I2IA 4GXUN 4QYOB 4XNYL 4TRPL 5D1ZB 3QI9B 3VFNB 4N0CA 4KGJA 1F3JA 2BRQA 3AVEA 2JB5H 3RI5K 1BX2B 4B53A 4YO0B 2WBJD 4L4JA 2X7LB 25C8L 5F9AC 3MA9L 3H3PL 2VE6B 5CUSH 3OR6B 1ZHLA 4NKDB 3ROOA 3HE7C 5CHNB 4OM1L 1UG9A 4GMSH 2AJZA 4JFZH 3VU2A 1FDLL 1J0HA 2NY5C 3RWGA 4KMTH 2DQHH 2VDQH 3D39B 5F7UA 2V5SA 3SDAB 2FGWH 1ZGLP 1SJVA 4X5XA 4KTEL 2ZCKL 2P8MA 4X6CB 5MERB 1WFOA 3MLUH 3Q6GH 4GS7C 5D93C 5DO2C 3WMSA 4K71B 2Y7QA 4WI7A 3DYMA 4XP9L 1DN0A 3HI1A 1DQJB 1N5YL 3U30C 2D0HA 1INQA 4L3CA 1D9KA 1FO0A 3U82B 4YHML 2I07A 3CD4A 5C3TA 2R2EA 4V2BA 3CVHL 3VFUA 3WNMA 1ORQB 5BW7C 1Q1JL 4MJIE 1LEKB 1MHCB 5E00B 3CNKA 4EBQH 1QZ1A 1JFQL 3AU1A 3V52H 5F7FA 1J10A 3IKKA 1XF5B 3MC0A 2DQEL 3OX8A 4LCCC 1HXMA 4AEIH 4NUGH 1FL3B 3VH8G 4D3CH 2J4WL 5C2UB 4ZS6D 2VWEC 4OLXL 3QDAA 1YZZA 4M6MH 4QXTB 1K85A 4IRZL 4P57B 3VWKC 1E6JH 5DFVC 1N3NB 5TE4L 2V9QA 4BFEA 2VAJA 1ADQA 3T2PA 4O58L 4ACPA 1H9VA 4RMSA 3IDXL 3MCLL 4MSWB 1QUNA 3ZKXB 8FABB 2YWYA 4FQJL 4HKXB 2Y36H 1FNLA 2BNQD 1ZMYA 3WDJA 1RJZB 2CLRA 2W9DH 35C8H 1HH6A 1M71A 3IDUA 1DUYB 2X4QA 4O02H 1FGNL 3E6FB 2ZSWA 5EC1A 3ES6A 5DHVA 3TIEB 2AGJH 3VGDA 4Q9CA 3FOLB 4GRLA 3B6SB 3VI3E 2R4SH 1CG9A 2XN9D 5GRZA 5TF1H 1R0AH 5D7JD 2EEDA 1ADQH 2HMID 2A6IA 4XI5C 4NUJA 4B7IA 2DQTL 4G6JL 1X5AA 2ESVB 3QJHB 5ISZE 4KK9D 3MODH 1B0WA 3M17B 1J1PH 1DLHB 2QBWA 2XQBL 3TIDA 5K9JL 1OTSD 3E2HB 1JPGA 3HNTL 4HAGA 5FYJL 1ZWIB 2Y23A 1DBJH 2BMKB 4WV1B 1CTOA 4JY6A 4YHYC 1NCCH 1A7NH 4UOW0 1UKQA 3UPCA 5DHVH 1FNEA 3SKOA 2YBRB 1MHEA 3RWIB 1MJ7H 1EMTH 4ONHA 4XPHH 4X8JB 3B43A 1TVHA 2A0LD 3WNOA 4DVBB 3RUGF 4LLWB 3VRLE 5IR1A 2XTJE 2VKXA 3OAZK 3WUWA 2X4PB 3DVGA 5DVOA 1W2KT 4TYUA 4CN1A 4HUXB 1FRGH 5HVWA 2IPTL 4LLVA 1QKZH 2ZUQB 3F7RA 3P0VL 4J8RA 3VFTA 1T22A 5AD0B 4LBEA 1YEIH 5DS8B 2GJZB 5J11C 1RJCA 1CLOH 2VR9A 3PDGA 2QADC 1NBZA 1BECA 3GSQA 4KKLD 4LCCA 3KXFA 1IL1A 2JELH 4JKPH 4PREB 1YPZA 1YYLL 5E8PA 4UDTB 3SKMA 2P5WD 2M8XA 4R7NB 4LCWA 1MCPH 4G8EB 5FYKU 4CN6A 2HKHL 5GRJH 4LP5A 4DW2L 3PV6A 2BERA 5GGQL 3DIFA 1I9JL 1NCBH 2P45B 1C12A 5CJ5A 5HYSA 4LRNL 4N0RA 4FQQB 4DWHA 2H2SC 2OQJA 4G80B 5C0BD 3SGDI 2P4AB 4ELKA 3QEGL 2SEBA 1J8HD 3MRNB 5A2FA 3BZFB 4PJEB 1JIBA 3MJ9L 2YEZB 3WN5C 3MV11 1IAOB 1LDSA 2VDPH 3ZSSA 1YEKH 1CGTA 2FYYB 3GJEB 3FB7A 4FQPA 2FO4B 4ORGA 1PQZB 3OV6A 2K7PA 2X4TA 3KYNA 1DVFB 1VACA 4YXHL 3L9RB 4WI8A 1HILA 1I8KA 1FAIL 3RUGB 2W0PA 4O00A 3TNMB 2CQVA 2A6JB 5DJYB 2BSRB 5B4MC 2V5RA 5ENWB 2W9EH 1KTDB 3UX9B 1H3GA 1PDKA 4GW5A 1TPXC 3SE4C 1A9EB 1JBJA 2AP2A 3IDYC 4NNXA 4PJ8B 43CAA 3H9HB 2P49B 1D5MB 4NM8H 3TF7A 4G43B 3SPVB 5EZIH 5EO0B 3QHTC 2BY1A 1U58B 3BDXA 5TH2A 1MF2H 4TNVK 2MCG1 4JHAL 4GBXC 1N5AA 4C56D 1UQSB 4Z7VB 1XF3B 4M61A 5DMKB 5DJ0B 1Z9OA 4J1UB 5BJTB 5JPMB 3ULVH 4PJHF 2Q76A 3C6LB 2CXKA 1F4XL 4NSKB 2EE9A 1OP3K 5C08D 5DUMH 3EFDL 4Y1AE 1QFHA 5D72H 5M94B 3K81A 5KVDH 4RNRB 1YEGL 1N59B 5DWUH 1LE5B 5CFHA 3IDJA 2VAAA 3QIWC 4HPOL 5DD0L 4OSUH 3L1OH 3LKSA 5IW6A 3CLEH 5EG6C 5I1IL 1N0XL 1XR8A 3RTQC 2EH8L 1A7PL 4JRXD 5HYQA 3WIIH 3LRSB 1YA5A 3IVKB 1L6XA 3VH8A 4L8CA 4IOFC 4ZSOB 5C9JB 3RVTD 5FHBL 1WTLA 4GUPB 5HY9A 3QAZB 4RMWA 3VXSD 5FYLD 4X5WA 4JFDE 3RVXD 2X44D 4MJIA 3O2DA 4ONOA 4JCMA 1IGFH 1FIEA 1OP9A 1X5HA 4HKZB 5E2VH 1ONQA 3K80A 2DI8A 2JIXD 3WHXA 3WDIA 5JDSA 2N7BA 1X5ZA 2BVQB 1SM3L 4M5YH 2HN7B 5D5MF 1A7RL 3MNZA 4FTVE 2JK5B 4LRIC 5KAQG 4V3DB 3NA9H 1KLGA 3TFKC 4Z78A 5FECB 5GGRY 1BQLH 1T89C 4G5ZH 4K9EH 2W0LA 4B0MM 5C8JA 4CBPA 5C0JA 3KLDA 1Z5LA 5A16B 4U2YA 5EN2B 4IMKA 4KROB 5DRWA 3O2DH 3T08A 4F7MB 3C8DA 4J3VA 1AGBA 4IRSB 4PRIB 3VWJB 3PIQA 2GSGB 3ARGD 4NRZA 1KB5A 5GS0H 1VKXB 3AREC 5HGDB 4PJHB 1ZLWH 1TNNA 2P1YA 1LO4H 1R3JB 3FMGH 5F44A 4PGBB 3C2SA 1E4WL 5DMGD 3ROLA 5HDLA 4W81A 4NO0B 1U3HA 1MRDH 2VABA 3GMLA 3STZA 3T2QA 3W0WD 3BW9B 4NN6B 1FZOA 3C5ZC 5FM5O 1B2WL 3Q1SL 3VXQA 5KVFL 4XPFL 5ISZA 5KSBF 4ESKA 5F7MC 4CVUA 2DQGL 5FK9B 3ULSB 1KB5H 4NQTA 3I75B 1ETZB 4DZ8B 3GBML 4MNQB 5JXED 4YLQT 4UQ2B 4XXCA 2HP4A 1IGIH 3D9AH 3BIKA 3F7QA 4I77H 2VLRE 1LE9B 4D9LH 4NHUB 5D5MB 3DX8B 4J23A 4MNGE 5F7WC 4CKVX 1VA9A 1DSFH 3CPLA 3GMQA 3LS4H 3R06A 4G3YL 5GRVL 4D94A 2LAAA 3RPIA 1AGCB 5MEND 1KJ3L 3WS3B 1I8IA 1HHGB 4JY5L 4N0CD 3FB8B 5F1IA 1K2DB 1U91B 2DI7A 4N8VA 3W9DA 4X7FC 4YPJA 4ZD3L 4HH9A 3DV6B 2VLLB 3V0WH 1UXSB 3SE8L 2ZSVA 2Y07L 4LEXH 2NY1D 3ZHKA 2C4XA 4HWZB 5CJOL 4UINH 3VXMB 5I76A 3INUL 1VGEH 3MBXL 5DJ8A 1FG9C 1XF4B 2BCKA 3FQRB 4Z7WB 4HF5L 1IAIM 5T1LB 3DGCR 3B5HA 3HPJA 1WEJL 4XP1L 1L8JA 1YJDC 5GS1B 1CI5A 1UH4A 5K9QG 4U1SA 4BFIA 3VFOA 3HZYA 3KPPB 4WU5A 5D1XB 4BSJA 1K5NA 4HDIA 3BO8B 3UBXG 3B9KC 2YPKB 3HE6A 5J89A 3BPNB 3LQAH 4OV6F 3LDBC 1S7XA 3CSPA 2WAHA 4XMPH 4IRJB 1D9KD 2W92A 1RY7B 3TZVA 1BLNA 4LAQH 4P5KB 4EKXA 1P4IH 3QJFB 5I1CH 3WUZA 3MJ7A 2IF7A 4S1QH 4ERSH 2D4DA 4UT7L 2CPCA 4GKSB 2UWEF 4OLUL 1GSMA 1NGWB 4ZNCD 4GAJL 2FBJH 4DKFH 4OF6A 2R1YB 4U1JB 2DBLH 1CLZL 3VI4E 3RIAK 4U3XA 4XBGB 4NT6A 4XP6H 4A6YA 1LQVA 1EBPA 3ZKMD 2VZTA 2DYPA 1D6VL 1FE8L 4RFNC 2Y9RT 4UTAH 2PW2A 3GNMH 3J7HA 1PX4A 5J1AA 5LCVL 3SKNB 5LGJA 4N90D 4DGVH 3CAFA 3JBG7 5IW1B 4MVBC 3F7VB 4E41B 4PY7B 5D7LE 1NBQA 5L8JB 3AAZA 4OZFG 5E4EB 2VXTL 3E1F1 1RZJH 4Y1AA 2VJXA 4GRLD 4BSWA 3JUZA 4NZRL 1YJDL 4A6YH 5ACZA 1EHNA 2RCSH 1U2CA 5HPOA 4QOKE 3RGVB 3L3KB 1RHHB 4XNXH 1BZ7A 2BSSB 2K1MA 1RZ8B 1KFAL 4XNQB 1RIVH 3RVUC 3ZYZA 4Q9RL 4WEUD 1J11A 3T2NL 5C0EA 1LO2L 1OAQL 2YC1B 2CXGA 2ICEB 1AY1L 4S10A 3V5KB 4N5EA 3RL1A 1UEMA 3CLFH 2DM2A 5LWYL 5E2TL 5H37H 1P9MA 4JFDA 1M7DA 4MWFB 2ENSA 4LQFL 3IDMB 4L4VB 5IB5A 3M8OL 4P3DA 2QSCL 4F2MB 4KAQH 1G9EA 3S4SB 4IDLA 1BZ9B 3VCLA 4ZPVA 4DKAA 3HC0A 1FVEB 4S1RH 1G0DA 2C3VA 3DHJA 4XHJD 2UZYB 1F90L 1OTUC 4XPTH 2JB6A 5E99H 4BH7A 5EZOL 4LKCB 1DFBL 1IBGL 4MQXD 1F02I 5DUPH 5JO5A 5KN5A 1EJ6A 4I0KA 4PD4K 9CGTA 4DN3L 1P2CB 4H1LA 4MD5A 3KXFD 4OCXH 3N85L 4AEFA 3NVQA 4GQPH 4YGVA 4J4PC 2CDFB 2UYLB 5HHOE 5I71C 5IM7A 2MMXA 1S3KL 1MREL 4LCWD 1JJUA 3GM0A 4WCYH 4Y4HA 4BQ6A 4ODTH 4R0LB 2W65A 2G60L 4UIMA 1HDMB 1F97A 3MJ8A 1CIUA 4POYA 3LQZB 3C60B 4G9FA 1RU9L 3GRWA 5F6HJ 3NIFF 4D0CA 1MWAA 3KJ4B 3IB4A 4DJMA 1T0NB 4FQHB 1NMAL 5HDBF 4R4NC 4BFBD 2AJYL 4Y89A 1I7UB 2FH6A 3FN9A 5HYJB 1YNKL 5C0CB 2ATPA 1LP9B 3QIBB 3ME0A 5HDQH 4P2OB 3VA6A 2ATKA 2VLRA 4PJCF 4FG6C 1MWAH 2DM7A 1U93A 4MNGA 4MS8C 5HHPA 3VFSA 1JGDA 4HXAL 4JFPB 2BVEA 3DVNA 1VFOA 3LMJL 2X05A 2ITDA 4X4ZA 1LO3H 1X5GA 4Z8FH 3S35X 4MQTB 4OJFH 1NGQL 4EJ1C 3L3IB 1CE1L 3A67L 2GCYB 1A6VL 2PYEE 2VDRL 4YX2L 4PGCA 3ARBC 5EOTA 4P0DA 4RMQA 3UBXA 4YPGB 2QTEA 5GQBA 2VTFA 3WO4C 5F1OB 2HKFL 4UAOB 4NBXB 3AMLA 2FX7L 2EIDA 1JWUA 3O6KL 3RNQB 5IMKB 5TDNA 4EIGB 4MA1C 5C7XL 3EDDA 5JA9A 3MRDB 3MLYH 5I8EA 2QADD 15C8L 4JKKA 4NQVA 4LVHB 2ARJA 1VADB 3C8KA 4LDLB 4KKAD 2LQRA 4LSPH 2X4NB 3RVVC 3HKFA 3MACL 5SWQB 3ISWA 5EIIB 4Z95H 1DUZA 1KCLA 3JTSA 3BUYA 4OCNC 4KVNH 4U1GC 1G7MB 3GSOA 1Q72L 1WZ1L 3MLVL 4UT6H 3BPLB 1DE4A 3QWRA 1JV5B 1JNJA 5ESQA 1JTTA 4NHCH 4QWWD 1CDIA 3QNZB 5I75C 1PG7W 4I0PC 5IESH 2E7MA 1J1OL 4LSTH 4UMGA 2O5ZH 1DTUA 1OAYL 5FYKL 2IADA 4MJID 2Z4QB 1DEEA 4HIXL 4P2RB 5GGVL 2OX5A 4PJCB 4WFEE 4QF1B 4ODWB 1ZAGA 3IF1A 5GS0D 4ETQB 2CGRH 2P5EA 3BWAB 4KFZC 3PQYE 2XQYG 4OQTA 3C09B 1R3IL 4DTGL 1NL0H 4PBWD 2QQQA 1I85A 3G5YB 4WHTB 3CX5J 4LSSH 4QT5A 4M48L 4CAGA 5TQ0L 2B2XL 1QNZH 1CGSH 5L8KB 2FATH 4ZFFB 2AJ3B 5DRXB 5TDOB 3MOAH 5FCUL 5EZLA 4F9PC 5DJXA 4L8SB 4NRYB 4HX1B 3G5VA 4CVWA 1QBML 1C08B 4AY0A 5E08L 1ZLVK 4OQTH 3RWFA 4LSDA 5D7LA 1QG3A 1UZ8A 4QTIH 4WJ5A 3MGOA 2VC2H 4GAGH 4KRLB 2CR6A 3PG2A 2C3WA 3FZUC 4PLOB 1U3HD 1KENL 1I1CA 4QOKA 5JHLL 4F80A 3OPZL 2NY3C 3NGBB 4U6XA 2CRIA 5ISZD 1KCRH 2P8PB 2NNAB 4LFHG 5EU7C 3V6OC 1G9MH 3GMPA 4ZYKB 3X14B 5ETUB 3QHZL 1RUQH 2XWTA 3VFRB 2MWCA 3EDEA 2FD6H 4YGAB 5FGCE 4DCQB 3Q3GA 4JFQB 4OAWA 1X4XA 4FP8H 5D70H 4MCZB 4KJWC 3CDFA 2GTWB 3QNXB 3PABB 1UJ3B 4RQQB 5D2NB 4NZUH 2XTJD 4OCYH 4LNRB 4NBZB 3UC0H 4I18B 3BN9D 2CLVB 4JG0L 3MRCB 2IPUG 2APWA 5E6IA 2VXVH 3GSNL 3F5WB 4L5FH 4FN0A 4U1IA 4NYLB 4XPGH 5DJZA 4ZUVA 4ZUSB 4N1HB 4K7PL 4OM0H 3SDXE 3KWWB 5T33H 3OKEB 1OAUL 2YUVA 3PDOA 3ZYJA 1AXTL 5HHOA 1UH2A 3NIDF 1ZHNA 1EEZB 5DJAA 3O6LL 3LVEA 7FABH 4PRDB 3GKWL 4C57C 3FT2B 3ZE1F 1MVUB 4X80L 1A4KB 1S9YB 4HWBL 4PJAF 1WICA 5FA3B 1WGOA 1SEBB 5HGBB 2EDOA 4OIIH 2DD8H 1EUUA 3HE6D 5I74B 5IWLA 4TTDC 3GIVB 1TZHB 2NTSP 4QO1A 5L6YL 2D31A 4YFEA 1WZMA 4Q74A 1F2QA 2P8LA 4H26B 1KJ2A 1ED3B 2IH3B 4DGIH 3BP6A 3TZVD 2VDMH 3EO1B 5K93A 1Q0YH 3QISA 4Y4KC 4X9FA 5DJDA 4UBDD 1XEDA 3S36L 5E1AB 2WIIA 4PP1C 3RHWK 4UV7L 4JFFE 4IDJH 4Y16B 2E7HA 4OUUB 5I1JH 1D5ZA 3RBGA 1A6WL 2MNUA 3ECBA 2BNQB 4HZAA 3DXAB 3U6RA 5L0QB 2OP4H 3EYSL 4R4FH 1CE6A 3WLBA 3CFEA 4FQXA 5MEPB 4GG8B 5EUKB 3N06B 3BGFB 4QRPE 1QFOA 5LGHH 3BPCA 1KJ2H 4MAYC 1LO5B 3L3GB 4R2GB 1C5DB 3ARFA 4QXUH 4OV5B 2KZWA 4HIJA 2PYEA 3O2WL 2DYPD 1IT9L 3RAJH 1QR4A 1X5LA 3DYOA 3IU4H 4JLRA 5KTEL 3RFZC 2NY6C 4RFEA 4P5TA 3DSFH 4LVOC 5EUOF 1AGEA 3D0LB 1G6RL 5FOBA 3B2UD 1MLCA 1DLFH 2NY4C 1OD9A 4X6DE 4XPAH 5IEHA 1S5HA 5H94B 4JO1H 3QUXA 4PJAB 2RJMA 4Y1AD 4F33A 1HCFX 4TQEH 1B0RB 2G5BB 2GY5A 2LE9A 3HNVH 5DTFB 1VEMA 1FYTB 2VDNH 4FQIL 5KG9A 1V7NH 1QFUL 2NMSA 1M7IB 1NLBL 5CBEA 2F74A 3OG6B 4F58H 2ADIB 1U8LA 2FEDC 3KYOB 1MQKL 4Y5XA 5F3HB 4N5ED 4YE4L 3X13A 2M2DA 4M1DL 5I66B 1AXIB 2HJFA 4NP4L 1Q9KA 3TWCL 4QRUB 4JFDD 2PETA 4ZFGH 5FKPA 1G7JA 5FUOL 2FJHA 1VENA 4U05A 1OM3H 1QVOA 2DOCA 3QUZC 4YBQD 1EHLH 1WISA 3PQYA 3RWJB 1A7QL 5IT2L 5E8NB 4MB3A 4DUWA 4XNZB 5FUZH 5JW5A 3MUGA 1Z3GH 1MHHA 4FFVC 3VXUB 1P6AB 2R1WB 1WBYB 3FO0L 4KTDH 3IU3A 5EUOB 1F42A 1VFAA 2NXZD 3VGEA 1MNUH 1I75A 1IGTB 4Y4HD 2DKMA 4EN3C 4WI2A 4NGHL 1CDCA 2R2B