5IB2A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib2A01
1ZE3C 2A6JA 3NAAH 1C8PA 1MSPA 4XP6H 4U2YA 2NY2C 4AEHL 4GAJL 3GSNH 4KJWC 5GZOD 2EH7L 3ARDD 3TCXA 4WWKA 5F9OH 2VZTA 3BOVA 4GQ9L 3U82B 4G6JL 5CSBA 1D5IH 1AD9A 1FG9C 2ARWA 4FQXB 3QUXB 1T4KA 3C60C 4X6CF 5F93C 2VLLA 2WSKA 4APQD 1KYOK 2ZCHH 4PV8B 4DKAA 4UOW0 2XTJD 4YXLL 1E4WH 4UMGA 5HYEA 3WUZA 4J12A 4HXBH 2GFBA 1NCBL 2XWJB 3HPLB 5FK9A 2CLVB 1S9VB 1WWWX 5CMAA 5GRYA 1U8NB 2CDGB 5DTFA 3MROA 2DJUA 1I85A 4IBLT 2Q87A 3ZT5A 1FFRA 2V9RA 2BDNH 3HMWH 1NFDE 1JF5A 4WTZA 3MV7A 3EW3B 2GHWB 4UU9A 5I2IB 2A83B 5FHBL 1MREL 1HCVA 2XG4A 1ZT1A 1MCEA 2ZCKL 2R0KL 3O2DA 3JUYA 4DW2L 4JVWA 5FGCB 5F8RC 3DX6A 1M6OB 1FGVH 2IF7A 5TQ0L 4M5ZH 3C08L 4I3GA 3DHMA 5ANMA 4GBXD 1OCWH 3MV7D 1U0QA 4DVRH 1DDHB 1HIMH 5JHDB 3I3EA 4X7SH 1L6ZA 4HH9A 2DQCH 1NGXA 1S7UA 1S9YB 4U7MA 5IBUB 2AEWA 1AXTL 3TBVA 5CBAA 3SKOB 4GKSB 2X1PA 5CUSL 5B21A 2E7LA 3KPMA 2EECA 3H7BA 3T0WA 1HSBB 3PP3K 2CIIA 5F88A 1CFNA 2AQ3A 3VDCA 5F44A 1MHHA 3MBED 1RZJL 3VXMA 1I1FB 5MEPA 1AD0B 1JP5A 1YJDL 3ELAT 3H9SB 1NC4A 2FD6L 1NAML 3GDBA 4XX1G 5CHNB 1NAKH 4L1DA 1PY4A 3QPXL 5EU6A 4OBRA 3QNZB 1REIA 5IMMA 1DBAH 2X1OA 4U1LA 4Y4FB 4PUBL 4DGYL 5KS9B 2DLFH 5EOTA 4QHMB 4NN5B 3FFCA 4D2NA 1TJGH 3LRHA 3VXMD 1MUJB 3LQAH 4MXQA 3JTSA 1KEGH 1YEIH 1DBJH 5EU4A 5HVHB 3T1WA 4JHBA 3CFBB 5E8NB 3MLVL 2Z92A 3HAEH 1IC7H 3DTXA 3P4OA 1FQ9C 5IB3A 3HUJF 4PB0L 4UOJA 5CFHA 1PX3A 4FFVD 2JLLA 4TRPH 1EA9C 3T65A 3OAZH 2JJWA 4XI5D 1JHTA 1A6ZA 1BVKB 2VJXA 4Y19E 5JQ6H 5KSBF 5LBSH 5E08L 2VO5A 2B1AH 32C2B 3MXVL 2V5MA 4JG0H 1CFSA 2HFFA 4QOKD 3ARGD 4JO3L 5D8JL 2APWA 5IB1A 4UQ2B 4KI1A 5HYFA 2APVA 5FUCE 2YK1L 3QUMH 1WIOA 2G9HA 3JV0A 5KSVA 3LH2L 4HHAA 1HXMA 4BZ2L 3R06B 4KTEL 4HEME 3CC5B 3PWPA 5D7IB 2NCMA 5KTEH 4FTVB 4E0RA 4KVCH 1I9RH 5I75B 4Z9KB 1QSFA 1IBGH 4OZIB 3P0VL 2JB5L 2X4TA 4P9MH 1U8HA 3HUJB 7FABL 5KJRL 3GM0A 3KAAA 3QCVL 3QI9B 1T03L 4N8VG 4R4FH 1QFHA 4YHNA 1E27A 5TQ2L 3ZT7A 3H0TB 4NN7B 1YA5A 5FDWA 1L7TL 4JHAH 5DK2B 1N64L 1I4FB 4O58H 3C5SA 3VMOA 1X5LA 5D2LE 1I8MA 4XNUL 2ENSA 4KUZL 4WCYH 1SJEB 1Z2KA 1EPFA 4X5WA 1S78C 4HIXH 2OXHA 4X6FA 4UOW1 4QXGH 1KCVH 4WFGE 2YZ8A 1AKJB 1DBMH 2OJEB 3V4PH 4TULH 5HYJB 5F96L 3T0EE 3IT8D 1UVQA 1J87A 3NA4A 3Q5YA 5E6IB 5IGXH 1N26A 3C6SA 2RCSL 2OP4L 2HJFB 4WENB 2OI9B 3EZJB 1SEBA 4Y2OA 1VCAA 25C8H 2X4NB 1P7QD 2PNDA 5DWUL 1F8TH 3DSFH 5D72H 4PGJA 1R5IA 1YYLH 4I3RL 2A73A 4WGWB 3K46A 4KZDL 4Y4HA 1KN2L 5E00A 4M7JH 4B0MM 4F33A 4LSVH 3FCTB 2DQIH 4OKDA 3PWNB 5IHLB 4C54A 1JHLL 2IANA 3MV8E 5GRWA 3HI1B 4Z7NF 5F6IB 2AV7A 2FJGA 5T3ZL 3RI5F 1K8DA 3HAEB 4PV9A 1DE4B 4HWZB 5B3JF 3BP6A 4UT9H 3NMEA 4PJHA 2EC9U 4OCRL 2ID5A 4LPXA 2HJKA 3NCCB 1IRAY 5CBEB 1I1YB 3RVWD 1U6AH 3ZE0F 3ARBB 4EVNB 2DB8A 3DMMA 1FRGL 1BZQK 3HMXL 2FGWH 4RDQF 4YHIB 3VD5A 3DETC 1Q9OA 3O0RL 4YBQC 1Q72H 5I1DA 1CQYA 3WCYA 4IRJC 1HILA 4KKLC 4UBDD 2NY5L 5GGRA 3X13B 3ULUD 2IG2L 3QFJB 5E2VH 2E27H 3S35X 2XRAL 4F37K 3I6KA 3DVIA 4UNUA 5F1NA 3STLB 2FYYB 4MXWH 4P5TC 3SCMD 5BZWB 3T77B 1TMCB 4CW1B 2GK0A 3ARPA 3O2VH 5E7BA 5SWSA 5KSUA 1K4DB 1IFHL 2W0PA 4WFHD 5EA0L 3O8XD 2H8PA 4LSQH 5IB2B 1I7UA 2WV3A 4MDIB 4NIKB 1F4XL 3FFDB 3BIKA 3LRGA 4JN2B 4MAUL 1XGUB 2NQCA 5D6DC 5T1LD 4ELMB 3BP7B 1FNSH 2NW2A 5HDLA 5GS1C 4LLYB 2HAZA 4Y5XB 5GGRY 3PWJA 1FFQA 3QR2A 4NFDA 3S36X 2B2XL 3QCTH 4Q9RH 2DQTH 3LMJL 4PJXA 1T1XB 4MA8L 1G0YR 4W4OA 4BJLA 4EBQL 4GRWF 1YMMB 5KW9H 4X7EC 3QJHA 5CILH 1QQDA 1NDGB 3L95A 3BI9X 1AFVH 4XCCH 3JVGC 4U1HB 1N2RA 2BY1A 5I1CL 4KKBD 5KZCD 2APFA 4JM2F 4GG6A 5D96B 4MS8A 4N5EC 3IJYA 4DTGL 2A1WL 3ZDZE 1OGAD 2FDBP 3C6LB 3S35L 1BWWA 3OKMB 5TF1L 3RUGB 5F3BA 1C16B 3LEVH 4KQ4L 3MV9E 4ZS6D 1D6VL 4GW1B 1IEAB 4URTB 3TN0C 1JPFB 1OF2B 1SY6H 4UINL 2ARJB 4E41E 3RWCA 1QBLH 2NXYC 4ZNCD 4LSDA 4O2EA 1BQSA 1MHPH 4LCIH 1U9KA 1OTUD 4ELKA 2NY6D 1IAIL 4NZRL 2VDPH 1FN4A 2D7QA 5D7LA 1K4CA 4LRNL 4MNQB 4YHMH 5A2LH 4OF3A 4QRTA 5D93B 2GSIB 3X11B 4X4XB 5DQDL 5GGTH 4X5XA 1VFAB 5CWSB 5I1HH 1P4IL 4O02L 4HUUA 1MRDL 1P7KA 4HS3B 1RMFH 5I9QC 4PJDE 4KI5D 5F1SA 4OLUL 1JBJA 2RFXB 4M7LH 3RFZC 5ENWA 4BK4A 1KSRA 4NO5A 4JDVA 3F12A 2VXUL 1M05A 2CIKA 1W0VB 2ICEB 3A6BL 3QG6B 1CG9B 5DK3A 2FR4A 3RY5A 5C1MB 4LIQL 1ZHNA 2P5EB 1G1YA 4MNGA 2D7PA 3OXRA 4PG2C 2GJ6D 2PO6D 5KOVC 2QSQA 5GS0C 2VR5A 4CVUA 4LPVA 4BFIB 2Q76B 1KPRB 5GRXG 2VDKH 2LTQB 4PRIB 1V05A 1OVZA 3HE6C 4NDMA 2FSEA 5TE7H 5T3XH 2W9EH 3RWEA 3ULVL 4S2SA 3UTTA 2F53E 3DGGB 4GKZB 5J9PA 3CFDB 2VC2H 4XCYA 3UTSA 5C0EB 4OI8A 4LOUD 1EUTA 3FHQA 3QZWB 3ROOA 1T83C 4F7CB 1BEYL 2BNRB 4QKXB 5ID1A 5TJWK 2IEPA 1CDJA 3ILPB 3LKOB 1EO7A 3GSWA 4BZ1H 4HK0A 4NQEA 3EYQC 3MYJA 4C56B 2BVOA 5J1AA 3MRKA 3FAXA 5I8OL 4RSVA 4TPRL 5AZ2L 5FYJL 1IAKB 1KCSH 2VR9A 4JFPA 2B7DT 3AM8C 3DVGA 1ZKAA 3VDAA 4RGNB 4WTWA 3VGGA 5B8CA 4OI9A 2BSSB 4ZMAT 1FHGA 3BEVA 5DEFA 1QFWL 3FTGA 4LNRB 4NQED 2FGZA 4ODUA 1A6WH 1U3JA 1J0JA 2HWZH 5DA0B 5FOBB 3U9PH 1X5YA 1ZEAL 2GIYA 4JFDD 4WUUA 5EU5A 4F3FB 1MLCA 1FYTA 1A4KB 3V6FB 3UPRB 3B5HA 1QEWB 4LVEA 1PLGH 2D0FA 4PJDF 5FO7B 4XB8A 3FB8A 3H42L 3VFGL 3W9DA 1E6JH 1PY9A 1T7WA 3V6ZA 4M48L 3U4BH 1NSNL 4HJJL 5T33L 1J05B 1OW0A 1PKQE 2AK4D 3D85D 2WWKO 4FQLL 4N8VA 1I7RA 4WUUD 4ORGA 3ARQA 5ILTH 6FABL 5C08B 2F54A 3GO1L 4K2UH 1IGJA 2XACC 3LRSA 4PJ7A 4NRXB 3NBNA 5FUCC 2LVCA 2YBRA 3HRZA 1NMAH 1QLEL 1KLGB 1SM3H 1VPOL 3KYMB 4XMLH 5E2TH 1CGVA 1G6RB 4J3VA 4JY4A 1RZFH 3QIBA 1YY8B 4EN3A 4F8TA 2N7BA 1MNUL 1O0VA 1KNOB 2NLJA 1IL1A 1JL8A 5B22A 1DANU 3U9UA 1BJ8A 5CZXD 1NGQH 4IS6B 3T0AA 3WLWD 2VR4A 3SE4A 3WYRA 3TA3C 4GG8B 2YC1A 1DLFL 1P5UA 1G6VK 1QUNA 1NMCC 4N0RA 5D2NB 5D7SL 3L5WA 3DX9A 5SWZA 5HGAA 1MCDA 5CIPA 3D3VB 1HI6B 1MJ8H 3S3JA 2EDFA 3RGHA 2APTA 3F7PC 1UYWL 1TCMA 1YY9D 1TJIH 4MCYA 3WO4B 1YQ2A 4K7FB 1JZ8A 3O6KH 2PCPB 4OT1H 2CO6B 1AXSB 5GRZA 4XCNA 1MIEL 5J11C 3UDWC 3TBSA 3T3MF 1LK3H 3VI3F 3T0EC 1WSST 3WIFB 5L9DL 1JHKH 3IAQA 4QXUL 4HIEB 1HZHH 3DURB 1A6TB 2X5PA 3VXSE 3G5VB 4U1SA 3BGFC 2WQ8A 1HNFA 4LNVA 3SJVB 5D7JC 2GW5A 3DGCR 5LWYL 4HV8B 4GKOA 3AMLA 4PJEB 4ZOBA 4KK8C 5EUKA 5C09E 4NRYB 3TH3T 3OMZA 4HJ0C 4LKCB 4U0RC 2G5BB 3FQXB 1CLZL 1MI5E 4YEEA 4OCYL 1QVOA 1ZT4A 2NMSA 3JSSA 3IB4A 1AXIB 5DJDB 4OIIH 5TE4H 3GSOA 1KPVA 2DQGH 3VRLF 3MRRB 3MRQB 1FZMA 3GI9H 4Y5VC 3CH1A 4NKOA 4M8QB 4WHDA 3CDFA 3BEWB 5CEZH 1U3ZA 3QQ4A 1KFAL 3CDGB 3BP5A 3QEQD 1D5MA 3B9KD 3CLEL 4C58B 1JWUB 3B2VL 5DHVB 1OB1B 5IMOA 2ZP0T 2WLYA 1VFBA 2GTWA 4U3CA 4G80B 4PY7A 1BECA 4XGZA 3WFZA 2ICWJ 3I50H 5C0GA 4QRPD 1BD2E 4XPTH 4D0BB 5D9SB 4QHKJ 1EXUA 3RL1A 3EOTH 4R4BB 1CGSL 1OP5K 1VESA 2NR6C 4HT1L 3BQUB 3BKCL 1DUZB 2R8SL 2YHGA 3MRPB 5BCAA 2PYEB 4JPKH 4OLWL 4PJFB 5F1KC 4ZYKA 5AYUL 2HT3C 4G6ML 3MNWB 4IDJH 5BV7L 4W70A 1RPQA 1I8LA 2EDLA 1A3QA 2VDOH 3G9VA 5DUPH 4BH8B 3IAGC 2OCFD 2W9DL 3VFSA 4KTYA 1IM9D 1CDCA 1RHHB 1YMHB 5I30H 3OGCA 4X99A 3SE9L 4Z95L 2VLJE 3MLUH 3HKFA 2H45A 1DEDA 3KPPB 3CVHA 3EYSL 4EIZC 3G5ZA 5KSAC 4JKLA 4MA1B 1FJ1A 1BF8A 4PP1C 5DJCA 4IOSD 1RUQH 3CAFA 3CLFL 2B0SL 4ALAH 4P2RB 1DQJA 2Z8WC 2QSCL 2VXSH 5B38G 5I1AB 5J0BA 4N9OB 3VRJA 2BRQA 4OF6A 3ALPA 1MY5A 3O3BB 1NCNA 3ZYJA 5ITFA 4LDEB 4ZFFA 3BGMB 3MLXH 1H8OA 2IFFL 5D1QD 3ZTNL 1MLBB 3Q5TA 1M7IA 4PFEA 3TWCL 3RHWF 4QCIB 1U93A 1FZOB 4YFLF 1AIFA 3MLRH 4GAFB 2WIIB 4PJBB 4DAGL 1T1ZB 2ATKB 1RZGB 1Z3GL 1JGDB 5GS2H 1GGYA 3NABL 2JELL 1LQVA 4Q6YA 1GIGH 2B5IB 3T2PA 2J5LC 1UH2A 5D70L 3UROR 5EDXA 1UXSA 4GMTH 1I3RA 3G6JB 1D6EB 1G7PB 1HSAA 2HG5A 4MJ6B 5CGYD 1F45A 5SX5K 4A6YH 1YEGL 4XWOC 3REVB 4Q9CA 2C1OB 5MERB 3OKLB 4HWUA 1CF8L 2FB4L 3AXLB 1IC5L 2DIJA 1R3IH 2XG5A 4S0SD 2A0LD 1ONQA 2UY6A 4U1MA 3CPLA 4ZSOE 4HUKB 4FRWA 4BK5A 1U36A 2NTSP 4FMKA 4L1HA 1CXHA 4O2FA 1QRNB 3OAYK 1W8NA 3D39A 4RNRB 1KCUL 3U6RA 4CADA 2YA0A 4OQTA 5F7NC 35C8L 2DQDL 4LCCC 2C4FT 1NGPH 4QOKE 5FYKL 3GMOB 2QHLA 5IW1B 5JUEH 5I73C 2YS4A 4YZFF 1A1MB 3LD8C 2I9LA 5FFLA 5DVMA 3VCLA 4FQXA 4P2QE 2ZKHH 4G7YH 4J8RB 1IT9H 4PV8A 4X80L 1ZANH 4U6TA 4XVTL 4TQEH 4LGRB 1AHWC 2I5YH 1MCOL 1I8IB 2VQUA 2ZWLT 2IAMC 1J8HA 4OZHE 4JM4L 4TVPE 2QQLH 2F74B 3OBAA 3AVEA 4X6DE 1UJ3C 1QBML 3HPLA 2XWJA 4F9LA 1S9VA 1TTGA 2WUCH 3QDJD 5JW3H 1U8NA 2QADD 4TOYH 3IDGB 2Y36L 4QTIL 1S3KL 4QF1B 2JJUA 4MJ5B 1AO7B 5FCUH 1A6UH 4L9LA 3TT3H 2A83A 1J8HD 2CSPA 2EXWD 2P48B 4ETQB 2XNAB 5J89A 3OAUL 5E8PB 1GOHA 3IDYC 1Q9LB 2VL5A 3CFKB 3RJQB 3QH3B 1KJMB 3UJJL 4NGHH 1DDHA 5JHDA 2WMPA 2X89A 1X7QB 5C92A 4ZAKD 1S9YA 5I8EA 5IHBA 3VG9B 3SKOA 4GKSA 4PJCE 5DJ0B 1N6QL 4UTBL 3GKWH 1CGXA 1KB9K 5JPMB 1X4ZA 3G5YA 4D9RD 1DQLL 1C7SA 2WLZA 4KRPB 1I1FA 2R0WH 4A6YB 1DSFL 1AD0A 4MZ2A 4KC3B 3SDYH 1H3TA 3H9SA 1RK0A 4FG6C 2CJUL 3PQYB 5CHNA 5IVNA 3RGVD 4JY6B 4AT6B 4FQCL 5I18L 3QNZA 1MAJA 3CSBA 2F9BT 3IFLL 4Y4FA 2MCG1 3C87A 1WJ3A 5KS9A 3QXVA 4B53A 2I07B 4QHMA 4OLYL 5LCVH 1ZVYA 1RZKC 3Q6GL 1KUMA 5DC9B 4ERSH 1OAQH 4GRLC 1MUJA 1JGVH 1F58L 5EBWB 3WFEH 1QYGL 3SDXE 1I1CA 3CFBA 4LSUL 4RIRB 5E8NA 5JZ7C 1UH3A 2VN4A 5DS8B 4POZC 5I0ZA 2VABA 4LP5A 3ULUE 4CN1A 4KMLB 3L5HA 1IKNA 4X6DF 1BVKA 1GZPB 4N0CD 3RQ3A 1BGXH 2NY1C 5BW7C 5EBLB 32C2A 1C1EH 3BPLC 4Z76B 1HH9B 4PRHD 4UQ2A 12E8H 3JV4B 3UJIH 2JCCE 5IT2H 2LU7A 1Q8MA 1DZBA 3MXWH 2R29L 3CIQA 2ICWA 1EHNA 4P5KA 4Z7VE 5LAXB 3ZTJH 1ZLWH 2IBZX 3CC5A 5D7IA 3P9MB 1CDIA 4FTVA 1BFVH 4YLQT 4QWWD 5EUOB 4OZIA 3FN0H 4M62H 1CDBA 3DO3A 3TFKC 4JHWL 1O5DT 5ITBL 3BRFA 5IB5B 4CU6A 4G6KL 2N1KA 1Y6MR 4Y16B 2UV3A 3QI9A 2PXYB 3V52H 3FB5B 4HPOL 4XVSL 3H0TA 5GIRB 5JXEA 2RIKA 3NCYP 3TVMD 5BVPL 3KHOA 3PP4L 5DK2A 1TNNA 4OLVH 1I4FA 4WI2A 1V3KA 3TBTB 4I77H 5IESH 3WN5B 5ALCL 4XAWL 5IM7B 3CVHL 3OPZL 3UC0L 4FQPA 3ZZ1A 1SJEA 3DBXB 2FX7H 2AABL 4G7VH 3LY6A 3I2CL 1OGAE 4IOFD 1JI1A 1JGUL 2OJEA 5DJ2B 5DJ8B 4CGTA 5HYJA 5GHWL 4M4PA 4Y4KB 4LVHB 5J06A 1UFUA 1X5AA 1ZTXH 3L3OB 3PE9A 5E6IA 3ZKND 4JDZB 2HJFA 3RWHA 2OI9A 3P0YL 2X4NA 3AC0A 4OGXH 3TJHD 1JF1B 3SDXF 3NH7H 3QQNA 5F7KC 2MWCA 2F5BL 3AY4A 3J7HA 1FBIL 5T3ZD 5FM5M 3WUWG 3KVQA 1BVZA 3WFBH 4K3EL 1U2HA 3FCTA 5I1EL 4XP9L 5CJBA 5EZJB 5KANG 4XC1H 1AGFA 3MZGB 3O6FD 4H0HB 4LVOB 3HI1A 2Z4QB 1P5VA 4MVBC 4APQC 4HS8L 1LO3H 3HAEA 2UUDK 3KYOB 1DE4A 4HWZA 1UEYA 2BVYA 3T2NL 2M8XA 4GSDL 4J1UA 1LO5B 1TQCC 3PP3H 5CBEA 1HEZB 2Z91A 3ARBA 3R1GL 4EVNA 4PYHA 5MENE 3BHBB 4Z7VF 4XMPH 4YHIA 2DRUA 2FBJH 1R0AH 2GJ6E 2PR4H 1KXTB 2I27N 5C0CB 5KVEL 2EO1A 3P11H 4YHOH 3X13A 1UM4L 3FB7B 3QFJA 1ED3B 1OARH 5J6HA 1DBKL 1H3PL 4M5YH 3STLA 1CE6B 2FYYA 1HE7A 3T77A 2VWEE 4PD4J 1TMCA 3PHOA 4CW1A 4POUB 2VDNL 5M7QA 4M1DL 3UYRL 1K4DA 4TSBL 2O5XH 4HBCH 4ZQKB 5IB2A 4IRSD 1F3DH 2AXJA 4K7PH 4MDIA 5FO9B 4OQTL 3FFDA 4NNPH 4JN2A 1BAFH 1XGUA 3ZE1F 1Z5LB 4HLZH 4KHXH 3BP7A 1H15B 4ELMA 3S8WA 4XX1E 4QRRB 2OMNA 4JO1L 3ZSSA 1TTFA 4PGCB 3BE1L 5HHPB 5GJSL 4J4PC 5KAQF 3B3IA 1S5IL 1DBBL 3KJ4C 4HH8A 2IPKB 4RX4A 5DI8A 4LPWA 3W0WD 2ZPKL 1T1XA 2HN7A 3GFUA 2DJSA 2DL9A 2YPKB 4NFBA 5C0NC 3ZO0A 5FCSH 4JRXB 1I9IL 1UH4A 3LB6C 3RKPA 1YMMA 4OGAD 5I17B 4FOMA 1X3DA 2BRRH 3RBSA 3RWIA 1NDGA 2P8LA 5ADPL 4U1HA 3C5ZD 4HBQA 1PKOA 4L8CB 3IDIB 2GKIA 4X9BA 1N3NB 4LGSB 3OB0K 4JFDE 4TUKL 3NACH 5IW3A 3HZKB 4OCSH 3C6LA 1CI5A 2H6PB 2ZUWA 3OKMA 3RUGA 1C16A 1Z0MA 2V2TA 2E6QA 2I60H 4GW1A 1IEAA 2C1PB 4N8CL 2LV4A 4R4NC 2Z0BA 2ARJA 5F97E 1A7NL 3B5GA 1QZ1A 4Z7WF 5JW5B 1S7TB 1L0XA 4R26H 2AK4E 4XP5L 1YPZF 3U4EB 3ZLQC 4H8WL 4WO4D 3JV6B 4M7KH 2AJUL 4PGDB 4RFOL 5FV2A 4MNQA 3SGDH 1RZ7H 1SJXA 4M9PA 2GSIA 1UWGH 3ARGC 3X11A 4NBYB 4X4XA 2EDXA 3UTQA 4B7IA 1VFAA 5IQ7L 5CWSA 4OFIA 4I0CC 1WWAX 4HS3A 4PJAA 5C0AD 1WLHA 4OD3L 5TE6H 1F4YH 1WCBB 1BM3H 4PJ5A 4Q9QL 2RFXA 4Y8DC 3G6AB 1KJVB 3JTTB 2ESVD 1NGZB 3OR6B 1L6XA 3RNKB 2ZG1A 1W0VA 2ICEA 5CINH 1RULH 3O4LD 2P5EA 3QNXB 3P30L 4QRUB 3LDBC 4TN9A 5IBLC 4P4KC 4EJ1C 1X5ZA 2FX9H 4Z7WB 1T22B 1UCBL 3OX8B 4BFIA 2Q76A 1KPRA 4NWUL 4PJ5D 1JGLH 3QWQB 4PRIA 3WFDL 1D9KB 1DEEB 3NAAL 3B9EA 5DRZA 2VDRH 3ETBF 5A2IH 4XP6L 3GSNL 2FX8L 2PF6A 1ORSB 4S1RH 4HWBA 5F9OL 3DGGA 4GKZA 1JZ5A 1CLYL 1MWAH 3CFDA 4D3CH 2KPNA 5C0EA 1D5IL 5GGQH 4F9PA 1NC2B 3QZWA 3ET9F 1IVLA 4UIKH 2EICA 4F7CA 3MFFB 2BNRA 5J8OA 1A6PA 1LEIB 3LKOA 3V8OA 1MFEH 4I8DA 3ZE2E 4EIGB 4HC1H 4HULB 4C56A 1E4WL 1UACH 5CJ8A 2ZSWB 3STBA 1WITA 4HXBL 3ARFC 3UPCA 4TNWF 4XPBH 4F8QA 1IAKA 1NFDB 3H9HB 1TXKA 3MRCA 3W11D 2BSSA 5HY9B 3CVIH 5E95B 3MRFA 3HMWL 1JPSH 4LNRA 2DMCA 3DV4B 1WBZB 3BD4A 2ERJB 2XPGB 1T1YA 4PY8J 3D0LB 4AH2A 5IKCB 2P43B 1SY6A 4GKNB 2DLGA 5FOBA 3EO1B 1EERB 4JCMA 1NEUA 3PL6C 4G8GD 3UPRA 4F3FA 3EO0B 1EJOH 2ADJB 3QEQE 3RVWC 1IAIM 1FGVL 4G3YH 5JMRA 4N0YH 4M5ZL 4FFYH 1WZKA 1OCWL 4DVRL 1TVHB 4TVSa 4X7SL 5FYJU 5CGMA 4QRPE 1J86A 2DQCL 4P23D 1CD1B 3BN9C 1J05A 3WNLA 1UQSB 2AEPH 1JNLH 3VU2A 3IF1B 5HHOA 3DYOA 5DJ6B 4GT7A 1ZS8B 2VLKE 3P0GB 2VQ1B 1U2CA 1NUNB 3KPSD 3MUY1 5C08A 5TF0A 5D1XC 1WEJH 1DQQB 15C8H 3VXRB 4S11A 2Z31C 3F7VA 1WZ1H 4NRXA 2Z35B 4GXVH 3CK0H 1BP3B 4YDIH 1NAKL 2AK1H 3O8XC 1FVCB 4FQ1L 1T2QL 5C0IB 2BFVH 2RB8A 2XA3A 3KYMA 1DBAL 1KLGA 3T1FB 1G6RA 1NUFA 3O41B 5HGBB 5HHOD 1YY8A 1TJGL 3TH2T 3EDJA 1F42A 1KNOA 4Y5YC 1Q0YH 1MCLA 3LQAL 1I1AB 1YEIL 4IS6A 1AGCB 4DKEL 1A14H 1DBJL 2F5AH 4Y19B 2OMBA 4OJFH 5K59E 4MQSB 3DRTB 1IC7L 5D2NA 3DVNA 1V3MA 1MWAB 3BZEB 4KK9D 4Q97A 5IF0A 4TRPL 1MCIA 3TJEL 3D3VA 3TF7A 1SYVB 1HI6A 1RIVH 4JVUA 5C9JA 3B2UD 1FZJA 2J6EA 4UT7H 5JQ6L 5LBSL 2CXKA 4K7FA 2B1AL 1FGNH 1S7XB 1BREA 3LEYH 2PCPA 2MJWA 3C8KB 4JG0L 3IDMB 5KVFL 1AXSA 1TZIB 1G7JB 4LEOB 4Z7UB 4KK5D 5CD3B 1AH1A 1A9BB 3PGDB 4RQQB 5CP3A 3VFPB 4C83B 3PWVA 4WTXA 2EXYD 3O6LH 4LLUA 1GHFH 3QUML 1UJTA 3WIFA 4A2MA 2Y7QB 3HN3A 4HIEA 3DURA 1A6TA 5E94B 4Y2DB 4CUCA 3CFCH 3GSXA 2QLVB 3D25A 5KTEL 1NBVH 2DQJH 4C4KO 3O9WC 4RRPG 3SJVA 1IBGL 5JR1H 2Y07L 1QFWM 2EIEA 2PTUA 4HV8A 5HDQH 2KH2B 4WV1C 4PJEA 4KUCD 1SHMA 4NRYA 2BMKB 4EI5B 1P69B 1T6VN 4LKCA 1HHHB 2G5BA 3WO3B 4YGVB 1F4WH 4PLJC 3FQXA 1ZGLB 4R4FL 1C5BH 4L3ED 1R5WA 3TZVC 1FO0B 1MCCA 3N1FC 4JHAL 1HHIB 3LSOB 2NXZC 4O58L 3MRQA 3JWOC 3KNBB 1VADB 2V7HB 4AK1A 4WCYL 4M8QA 1CICD 2Y4SA 4HIXL 4PJ9C 4QXGL 1KCVL 2VMFA 3CDGA 1BJMA 1OTTD 1NPUA 4YXHL 1JWUA 3IDXH 5DHVA 1OB1A 1DBML 1RZIB 4JKKA 5FUZH 3V4PL 1WAAE 1ZK9A 5CZVH 4TULL 5INDB 2QQKH 4RAHA 3QCUH 4G80A 2VUYA 3EFFA 5FA4B 3EIFA 2R1XA 5DMYA 2P24B 5IGXL 4D0BA 5BO1H 1VGKB 4WGVB 5D9SA 1T89C 25C8L 4R4BA 1F8TL 3DSFL 5D72L 1QFUL 3NZ8B 3BQUA 1JFQH 1EUUA 3QUYD 1YYLL 4BFEA 1MJ7L 2XWTB 3MV8B 1FFOA 3MUJA 1DUZA 3EJZD 1DQTA 3MRPA 3DO7B 4M7JL 2EH7H 4PJFA 2VXTH 4LSVL 2YKLL 2DQIL 4GQ9H 1F11B 5I8KH 4Y1AD 4BH8A 4ODVH 3QYCA 3QUZB 1RHHA 1YMHA 2NY3D 4UT9L 1Y18B 5IW6B 3MR9B 3QDJE 3KPPA 1U6AL 3Q6FB 3GBMH 4LDLB 1JZ3A 3WSQL 3DARA 2ZOKB 4RMUA 2FGWL 3BPCB 1VEOA 1K3IA 1Q72L 2IC2A 3WNPA 5JW4M 5MEQB 5F3HB 2GITB 5HDBF 2EDOA 3WXWH 3QIWC 1YC8A 4JQVA 5E2VL 3NFSH 2GT9B 2CMRL 4P2RA 1EJ6A 3U4AA 3KPTA 3VXTB 1BLNB 3HC0B 2C3VB 4NPYB 4H1LH 2NYYD 2R2HB 3O3BA 3NOIA 3O2VL 4Q9BA 3BGMA 1KV3A 1KB5H 1MLBA 4DW2H 3ARED 5HHMD 2IGFH 1SBBA 4LSQL 4DFHA 3TCLB 4P48A 4QCIA 3UTZB 3EYFA 5KSAB 2Q8BH 1FZOA 3GK8H 3NCFB 4QYOB 1A6VH 1MCHA 4XNYH 2WIIA 4PJBA 1PSKH 1FNSL 1T1ZA 2ATKA 3CFEB 1RZGA 5HGHB 1WAAF 2QSVA 3CX2A 4NYLB 3AB0C 3FO1B 4XZUB 4D9RE 3J8F7 3BWAB 2VITB 5DD6A 2DYPB 5J4MA 4HK3N 3QCTL 2PUQT 5ERWB 3DI2B 1RZJH 2M26A 1JNNL 1JPTL 1D6EA 1G7PA 1CD8A 4I5BB 5D71H 4G9DA 5KW9L 1YJDH 4MJ6A 5CILL 1FSKC 1HDMA 1P6AB 1Y0LB 4XCCL 1AFVL 1MRCH 4JDTL 3MV9B 4WU7B 3S4SB 2C1OA 4PUBH 4DGYH 5MERA 3OKLA 4OTXH 4E41B 4YDJB 2CPCA 3O6ML 4IIQB 2YD1A 3LEVL 3NIGE 1OPGH 2LABA 3MLVH 1QRNA 2YD4A 3BZ4B 4P3DB 2VUOA 1SY6L 1YNLL 1QBLL 3X14B 4DGIH 1IQDB 3O3EB 4RNRA 2R2EB 5D1ZD 4LCIL 3DI3B 4OZFH 2VDPL 3ROLB 1INEH 1BQLH 4KRLB 3GMOA 3SGKA 4YHML 4TUJB 5DD1H 1ADQH 4PRHE 1A1MA 1FYHB 5AEAA 2CQVA 1NDMB 3HLAB 4JO3H 5GGTL 5IMLB 1EHLH 1U95B 5CZKA 5IROA 2B4CC 2JIXB 1YUHA 3RVUC 2Y25A 3GJFK 1I8IA 4M7LL 1N5YH 1LO2H 4LHUB 4BZ2H 2F74A 5A3IC 2EYRA 2NY4B 5HJ3B 5DO2D 5MI0B 4NHUE 2A2QT 4WEMB 5BS0D 4G8FB 4LCCB 4PP2B 1CE1H 5EO9B 2QJDA 3UZQA 4MJ5A 5I73B 4A2LA 1AO7A 1G6RL 1Z9LA 4NRZB 3CDYA 1ZLVK 2R1WB 3IJHB 1T03H 5FYKU 2VDKL 4YC2B 1KB5B 4MAYC 3T4AB 4ETQA 2XNAA 5ICZB 2XWBB 3QT2A 5T3XL 4PTTB 4LSRL 5TE7L 1LEKB 1MCWW 1AHWB 5E8PA 3VXPB 3ZKMC 1KXVC 1Q9LA 4HEPG 2VXQH 2NY2D 1II4E 4KJWD 1JPGB 5HGDA 5ACMA 4KUZH 3U7WH 4NKMA 2VC2L 3CFKA 5L2JB 3QH3A 2R2BB 4AEEA 3M45A 5IQ9B 2AXFB 3RTQB 1FLRL 3TPUE 3C60D 1X7QA 4L4TE 1G7HA 3BP4B 4QXTB 4RMTA 5DJ0A 4BZ1L 2NX5E 1JI2A 3SDDB 3BD3A 1UGNA 3KPNA 5T1KB 1M1SA 4OZGF 2OP4H 5T3ZE 2XN9D 3EKCA 2WW8A 3MRDA 3VFRB 5JPMA 5DWUH 5F9WC 3WV0A 2O5YH 1KCSL 4EDXB 5IVXE 4A6YA 4UILH 4DKFH 5C2UB 4WFEE 4BZYA 4I3RH 3UBXG 4L3CB 3PQYA 2X2YA 3RPIB 3S96B 4JY6A 3QO1B 4AT6A 5KVGH 3CFJB 2A6KB 4HKXB 1OSPH 3ALWA 2I07A 4XBPA 5C6TH 3UPAA 3VA6A 1CBVH 4PJIA 5DVKA 2C4FU 2HWZL 1K6QL 2OS7A 1KPUA 3U9PL 5EBWA 3ZHLA 2BVUA 2VSCA 4OZFB 4RIRA 1EDQA 4HUVA 1PLGL 5DS8A 3L5IA 1S7QA 2FZ3A 3OJDB 2AXGA 5E99H 2H41A 4RRPA 1WV7T 2DBJA 4GS7C 4N0UB 1E6JL 3O3AB 2IALA 3HE7D 5SX5H 2C3GA 1CWVA 1GZPA 2NY5H 3L3HB 2IG2H 2JE8A 4K23H 2BVPB 5EBLA 4EEEA 4ONHA 1P2CB 4LCYB 4PLKC 2XRAH 3AS3A 3MRIB 1HXYB 4JFOA 4Z76A 1HH9A 5C07D 3JV4A 3U1SL 2UWEE 5A2KH 2CDFB 3DWTA 4P46C 4D9QD 5CJOH 5LAXA 4LF3B 4NKQB 1NMAL 2AGJH 1ES0B 3SDCD 1SM3L 2AJZB 3P9MA 4XMLL 5EUOA 2P8MB 3IS1X 1Z6JT 1TPXC 2MQ3A 1N0XH 5IB5A 3PJSA 3W0WE 4GAYB 4Y16A 3L5XH 1NGQL 1QA9B 5HXMA 1CDYA 3FB5A 3BKYH 4MA7L 1W8OA 5GIRA 3T8XA 3QQ3B 1QLFB 4X9GA 4JJHA 5EFIB 2HMIC 1RJZB 4L4VE 4LBEB 3T04D 1NCTA 1CXLA 4YWGH 3TBTA 2AI0H 2P44B 5IVXF 3RAJL 3WN5A 1MJ8L 4JO2H 5IM7A 4KRNA 4K3GA 4Z5RB 1FE8H 1TJIL 3FO9A 3MPCA 1N8ZB 3O6KL 3LS4H 3UO1H 5I1CH 3QDAA 4G9FE 5DJ2A 5DJ8A 2QEJA 3E2HB 5ANME 3E6FB 4PJ8B 3L3OA 3S35H 2A0LC 4JDZA 1LK3L 5HHVL 3RKDD 3VGAB 2BP3A 1JHKL 1XIWB 2APBA 5C09B 1HZHL 4YHKH 5E6ZA 3GUTB 2R1YB 1JF1A 2WQRA 5F7DB 5JA8B 3I3DA 3BPOC 5DK0B 2AJYH 4JKPH 3RDTB 1R3LB 1MI5B 3O2DH 4X6EB 4HKJB 1EZVX 4OD1H 3MCLH 4BELD 2VXVH 2OR9H 5EZJA 2XZCH 5D5ME 4LIQE 5C0AE 2Z4QA 3IFOB 1EVTC 1NJ9B 3D2UD 5IB4A 3KYOA 1M71B 2ESVE 4OIIL 3PIQB 4OFYA 4P2OC 4WW2B 5TE4L 3FFCE 1LO5A 3S36H 4H88H 2DQGL 1BF2A 3KR3H 1HEZA 2Y9RT 3NPZB 2HLAA 3GI9L 4ZUVB 2P5WA 3NIDF 2IMNA 1GPOL 3CD4A 3BHBA 4I2XE 1S78D 3BJLA 3ULVE 4MSWB 2QADC 5C0CA 3A6BH 1J0YA 2P49B 4F58H 3QAZB 1CGTA 1UB6B 3ARDB 1ED3A 2J8UA 1FFPB 3I50L 1NLDH 4XPTL 1CE6A 2P5WD 3EOTL 5DMKB 4APQB 4ZFZB 4MD4B 3IVKB 5E8EB 2XTJB 5FYJE 4QTHA 3IU3B 5ACLA 4ZQKA 4JPKL 4M02A 2VLRA 4IDJL 2R4RH 3W5MA 1RZJC 4RMVA 4ZXBC 3SGDI 2VDOL 1H15A 4QRRA 1YJDC 4GMSH 1QSFE 2W0FB 4OSUH 5HHPA 5I30L 1IE5A 5ABDE 4U6VL 4L8SC 3C5JB 2IPKA 3MLUL 4XAKE 3DVFA 5AZ2H 4JGMA 1TFHA 2YPKA 4P5TA 4I0PC 2VOTA 2ADFH 2VLRD 3VWKC 4W6XB 3DETD 1IGIH 2XXMB 4YBQD 5I17A 4IRJD 4KKLD 1RUQL 4JFYB 5DTFB 1D7FA 2BSTA 3WNNA 5JTWA 4X4MA 4ALAL 5E5MB 4L8CA 3IDIA 4GBXB 3CMGA 1A6AB 3MV7B 2C3HA 1QOKA 2IJ0C 2N4IA 3HZKA 2EDQA 3ZMRA 1HQ4B 4P5TD 2H6PA 3MUGB 5GS1A 1BWMA 3L3DB 1FH5L 4GUPB 3K8LA 1ZEAH 4LHJB 4JFQB 3MLXL 4O4YH 3TO4C 3QDGD 2V17H 1FNLA 3DX6B 3CXDH 3SDAC 2QHRH 3MBEB 4LMQE 5JW5A 1S7TA 5FUOH 4U1GB 3U4EA 4J3TA 3MLRL 3ULVF 4N0CC 2XYCA 1NSNH 3JV6A 4PGDA 3OV6A 2GSGB 1RJYB 3JVGA 3JWNC 3KPSE 1GIGL 3WS6C 1CIDA 3RZCC 1UT9A 1UB5B 4GMTL 4OF0A 2HTLC 1KELH 1AY1H 2JJTA 3VXMB 3SKNB 1WCBA 3EO9H 3Q2CA 3KPRD 3K74B 1TZGH 4AQOA 3G6AA 3LS5H 1KIPB 3IFPB 3JTTA 2H2PC 4A6YL 3I9GH 3OR6A 2LU3A 1HOCB 4ZSOB 3DLQR 2FO1A 4AIZB 2R39A 1JMXA 4PRPA 3SKJL 2DI8A 1W72B 3QNXA 5DMJB 4N5ED 4QRUA 1ETZB 3VJ6B 2BC4B 4NNYA 2FL5B 1R3IL 3HRPA 2GCYB 1T22A 3OX8A 4QOKB 5EU4B 3ARGB 1VEPA 1D9KA 3TN0D 4MJID 1DVFC 2OZ4A 3M17B 5D7SH 2NXYD 3WJLC 1W0YT 3GMQB 3TP4A 4PRPD 3T65B 4KTDL 1T7YA 4YE4L 5IJKA 5JOPE 1NGPL 1ORSA 4LARH 5JUEL 1UYWH 2YD7A 4M8VA 1NC2A 1AC6A 1WVZA 5E9DD 1HKFA 1F97A 1CFSB 2X4UB 1DLHB 3S3PA 3MFFA 2ZKHL 4G7YL 4OZHB 5IB1B 1LEIA 2YZ1A 1ZANL 1BQHG 3LDBB 1G9NH 4PG2A 3K8KA 2I5YL 2QQQA 2CK2A 3HFMH 2ZSWA 2G9HB 1SYSA 2YD3A 5L88H 1P4LA 2QQLL 4BQ9A 1NFDA 3H9HA 5F7YC 3RX7A 4BFGA 3ESUF 2WUCL 4K7PY 4PJXE 1XGTB 5JW3L 1QSVA 4TOYL 4O2CB 3VFTB 4PRDB 4HIHB 5HY9A 2DOCA 3ZYOA 4L3EE 4GFTB 3Q0HA 5FCUL 3DV4A 5GS0D 3EHBD 1BZ7B 1KJ2A 4ZO6A 3VD9A 4PLNC 2XPGA 4HXAH 3D0LA 2EDDA 5IKCA 3HE6D 4GKNA 5GGVY 1QKZH 2NY5C 1T0NB 3EO0A 2P8PA 2ADJA 4OM0H 3C5SB 1CD0A 5ESQB 4PJCB 1P7QB 5D6CB 3MRHA 2W0LA 1HHKA 1JVKA 4KWUA 5J12B 4PJHF 4NGHL 1TVHA 3B2VH 3AM8A 5GGUA 4V3DB 1CD1A 3LZFH 3FQTB 5FO8A 3QXTA 4MCZB 5GJTH 1UQSA 1F00I 3AROA 1MELA 3IF1A 2OJZL 3FT3B 5DJ6A 1ZS8A 1H5BB 2VQ1A 1SEBB 3BRGC 4YPJA 5DR5H 5EBGA 1GVIA 3ZL4H 1F4HA 1R5IB 4HT1H 4J3OC 2MQCA 1DQQA 3QEUB 3BKCH 2A73B 2PW2B 4IM8A 4P2YA 3SEPA 2ZUQC 1FVCA 4LLAA 4JRWA 2WUBL 4Y1AE 5AYUH 4F33B 3T0BA 4G6MH 1PBYA 4M1GL 5DJAB 5BV7H 3O41A 5HGBA 2YR3A 4HWNA 5EG6C 1PEZA 4PPTA 1OQXA 5JDSA 5LCVL 2MNUA 4ERSL 1OAQL 1JGVL 1I1AA 3BP6B 5I1LA 3SE9H 3WFEL 1AGCA 2B1HH 1WFUA 3QXDB 4Y19A 2DM4A 3RIFF 3DRTA 5E1AB 3SCMB 1RY7B 1MWAA 1I85C 3BZEA 5ADOL 1SYVA 2IQAA 3L5JA 3BKMH 4X8JB 5I1DB 2JCCB 1K5NB 3OL2A 5EOQH 3W81A 2WZPD 4PJXF 1BGXL 1UADC 1S7XA 1LNUA 2PW1B 2B0SH 4ZOCA 3IDMA 2YOCA 4Z7UA 5T1LB 5CD3A 1A9BA 2QSCH 3PGDA 1KTDA 4RQQA 12E8L 3UJIL 3VFPA 5IT2L 4MYWB 5HHME 3ARUA 3MXWL 5J13B 4UAOC 5EO1B 3D69B 3U30B 2Y7QA 4GG6F 4DCQB 2GJJA 2UVEA 3P3YA 5SWSB 1XGPB 4YK4C 4Y2DA 3NCMA 4X83A 3TA3A 5ID0A 3GRWA 3PWLA 1I7UB 1M7DB 3L1OH 2E7LC 4R96B 5E2UH 5IUSA 4XVUC 4YBLC 3FN0L 3BRDA 4M62L 4G5ZH 4EI5A 5I74B 5CGTA 1HHHA 3D48R 5FECA 3NABH 4YGVA 3PWJB 5I76B 5D2LA 5HHNB 5KZCB 3V0VB 1ZGLA 3V52L 5DUBB 3LN9A 4Q58C 3S7GA 1FO0A 3TA3D 1OGAB 3B43A 1HHIA 3HA0A 1HH6A 3LSOA 1IAMA 3MRNB 4OLVL 3UDWA 2DIAA 4BQBA 4I77L 4KHTH 3I6GB 2BERA 3T0EA 5C70A 1NCDH 4GW4B 3KNBA 2V7HA 1QR1A 1QQDB 2OR7A 3MGTA 3UAJC 2FX7L 2X4SA 4G7VL 4RFEB 5ESVB 1N2RB 4NUJB 4JZOB 2NY6B 1RZIA 4MXQC 5CJQH 2W59A 3KLDA 3VI4E 5D7JA 1NCUA 4DUVA 5INDA 3GMRB 1CF8H 1EFQA 1FL3A 3RRQA 1L4IA 3ULVC 4WFGD 5FA4A 4NQDE 1ZAGA 4F15C 1P53A 1R3KA 4KY1H 5F3BB 1PGRB 4XNXH 3T0ED 1U92A 3QPQC 1JWMB 4OGXL 4YDLB 3CU1A 3NH7L 3BJ91 2DLTA 1KCUH 2XWTA 1LD9B 3MV8A 1ULVA 4LAJH 4ZPTB 3V6OE 4R6UA 5D7JD 5FYKH 4KK8D 1K4CB 3ZKSD 3LQZB 4WIQA 4J6RH 1F11A 4RFNB 1AJ7L 4XC1L 5IWLA 4FA8A 3AS0A 3RY6A 3CU7A 1XF2B 4JM2D 1U8PB 2WBJC 3MRBB 3MA7B 2P4AB 2GJ6B 5F21B 2PO6B 4BFBD 1H3XA 1OWRM 1Y18A 3ARYA 3HPJB 5IW6A 3F8UB 1MCOH 3MR9A 1LILA 3Q6FA 2ZOKA 4JM4H 5BS0E 4NQXB 4XMPL 4NO5B 1VGEL 4JDVB 2FBJL 3BPCA 2VZ1A 4N5UA 3LKRB 3P11L 2GITA 1ZHNB 1S3KH 4MNGB 4YHLH 1OARL 3SPVA 2GT9A 4M5YL 1ZT7B 2FO4B 2AERT 3HC0A 2C3VA 2K7QA 4NPYA 4OCNC 2NR6D 1I3VA 5CAYB 2FSEB 1CL7I 2R2HA 1FIGH 5GRVK 1N6UA 2FIRT 5I19H 2AKRB 4OAWB 4JG1L 5GPRA 5L8JB 2O5XL 3AAZB 4HBCL 4BSVA 3TCLA 4HCRA 1BVLB 4K7PL 5HVGB 4NNPL 5KSAA 4NOFA 4WHYG 5CIPH 4XCFL 1FZKB 4QHUB 3GGWA 4Q74A 4QYOA 3UJJH 5C7XH 1A21A 1B90A 3QIUC 4KHXL 4I13B 4P23C 1GGUA 3CFEA 4PRBB 5ID1B 5MHSE 5HGHA 2XN9E 4NYLA 1KIUA 3FO1A 3GSWB 4XZUA 4FFWC 1GZQB 1HINH 3BWAA 2VITA 4NQEB 1Q0XL 1N6QH 3MYJB 5HPMB 4JGUA 5ERWA 5GGVL 5EZOH 2J8HA 4Y4HC 5IVZA 4IJ3B 4P2CG 4JJ5B 5F6HI 3QDMD 4JFDB 1PEWA 4XNMB 1OAXH 4U6XB 1MAMH 3HG1D 4PP1D 1Y0LA 1HYSC 5DEFB 3MV9A 4WU7A 2E5EA 3S4SA 3LPWA 3IFLH 2F19H 1GRWA 2X7LB 4PJ7F 2FECI 2FBOJ 4OLYH 5IR1B 4E41A 3NACL 4YDJA 4OCSL 3Q6GH 2AK4B 3D85B 5E4EB 4JKWA 3AB0B 2I60L 3GSVA 4WUUB 1QYGH 2IPTH 2CRIA 1IQWH 5DD0H 3BZ4A 3KYKH 3QRGH 1XGYL 3X14A 1DP0A 1IQDA 3O3EA 4U7KA 2R2EA 2FJHB 1D5ZA 3PGFH 3EOYG 3WD5H 3ROLA 4RBPK 5AZEH 5E7FA 4M7KL 4TUJA 4EUPG 1RZ7L 2J88H 3O3UN 1QLRA 5JXAL 1UWGL 5JIIA 3NA9H 1NDMA 1G7QB 5IMLA 3IETA 2R56H 3MFGB 1FPTH 3NPSC 2JIXA 4WVRA 1IGJB 4OLZL 5TE6L 2K7PA 1F4YL 2CH8A 4AQ1B 1BM3L 2Z93B 1H3GA 5B4MC 1U8MB 2YBRB 2YMXH 4LHUA 5I1JH 1IC4H 5C3LD 5IG7A 4XP4H 1NLBH 5HJ3A 4XWOD 1KF9B 5CINL 4BSWA 3NCBB 3LPFA 2WBWB 4G8FA 4LCCA 4P3CH 1RULL 4PP2A 1JPST 5EO9A 3BFOA 2EDBA 2FX9L 3FQNB 1IL1B 3K80A 3V8CA 2EE6A 4G6KH 4RGMC 3VFMB 2R1WA 3ZDYE 2YD6A 3IJHA 5BRZE 2F53A 4KXZI 5TPWH 4WHTB 1JGLL 3UXFA 5FV1L 2Z9TA 3T4AA 1IZJA 4PTTA 3L5WB 1ZSDB 1AHWA 1AQKL 3ZKXC 4V1DD 3VXPA 2VDRL 5CEXB 5CKGA 2BVQA 5DFTA 1JPGA 4S1RL 3ZT6A 4MS8C 5C8JB 1E4KC 4D3CL 1MWAL 5L2JA 1R5VB 2R2BA 1NCWL 5GGQL 3VWJC 1A22B 4UIKL 4Z0BL 2AXFA 5IQ9A 3RTQA 2F53D 1ZXQA 4S0UC 4I48B 5GHWH 4LAQL 4OD2B 2KDGA 2PTVA 5EIVA 4QXTA 1MFEL 3OJ2C 4HKBB 3SDDA 1HYRC 4HC1L 4WEBH 1S8DB 5T1KA 3L3IB 1L0QA 5BV7C 1B0GA 5F7UA 2IAMD 4R90H 4LLMB 4EDXA 1XFPA 3VW3H 4YQXH 3I84A 5DZLA 5H37G 1ZA3B 4NQCD 5C9KA 1YEDA 1PFCA 4L3CA 3RPIA 3S96A 3V5HB 1T20B 3QO1A 2D7OA 3GRWL 4ZO7A 3CFJA 2DBLH 3CVIL 2A6KA 1JPSL 3MTRA 4HKXA 3QEQB 3FB6B 3B9KB 2DS4A 2BCKB 1FNHA 3T0XA 1QPXA 1QVOB 1ZT4B 4JREC 4G8EB 1RHFA 1DFBH 4QRPB 4OZFA 2ORBH 1EJOL 1PKQA 2YUVA 4YIQB 3OJDA 3CH1B 4K9EH 4G3YL 1V7MH 4IRZH 1ADQA 2ED8A 2XKNB 4FFYL 4K55A 3O3AA 4RA3A 3D39E 1I3UA 5IMOB 5KVEH 2WANA 2B8OT 3L3HA 1OTSC 3AGVA 1JNLL 1P2CA 1NUGA 1JRHI 3QQ9C 3MRIA 5C0GB 1HXYA 1U8IB 3KYAA 1CDGA 4XXCA 1IM9B 3EUUA 4ODSH 1WEJL 2PYED 2CK0H 2H1PL 15C8L 4Z18A 1A2YB 1WZ1L 2VDNH 2A74B 2X44D 4GXVL 3CK0L 3AREC 4S1SH 4LF3A 5E2WH 2AK1L 4HIJB 4FG6D 1LP9B 5ETUB 1MF2H 1ES0A 2BFVL 2AJZA 1JCKA 1JYVA 4OQTH 1IMHC 1AI1L 1YEFL 5EULV 4KFZC 2P45B 1MPAH 5ACZB 1F90L 1Q0YL 4GAYA 3TESA 1WQVT 4GRLD 1G7LB 5EH1A 1QA9A 1A14L 2F5AL 1INDH 4OJFL 3QG7H 5JZ7D 3OJMB 2AQ1A 1S5HB 1QLFA 1Z9SA 4NNXA 4POZD 3E1F1 4NC1E 4NOBA 5EFIA 4LBEA 3GJFH 5JW4N 1XR9A 3BPNB 5LVEA 3LOWA 4NO3B 3KDMA 5D1QB 4Z5RA 4UT7L 3WXVH 5K9JL 5L0QC 1FGNL 1N8ZA 2NY1D 2R0LH 4YEFA 1PG7X 4UNVA 3LEYL 4U05A 3ARVA 5FGCE 4X6CE 4L5FH 2YSSA 2VLME 4M43H 3RU8H 4TUKH 3E2HA 3E6FA 3TFKA 1TPXB 4PJ8A 1O7VA 1LVEA 3QDGE 4L4JA 2X4OB 5K93A 3VGFA 1LQSR 5C09A 1XIWA 1P7HL 3GUTA 3CFIC 5DK0A 1M7IB 3CFCL 4YDKH 1QHOA 3U36B 1HN1A 1OW0C 3RDTA 1R3LA 1MI5A 1NBVL 2DQJL 3WJJC 2XA8H 4JCLA 4ZFGH 4X6EA 4WI7A 1UWXK 2DQEH 2YXFA 5HDQL 3CSYB 3VXSD 3SO3C 2BSED 1E28A 3V6OC 2RJMA 3IDJB 5TDNA 3P77B 1MFDH 1F4WL 4I18B 5CEZD 1C5BL 1DTUA 3IFOA 3K2MC 1NJ9A 3KPRE 5HVWA 5IQ7H 5JPNB 3PDGA 1M71A 1UXSB 3UJTH 3PIQA 4KMTH 4XXDB 3S9DB 4ZUWB 1TVBB 4LK4A 4ACPA 3MOAH 4ZUVA 4Q9QH 1OP3H 3QIBC 5EOCJ 4YHYC 1PJ9A 1RIHH 2WBKA 4EN3C 3F6LA 1KCGC 1YECH 4QNPF 1U3HD 4MSWA 5FUZL 2EZ0D 5CZVL 2K3TA 5F89B 2QQKL 1UB6A 2OTWB 5EU7E 3QCUL 2I25N 1OSZB 3ARDA 4KDTA 3SE4C 1TNMA 3P30H 1FFPA 4MJIE 1TIUA 2ZSVB 3T3PF 5BO1L 4P9HH 5DSCB 4O2FB 5DMKA 4MVBA 4APQA 4Z6AT 2P42B 1JFQL 4ZFZA 4MD4A 4DEPB 1BD2D 4KJQC 1BBDH 4NCDA 3U6RB 3IVKA 5E8EA 2F58H 4CADB 4EXPX 1GGIH 5E9DE 3IU3A 2FX8H 3E8UL 5HD8C 4U4BA 1TZHB 2VXTL 3D0VB 4UUJB 1CLYH 2CUHA 4H20L 5HGGS 3GBNL 2VLJA 2I9LB 4K3JH 1RURH 3U0PB 3QDJB 4R2GD 3VCLB 5B3NA 2QADB 5D7IE 4HLJA 5I8KL 4ODVL 4FTVE 3VH8G 4S0TD 4MVBD 2CGRL 2W0FA 4OZIE 1YZZA 5A40E 4XPGH 5KG9B 2I26N 2X10A 5DRNB 3GJFB 3EFDH 3C5JA 5I66B 3HUJE 3B8SA 3GBML 2BVEA 1HHGB 1J8HB 5F9AC 3N85H 2EDHA 1OHQA 2VLJD 3BAEH 4K3HA 4FHBD 5KSBE 5CD5C 3WXWL 4JFYA 3O4OC 4NSKB 3H9YA 4HGKC 3NFSL 1RD6A 4BQ6A 5E5MA 3OKKB 4GBXA 1A6AA 4BYHA 4L9LB 1Q38A 2W1NA 4LU5H 3U0WH 4ZAKB 1HQ4A 3MUGA 5JORB 3V4VH 2P7TB 3C2AL 3L3DA 2SEBB 4GUPA 5KS9F 3RWDB 4X4YB 5GS2D 3H8NA 4JFQA 4QEGA 1CXFA 1KB5L 3RBGA 4UT6L 2IGFL 2X40A 2VL5B 3MBEA 4JZNB 4NWTH 1QSZA 3BWUC 3R0NA 2Q8BL 4MMXC 4FZ8H 3GK8L 1C5CH 4AEFA 4NQSB 1A6VL 4XNYL 3ES6B 3HE7C 4K71C 1DL7L 5TDPB 1PSKL 2CKNA 1V7NL 2GSGA 3RGVB 4AZ8A 5I8EB 1RJYA 2MOVA 2NZ9D 1F3DJ 4J4PD 1S9XB 3VMPA 3WNOA 2W65A 5IEHA 2CRMA 2ATPB 5DGRA 5ICXB 3DYMA 4XWGH 1UB5A 3G5YB 2QKIB 5C0ND 2Y72A 4R7NB 3SKNA 1DN2A 2V2WB 1M7XA 5D71L 1BX2A 3W39B 2X42A 3LB6D 1I8LC 1RK0B 1F4AA 2B20A 1X6LA 2VDQH 1KIPA 3IFPA 3SGEH 1XF3B 2MQ0A 4KV5E 3RA7H 1FAKT 1MRCL 1N7MH 4FQ1H 3SDCC 1HOCA 1T2QH 4ZSOA 4X0KB 2X4PA 2QR0B 3P40A 3TC9A 4AIZA 1IM3B 5GGSB 3UTOA 1W72A 4OTXL 5C0BD 4LPTA 3ARRA 1ETZA 3VJ6A 2BC4A 2FL5A 2X4RB 2GCYA 5D7IF 2CKBH 3S37X 1OD7A 4DKEH 4OZIF 4QOKA 3ARGA 1OPGL 5I15H 4ZFOA 1CL7L 4PRHB 4R4ND 2F8VA 4DGIL 3M17A 2VABB 4WUKL 1IEBB 2PYFB 4LQFH 3GMQA 2OL3A 1CGUA 4P2QA 1X5JA 3TJEH 3VGDA 1INEL 1BQLL 5FA3B 5ISZD 4NQUA 1G7MB 1CXIA 5DD1L 1LDPH 1ADQL 3G08B 3MLWH 4Z7NE 3TBYA 4LKXB 5KVFH 2X4UA 1DLHA 3B6SB 4K07A 2CDEB 4OZHA 3F7YA 4CMHB 1UCTA 4IHOB 5B3JE 3VFNB 1EHLL 5I71C 1TETL 4X6DA 2J1KA 3Q3GB 4P4KA 3RKDC 3JWDH 4XTRC 4P2QD 2ICWB 5AUMB 3ZE0E 4P5KB 3AS2A 5JHLH 3FRUB 3VRIB 2V9TA 1N5YL 1LO2L 4CN4A 3GIZL 1JNHB 2YUWA 4I4WA 3TVMB 4DN3L 1EH9A 3D5OF 1XGTA 4O2CA 2Y07H 3VFTA 4TVPD 4PRDA 1CE1L 4HIHA 1JTOA 3BGAA 3MRGB 1NFKA 2PN5A 1YMME 2AEQH 5IBLD 1IGTB 5EORL 4P4KD 2B39A 5CJXC 1KEML 1LMKA 3D9AH 4NO2B 4F7TB 2XOTA 1BZ7A 2VL4A 4NO0D 1FCCA 3PGCB 1I7TB 1VERA 3KYNB 1D5BB 2P46B 1VFUA 2W0KA 3S37L 4I1NB 1WTLA 3BUYB 1T0NA 1Q9WB 3TPUB 3K81A 1BZ9B 5ESQA 3KPLB 2VXQL 4PJCA 1P7QA 3ARFA 5D6CA 1GC1H 3U7WL 3BXNA 3CSPA 1R24B 4YXHH 2V7NB 4KV5F 5DLMH 1S9WB 3FQTA 4LSSH 4MCZA 2NNAB 5FGRA 3HZYB 1N6VA 3FT3A 1EBPA 2HLFC 3O6FB 1H5BA 3FJTA 2CLZB 8CGTA 3RWHB 3ARFD 1DR9A 5FF6B 2O5YL 3OAZK 1QFUH 4GRWE 1BFOA 4UILL 4HFWB 4DKFL 3QEUA 1MJ7H 2PW2A 2E3VA 4FQXC 3QUXC 1OAKH 5KVGL 3CZFB 3GB7B 1MFNA 2YKLH 3OR7A 1YEJH 5DJAA 2CKBB 1OSPL 4MD0B 5DD3H 5B38B 3RPKA 1AGFB 5C6TL 4JQIH 4ODHH 1ZOXA 5LGKA 1CBVL 3VXUD 1LE9B 4XPAH 4FXLA 1KTLB 4U1JB 2EDTA 3SE3C 4J1UB 3PL6D 5DEGB 3QXDA 3QP3A 3CCHA 1K2DB 4K94H 4ELMF 1HK6A 5E1AA 2Z91B 3G9AB 4RGOH 5E99L 3SCMA 5BJTB 4R0LB 3WSQH 1C12B 1J18A 4GRMA 3RI5K 2CD0A 2X4QB 1S7WA 1JK8A 2Z31A 3Q5OA 4X8JA 4NC1C 2JCCA 1FNGB 1K5NA 2UWEB 3UTPD 1IC1A 3O8XA 4K23L 3BN9D 1BIIA 4IRSB 2PW1A 4MMZC 2DQHH 2E8ZA 5JMOC 3BO8B 5J6HB 1B0RA 2CMRH 5T1LA 3R8QA 1LWRA 1GYAA 4YUEL 1DJSA 2E7BA 2JJSA 4H8WC 3ZYIA 3PHOB 5EO1A 5D1XD 3D69A 2AEIT 2Z31D 5CJOL 4DCQA 1XGPA 3W0WB 2AGJL 3RUGF 1M7DA 2C9AA 2CO7B 1INQB 4R96A 1SQ2N 5A1AA 2Q20A 4XNZB 4HWBH 3OWEA 1N0XL 4JZJC 4TTGA 5JO5B 4JPIA 3C5ZB 4GOSA 5I76A 3L5XL 5HHNA 3B3IB 3V0VA 5DUBA 3AU1B 3BKYL 3QDME 5DI8B 2HN7B 1OGAA 4CVZB 5L6YH 1JNNH 1JPTH 3HG1E 4UV4H 3MRNA 4YWGL 2AI0L 4Y4FC 3I6GA 4GW4A 4JO2L 4NN5C 3RWIB 1FE8L 1I8KB 4RFEA 2P8LB 5ESVA 4JDTH 3LS4L 4PJAF 3UO1L 4NUJA 4JZOA 2DMBA 1OAYH 2BNQD 4YBLB 5HVHC 3GMRA 1JRHL 4WV1A 2D7TH 4WO4B 3O6MH 4WDIA 2V2TB 1MEXL 5DJZB 5EU7C 5H2BB 4YHKL 1IKNC 1JWMA 4MDJB 3TZVA 2AJYL 5INCB 1YNLH 5I1IH 4NZTH 5D5MB 5FYLH 4JKPL 1LD9A 5C0AB 5HYSG 4ZPTA 3O2DL 3R0MA 1ZVSA 4YFDB 5C2BL 3O9WD 1CYGA 4OD1L 3MCLL 2OTPA 1A8JH 5LXGL 4IOIA 3FZUC 2ESVB 2VXVL 4BM7A 2OR9L 3LQZA 4Z78A 3NGBB 3K0WA 4PJ9A 2XZCL 3MZTA 3DYPA 4PLJD 1RZ8B 2GEEA 2V6HA 1XF2A 3UTQB 1U8PA 3O4LB 3MRBA 3TZVD 3MA7A 2GJ6A 2PO6A 2E9WA 5CEYB 5C71A 4PJAB 3S36L 3PHSA 4H88L 4HKZB 3JBG7 3HPJA 4N0FA 3KR3L 2NXZD 5I75C 2COQA 5J6GB 4PJ5B 2J2ZA 5BMFH 1E0OB 1T89A 1GCFA 1OWWA 3SN6N 4NQXA 4PJ9D 1Q94A 2E8YA 3WIHA 4P0DA 2VDLH 2D31B 4F58L 3LKRA 4WFFD 3QI9C 4CKVX 1F3RB 2EDJA 4M6NH 5MEND 3EJJX 4NN7C 2FLRT 1A9EB 5JXEC 1G6RH 2VB5A 1ZT7A 1NEZB 3EHBC 4H25B 1NLDL 2FO4A 3BMWA 1W72L 3MSPA 3L3JA 4V1DE 2V5TA 1PG7W 4YHZH 1G9ML 4LSRH 3P4MB 2RAMA 1T66C 3BDYH 5DRZB 2AKRA 4OAWA 4HAFA 3AAZA 4HUMB 1BVLA 1U3YA 2R4RL 2D9QB 2R9HC 1NCAH 3MJ8B 5HPOA 1FZKA 4QHUA 4D0CB 1UM5L 3UP1A 3EJYC 2J6EH 4PRBA 1FLRH 2OI9C 2EDWA 4GMSL 1WGOA 3QIWA 3SJVE 4OSUL 2DICA 43C9B 3C09B 1GZQA 3ZDXF 1A7PH 3GMMB 4QO1A 5TDOA 1J88A 3AY4C 5HPMA 4NQCE 2ZUSA 5EO0B 2HVJB 5CP3H 1I7ZA 4U6HB 5FM5O 4KVNH 2ADFL 4JJ5A 4XPHH 1SJHB 4G8GB 4B41A 1IGIL 3F5WB 4JFDA 2WY3A 3MRCB 4XNMA 3LQAC 4U6XA 2Q3AA 1OQOA 3QIWD 5F6IC 1XCQB 5IFJA 1RUKH 1JYWA 1T5XB 4O5LL 3K2UH 4J3SA 3MRFB 3GJEB 1XMWA 2X7LA 4R7DB 1F02I 5HTSA 1WFNA 5IR1A 1QSED 3DXAD 1RU9H 2XKSA 2AK4A 4OZ4B 1T1YB 3ARBC 4XHJC 3T3ME 3VI3E 3D85A 4AH2B 1K6QH 2MHAB 1Z9OA 5BXFA 4HMCA 2MCPH 4N1CA 4O4YL 1E6OH 2V17L 3FQUB 4HD9A 3CXDL 2QHRL 4XH2B 3KPSB 1MCFA 4B5EA 5FUOL 2FJHA 3X3FH 5C0JB 5HI4D 1EFXD 1OGTB 1SVZA 1OM3H 2E9JA 3OHXA 2GK2A 4ODTH 3L9RA 5DHVH 2PYEE 4QHNB 5HHOB 1CR9H 3THMH 1G7QA 3V4UH 5K9KB 1AC0A 3RVTC 5T1MB 1WFOA 3U1SH 1KELL 2XZQH 1AY1L 2E7MA 3VRLE 4S1QL 1EO5A 3EO9L 1CN4A 2Z93A 3F7VB 1TZGL 1RK1B 5J1SC 2AQ2A 3LS5L 1U8MA 4K3DH 3VGBA 2EC8A 2L0DA 3I9GL 4Y5XC 4V2CB 1SEQL 3L7FB 3LV3B 3FN9A 5L2KD 3WEXB 3RZWA 4ZNEA 2BK8A 4NT6B 4WY7H 2D7NA 4JAMB 3K1KC 3FQNA 1KLUA 3VFMA 1CFTB 1V3LA 2PTTB 2ED7A 4NZDA 4WHTA 3ULUL 3IGAB 4MA7H 4PJEF 3RX8A 1JTPA 5C3TA 4F57L 1Z0NA 3DVNB 4U7SA 3WUWB 1ZSDA 4FP8H 1MCKA 5IF0B 5CEXA 3DOSA 3RAJH 2J4WH 4MX7B 4U0QB 5C9JB 4LARL 5FM4A 1FZJB 5D96C 5C8JA 4PGEB 5F8QC 1VFMA 3C6LC 1H3VA 1R5VA 2RR3A 4K8RH 3LEXB 3E6HA 1EMTH 1T5WB 2VSDA 4I48A 4M3JA 4JQXC 4OD2A 4D94A 1G9NL 3PWVB 4HKBA 1P4BH 1UZ8B 4LLUB 1S8DA 3RVUD 5HHVH 2WM0A 3HFML 3L3IA 4JFED 4L3EB 3O2WH 5L88L 3KLHC 4LLMA 2C4XA 3R8BB 3GSXB 3D25B 5A3ID 1ZA3A 3MODH 5D93C 4WI9A 4ZS7H 3G6JE 5DC4B 1T20A 3GEWB 1XZ0B 3S34L 3V5HA 5CEZE 5KBNC 1CICB 5IBTH 5E2JA 3TYGH 3KPOB 3QEQA 5FGBA 3FB6A 3B9KA 4E42B 2X9XA 2BCKA 4JM2C 1R5WB 4HXAL 4PJFF 1V5JA 2IFGA 4G8EA 4MAYD 5GZNC 3SGJA 1QKZL 3SBWC 3V95A 4QRPA 3VA2C 5GS3A 3I6LD 4OM0L 1RUMH 4PRAB 1EEZB 4YIQA 4OV6F 3ZKMD 1FL5B 4ONGH 1GPOH 2XKNA 3H6JA 3QUYB 3NZHH 4OIBA 1SMOA 5CCKH 4KU1A 1B4JH 3LZFL 2LTQC 1BBJB 5GJTL 4AMKH 1H8NA 1WUNT 3EFFB 4KKNA 5F1IB 4Q6IC 3X12B 3SKMB 3KXFD 4Q0XH 1D5XB 2R1XB 4ONFH 1U8IA 1MCPH 5IHUH 1U58B 1UENA 1KGCE 2QSTA 4Y1AB 5DR5L 1QNZH 3NFNB 1IM9A 3F7QA 3ZL4L 4X9FA 3E3QA 2VLKD 2NY3B 1TDQA 1A2YA 4ZG1A 1FFOB 2A74A 4GAGH 1G7IA 3PDOB 1CTNA 4HIJA 4YPGA 2DDQL 2N56A 1LP9A 3N9GH 5ETUA 4OFKA 2HRLA 3P9WB 3IJSB 1S7RB 1EHXA 4H5SB 3ZSTA 4LLVB 3QB7C 1EV2E 5CS7A 5EPMA 4RZCB 5E8DH 4WI6A 1IGMH 5ACZA 1G7LA 1CFQB 2B1HL 1SBSH 4U6VH 1A3RH 4PJBF 1CFBA 1AO7E 2YD5A 1HKLH 2VN7A 2YRPA 1S5HA 1EVUA 1WTGT 5HYSA 1BJ1H 1VACB 4ZO9A 3U83A 1HQRB 5ELIA 3WLBB 1BFTA 3V7AE 3BKML 4PBVC 3EDEA 4NO3A 4YZFE 5D1QA 2Z8VC 5EOQL 3AREB 5HHMB 1MCQA 5IJVA 2OTUB 3WIHL 3G6JF 4WNQB 3M8OH 4HQQH 2W9LA 3RL2B 4PLKD 1X9QA 5K9QG 3M07A 1RFDH 4MQ7A 2YD9A 1FH5H 2X4OA 2VZVA 2FHCA 4YX2H 1J1PH 4P46D 3MJ6A 3PUCA 2FHBA 5B39G 3U36A 2LVEA 1AGDA 3EYFB 3L1OL 5E2UL 4OCXL 3KG5A 2YPLD 2DYPD 3CSYA 4G5ZL 5JNYB 1UM6H 3IDJA 1E4JA 3P77A 4MHHG 1XAUA 4I18A 3RHWK 3CGTA 5DD6B 3HI5H 5AWNH 3RVXC 4OFDA 5JPNA 8FABA 2IBBA 2HMID 4XXDA 4YXKH 4ZUWA 3SOBH 4CN6A 1TVBA 4WW1A 4KHTL 4G9DB 1NCDL 2ICWI 1HDMB 1QG3A 5C0BE 1YQVL 2IQ9H 3KGRA 4XPFL 5D1ZB 2IBZY 4I9WD 4QHKI 3REWB 5CJQL 4GO6B 4X7TB 3SKJH 5F89A 2OTWA 1OSZA 1NFIB 1C7TA 4HDIB 2ZSVA 5D2NC 4KY1L 3BISA 1K9TA 5DD5H 4KK6C 4XNXL 4LLQB 3TF7C 1FIEA 2AJVH 1N4XH 4NQTA 5DSCA 4JFFD 4PS4H 4RWYH 5GSRB 3WFCH 1ZLUH 3WO4C 5ISZE 2WAHA 1LK2B 1MFAH 4M6AA 5IEKA 5C6WH 1QTYT 4JFHE 4MXVE 1XCTB 4KTDH 4YO0B 2AP2A 4YE4H 2LU4A 3RWFB 1TZHA 3D0VA 4LLWB 4UUJA 4J6RL 3TNNB 4JFZL 2Q7YB 1T1WB 3U0PA 4FQ2H 4WU5A 3S3SA 4R97B 3QDJA 1J9CT 5J56B 5BS0B 1J5OH 4Y88A 4IDLA 4XRCA 5KG9A 1YUHB 4NCC1 4P2OD 5DRNA 3GJFA 3OKDB 5I66A 4S1DD 1HHGA 3V5KB 3KPQB 4M1CC 2EYRB 3MNVB 2OXGA 3SGEI 2FATH 2DJ4A 5CP7B 2GY7B 4BKLB 2NY2B 4NSKA 4YHLL 5IVOA 3OKKA 1AP2B 4QRSB 3CUPB 3QEHB 3DUSB 3C60B 2EYTA 4WWID 4ZAKA 5JORA 2P7TA 3L3GA 1EX0A 2SEBA 5FXCH 4N90E 1FIGL 2XQYK 1F5WA 4PRNB 3RWDA 4X4YA 5JQHC 1GAFH 2XI9A 5I19L 2XN9B 5HGDB 4JZNA 4NKMB 2KZWA 2X05A 3VWKA 4NQSA 3ES6A 2V9QA 5C7XL 4ZXBD 5TDPA 4ZD3H 3QULB 4M61B 1FFNB 3LHPH 3RGVA 1F2XK 1G7HB 4NP4H 3D18B 1LDSA 1HINL 3BQUC 4MHHI 1S9XA 2OJZH 4DGVH 3KPNB 4CU8A 2ATPA 1NEZG 5ICXA 5EZOL 1C5DB 3MOBL 3MRDB 2X41A 4PG9B 2QKIA 1UWEH 4XVJL 4I0PD 4R7NA 4LCWD 3VWKD 2V2WA 3TBWA 2HKHL 2HP4A 3W39A 1OAXL 1MAML 5ICYB 1XF3A 1NGYB 4MXVF 3SDAA 4FFEX 2WUBH 4X0KA 2EYSB 2QR0A 4FFZH 4M1GH 3VXUE 2F19L 4QY8B 1IM3A 5GGSA 1OLZA 1UWXH 2VQTA 1X5HA 3MUHL 3HE7B 1LHZA 2VAAB 4XBPB 1DQDH 5MEOB 2WNGA 4N0CA 2DKSA 2HH0L 1WBXB 4PJIB 2X4RA 5JLZA 1KPUB 1KN4L 5EUOF 2VYRE 2IPTL 1IQWL 5DD0L 3WS6A 4I3SH 4PRHA 4HUVB 5C07B 3TO4D 1S7QB 2FZ3B 3KYKL 3QRGL 2AXGB 3SDAD 1EBAA 4JRYD 1IEBA 1FNEB 2PYFA 3UTPE 3PGFL 5ADOH 3WD5L 3X3GL 2IALB 5AZEL 5FA3A 4CL7A 1G7MA 1UZ6F 3G08A 2J88L 3SDCB 3BDXA 4ONHB 3O11A 5E0QA 1WT5A 4LKXA 3NA9L 3B6SA 2CDEA 5GGSY 4LQ1A 4JFOB 4IHOA 3VFNA 3RZCD 2R56L 1X5KA 1FPTL 3Q3GA 5K9OB 5KN5B 2HTLD 1A02N 5AUMA 3VE0B 1TCRB 2Y06H 4IMKC 3FRUA 3VRIA 2YMXL 5I1JL 1IC4L 1JNHA 2H2PD 3IKCB 3TVMA 3H9ZA 4XP4L 1NLBL 4PBWD 3MLYH 2B5IC 4JRXE 4P3CL 1MQKH 3MRGA 3LKSA 3B9VA 3QJFB 3OKNA 3PJSB 1IGTA 4NO2A 4F7TA 1NANI 1OT2A 5TPWL 3PGCA 1I7TA 4X4ME 2H2SD 5F7FA 3KYNA 1D5BA 2D3VA 4ZPVB 3T8XB 1DVFD 3BUYA 1Q9WA 3O81A 3TPUA 1U8QB 2UZXB 1BZ9A 3KPLA 1GOGA 4LL9A 4M6OH 3TJHA 4NKIL 2BNQE 2NX5A 3ZE1E 1Z9MA 3FO9B 1R24A 2V7NA 4JB9H 1EGJH 1U3HC 4DOHB 2EZ0C 1PYWB 1S9WA 1F13A 3ALXA 3P2TA 2NNAA 3HZYA 4WEBL 1EHAA 3O6FA 3HMXA 2CLZA 4KKCC 4L4TD 2OLDA 2W60B 5FF6A 4R90L 2NX5D 3D2UB 2ICCA 4YQXL 3VW3L 4HFWA 2XIDA 1E4XH 3VG0H 2DAVA 4P4RB 5JIHA 1X44A 3ARXA 2DBLL 3CZFA 2WWMC 3GB7A 4WFED 3FQWB 3GSRA 2CKBA 4MD0A 5IROC 1AJ7H 5B38A 4R2GC 5HHXH 2BY2A 2C3XA 1LE9A 5C0RH 5IB4B 1DFBL 1KIQB 1KTLA 4U1JA 4X98A 1KG0B 5DEGA 2ORBL 1L9MA 1K2DA 1XF5B 4Z7WE 5GRJH 2HLAB 2P5WB 4K9EL 4WFFE 5BJTA 3I02A 5CLTA 4R0LA 1V7ML 1C12A 1YPZE 3LN4B 4IRZL 4OGZA 1VGEH 1TTUA 2CRYA 2X4QA 4Y0GA 2GUOB 5CSGA 3WMSA 4NUGH 1FNGA 2UWEA 5JDJA 2ZUTA 4IRSA 3BO8A 2J8UB 1C08B 3C8HA 3WKML 3MV01 3QNYA 3QISA 1ACZA 4PJGB 2VKXA 3CSGA 1J0ZA 1KTRL 3MJ7B 1NUDA 4ODSL 4M9OA 2CK0L 3PV7A 4LMQI 4WWKD 2RHEA 3V6BR 2ED9A 3NCYS 5D7KD 3BSZH 5IHZB 4S1SL 4QTHB 5E2WL 1KBGH 4JG1H 3W0WA 3LIZH 1MF2L 1FDLH 3PDDA 2OZ4H 1GJIA 5T5NF 4DQOH 4GW5A 4UIMB 3VG9C 4L3AA 2VLRB 1INQA 3LKNB 4XCFH 4OM1H 5F9JB 3OKOA 1MPAL 2X1QA 4Y89A 4L4VA 4IRJB 5JW4R 5JO5A 3C5ZA 4KJYB 4KRPC 2NZ9C 2FH8A 4W81A 1Q0XH 1INDL 3AU1A 4EDWH 3KS0J 4FXGB 3QG7L 5I6XC 5GGVH 2FEEI 1AQDB 1JTTA 3T2OA 4CVZA 4P5TB 4G6FD 3PF2A 4M03A 4X6CB 4G9FA 3UZVB 2DMKA 4H0GA 5GS0H 1G1CA 3WHE0 1MCSA 3FQRB 3N0PB 3QBTB 3D6GA 2KQNA 3QDGB 4LDOB 4L4VD 3WXVL 1I8KA 4JGJA 2R0LL 1QSEE 3DXAE 2BSTB 5DURD 2HKFL 1MVUB 4L5FL 2OK0H 4CMMB 4HF5H 4M43L 3RU8L 4FQQA 2WWKT 5E6YA 4WO4A 4JZJB 5GS1B 4G9FD 4JEGB 3QWOA 5DJZA 3N1GC 5H2BA 1KJ2H 3DIFB 3M1BB 4MDJA 4YDKL 5INCA 4FZEL 1XGYH 1FL6B 5D5MA 5C0AA 3T0VA 4BQ8A 2EIZB 2XA8L 4X7CC 4ZFGL 4D0DB 4XVUD 2DQEL 3KPRB 2ESVA 3VXRE 3H3PL 2HRPH 1MFDL 1A64A 2EKSB 5JXAH 5EIIB 5KANI 1RZ8A 2YPVH 3FT4B 4OKVB 3O4LA 4I2XA 3QXWA 1NC4D 1RIUH 3UJTL 5EC1B 3GSNB 4KMTL 5CEYA 5EU6D 2L4OA 1L8JA 1F6FB 4KROD 4HKZA 4OLZH 3WNMA 3RWGA 4RMSA 1P9MC 3AUVA 1A0QH 3MOAL 5J6GA 5I8CB 1IGFH 1B4RA 2IWGA 3TN0B 4MJIB 5L2KE 4EQ3A 1RIHL 3FFCD 1I3GH 3UAJD 2NXYB 4KGLA 1YECL 2D31A 4WI3A 4Y16C 2JF1A 4PRPB 4FXKB 4MXQD 3V79C 2PXYC 2AW2A 2QQNH 5DC0A 3ULVD 1NFDF 4NNYB 1A9EA 4HUNB 2Q86B 1NEZA 1DN0B 3CZJA 4H25A 1FVEB 5E9DB 3IXTB 2VISB 1R6VA 4JANB 1WIUA 4P9HL 3WN5C 3QPQD 2LFGA 3TEUA 2WBJA 4Z7UE 1BBDL 3P4MA 3UBXB 2GI7A 2F58L 1CTOA 1AQKH 5I9QB 1VEMA 3W82A 1GGIL 5A43C 2AV1B 3G5XB 4Y4KC 4LVHC 4AY0A 4YAQB 3A67H 3WE6B 1KJ3L 3MJ8A 5FYJD 4K3JL 1NCWH 1RURL 4D0CA 2HFEB 4Z0BH 4JPVH 2G2RA 2CRZA 4LAQH 2WBJD 4JFEE 4YBHA 2YN3A 1PW3A 4H26A 3MBXH 4UI2A 43C9A 5I1GH 4XPGL 5EB9A 5KSBB 2ADGB 2GAZA 3GMMA 4MB3A 5I1KH 5IMKB 3EFDL 3PWPD 5EO0A 2HVJA 4LASH 1QSFD 1SYSB 3N85L 1FAIH 4U6HA 1P4LB 3HE6B 2ZCLL 2GQHA 1AGBA 1SJHA 4G8GA 3F5WA 3BAEL 3FAWA 3IXAA 4XAKD 4XNQB 5IV2B 4LVOC 2DLEA 5DMGC 4LCUB 1KC5H 3GRWH 3HR5B 1XCQA 3BH8A 1T5XA 5HDOA 3GJEA 4TNWK 5T1DH 4R7DA 4GJTB 4KDWA 3QIUA 1MFBH 1KJ2B 2BHZA 4LU5L 3I6LE 4P23A 4BH7B 3U0WL 4OZ4A 1LEGB 3V4VL 3T09A 2MHAA 5BVJB 4F2MB 1YN6B 2JTDA 2P8PB 1NH6A 2EE9A 3FQUA 1FO0H 2A38A 4XH2A 3PWUA 1O7SA 2K1MA 3KPSA 3MRHB 4NWTL 5J57B 1HHKB 3ILQD 4FZ8L 1C5CL 4J3WA 3FRPG 3H3BC 4LHQB 5LJYH 1K3ZA 1TQBC 3KXFE 5C0JA 3B9AA 3QIUD 5TH2B 5GGUB 1XF1A 1OGTA 4ZDHB 5I0DA 2WINB 5FO8B 4XCEB 1PD6A 4UV7H 2Q6WA 4CBPA 3WHE1 4FFWD 1ND0B 4QHNA 5K9KA 1J0IA 4JLRB 3DSNA 4GRWH 4XWGL 2XKUA 5T1MA 4Y4HD 2H3NB 4PREB 4OCWH 2H1PH 1QRKA 4F37F 3KHQA 4Z7UF 2DM3A 1RK1A 2IAND 2VDQL 3RA7L 1N7ML 1HYSD 1B9ZA 3QXUA 1ZA6B 1EEQA 1AI1H 1YEFH 3HZVB 3L7FA 5GXBB 3LV3A 3WEXA 2JK5A 3TT1H 5JDSB 3QUMB 4NT6A 5JW4Q 4JAMA 1K8IB 2CKBL 3ZHDA 1F90H 3G04B 1CFTA 3DMMD 5I1LB 2PTTA 1RI8A 5I15L 4X4ZA 5HI5C 3IGAA 4E5XB 3GMLB 2E6PA 3FONB 1VDGA 5EZLA 3WUWA 4LQFL 5D2LF 4F7EB 1F6AB 1LO4H 2R4SL 2IQAB 5F9DC 4MX7A 1XR8B 1ZV5A 4PGEA 1LDPL 1GGTA 1YEKH 5K9JH 3LKQB 1LNUB 3MLWL 3LEXA 1EEYA 1IZKA 5JOPD 4MB4A 2NPLX 2EO9A 3FO2B 3NIFE 1T5WA 5F7EL 1KTDB 4XT1C 3VXQB 2Y1VA 3Q48A 5SWSD 1OP9A 5T5FH 1UZ8A 2JKXA 3JWDL 1IAOB 1WC7B 3INUH 3TH4T 3TIEA 5JHLL 4L3EA 3S88H 3HB3C 2YPLE 5B4MD 3TA3B 5ID0B 1CLOH 1NMCB 3PWLB 4Z8FL 5DVNA 5HDBE 4PY8I 5C0FB 1ITBB 3RVVC 2A9NH 1XZ0A 3LVEA 4FN0A 4HCRH 1CICA 2AEQL 1E4KA 3KPOA 3MO1B 3ZYZA 2V5RA 3D9AL 3FOLB 2JJTC 1ACYH 5FECB 3QEGH 4U1KB 2MKWA 5D2LB 4E42A 4M93C 3IAPA 3VWJA 4R9HA 4ISVB 1A7QH 4O51B 4RA0C 4NQVA 3WIIH 3EYOB 5J11B 1HH6B 5F7LB 3ZHKA 4I9WE 4PRAA 1NBZB 3T0EB 1VHPA 1UKTA 1EEZA 1GC1L 1FL5A 1QR1B 3MGTB 4MS8D 2IH1A 2X4SB 3QUYA 2CR3A 3BGFB 3WDJA 2VE6A 3O45B 5DLML 2WP3O 2R23B 3VWJD 5D7JB 4YHPB 4LSSL 4FQIH 1FL3B 2DQUH 1BBJA 4GRWB 4M3KB 1D9KC 1PG7H 5F1IA 3X12A 4KRMB 5DRWB 3SKMA 1D5XA 1R3KB 4JFFE 4U0RB 2FLBT 2A6IB 3UZEA 1U58A