5IB3A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr and copper
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib3A01
5DUML 2WBJA 3TIDB 5I15H 3B43A 5KS9E 3MNZA 3IFOA 1M7DB 1MWAA 4OB5L 1AO7A 4K3JL 1YEKH 1QFWL 1VHPA 1YNTB 4U1JA 3ZTNL 1QLEL 1FJ1A 2ENYA 4OAWB 1S7XA 1F90L 2JELH 1VPOL 2VDOH 4HXBH 4EZMA 3HZKA 4QEGA 1QFWI 1CICC 2KBGA 5DUPH 3BISA 4Z0XB 3T2NH 1A9EA 1ZHLB 2WBJD 5CWSA 5C0CA 3CK0L 1CU4L 2FHCA 5GJTL 1AO7D 2V7NA 2ZUSA 1OAKL 5DFTA 2GFBA 1V7NH 4LBEB 1EBAA 3HS0A 4JEGB 3P0YL 4LP4A 2MPAH 4YDJB 1Z3GL 3PJSA 1I7TA 1QZ1A 1JE6A 2V5RA 4CU7A 1AGCB 4G80B 3QEQB 1EAPA 3K4ZA 4FMKA 5C0CD 5BW7C 4JPIB 4E9LA 5JW4R 4X0KA 4P2RA 4F7PA 5E8NB 1MY5A 1QQDA 3V5KA 5F70A 4KQ4H 3F7QA 4Z7UF 3MODH 3ORJA 5D1XA 5BVJA 4HIIB 2BVTA 4G9DA 4JFXA 3JXAA 4H1LH 3LKOA 3BW9B 5GS1A 3X12A 5GZOC 1A6ZB 3RUGA 4FFVC 2FO4B 1U3JA 7FABL 5C6PB 4PV8B 1CXHA 1K6QL 1F3JA 3K4DA 5T3XE 3ECBA 4YHKH 5KZCB 1G7IB 1F4YL 4XMLL 5IEHA 4PJIF 2ATPA 1FORL 5A2LH 4P2RD 3TNNB 4LPVA 1NANH 4G8EA 4PG2A 4RA3A 1JPSL 4FFZH 5F8RC 1S5IH 3KHQA 4JE4B 3LS4H 4LCWB 5IEKB 1SEBB 5D1XD 3TPUA 3S98A 5C86A 1A3LH 1FZMB 3O3BA 1GVIA 5TJWK 3WDJA 5KG9B 2CSPA 4PJ8B 1OWWA 4OCNC 1NGWA 2LU7A 3CNKA 2AJSH 3T08A 4HIHA 3O4LB 4AL8H 3S37X 4QRRA 4OGYH 1Z5LB 3HC3L 1T1ZB 4LSTH 1UYWH 5D7SL 5K59F 3NPSB 1HSAA 1QACA 2ZSVB 3EYUL 5B4MD 4JY4B 2QEJA 4N8CL 3WFCL 2IAMC 1NKOA 2OK0H 2ADJA 3U2SA 3FQTA 4MXWL 3WKMH 5IROA 2MCG1 3CVHL 2R9HD 1ZSDB 5ILTL 2DKMA 4YH6A 4ELMB 2VABB 4LCYA 2XKNA 4QRQB 3FRPG 1IAKB 4QRRD 3NCBB 4JZJA 3SCMA 3W11C 4KJYB 3WL9B 5T5FH 4KUCF 4U1HA 3MFFB 3P9LA 4NJ9H 4TSAL 1MCOL 3VA2C 1F3DJ 1MHEA 4NZRL 1X4ZA 5E8DH 1FGVL 1H0DA 5DHVH 3OKKB 1OSZB 4I3GA 1N5AB 2YEZB 1JGUL 4PJ7A 4V1DA 2R2EB 3TF7A 1JRHI 3TGXA 2YUXA 3RIAF 4ORGB 1FNGA 3SCMD 4AG4H 4J8RB 2WP3O 4HKXA 4NQUA 4JREB 4HJ0D 5JOPE 4GQ9H 2JJTA 5IVXB 1UKSA 4Q9QL 5TH2A 5HHQB 5IB5A 1K4CA 1WBXA 2VMFA 4KMLB 3FQWB 2W9EH 5JQHC 5GRUH 4G43A 5L9DH 4IOFC 4OUOA 4D8PB 4L4TB 4PY7B 4V1DD 1U95A 1WAAA 2GJ6B 5TGBA 15C8L 2BX5A 4OQTH 4XMKL 5CSZA 3W9EB 1CF8L 1P7KB 5DI8B 3F58H 4LK4A 2XTJD 1CL7H 1IGML 5HGAA 4CUCA 1XF3B 2Y5EA 3CU1A 4LPUA 1ZK9A 4LCCB 2AEQL 4NN6B 3VFSB 4GAYA 3MRQB 1QLFA 2AJZA 5CJXA 4JJHA 1G9ML 4JPWL 4XI5C 5TE6H 1BVLA 2IPKA 1YEEL 5D7LA 5KVGL 3QHFL 5IVXE 3DTXB 3C2SA 1QVOA 4ETQB 3ME0A 1YYLL 5F1KC 4GMTH 4TUKH 2B4CL 4ZD3L 5ANME 2BCKB 4D9QE 4K7FA 3MGOB 1BFVL 3G6AB 4JGUA 3BZFA 2AV7A 3DURB 4X8XA 4FP8H 1QEWA 5AYQA 4G6KL 1KGCD 2GJ6E 4J3SA 3MJ8A 4ZQKA 4JFYA 3EAKA 4WW2A 2QR0A 2DQTL 5I1GL 3OXRA 4NN5C 1F2XK 4PG9A 5HI5D 5D7LD 4BQ6A 4ZFOA 3QIWC 1BIIA 2XZQL 3A6BL 3FFDA 2BXZA 5J1AB 4Y4HA 5CP3A 1NCCL 5GRWA 3VFNA 5F7EH 3SDDA 5BMFH 4S0UC 2VE6A 3B9KA 5JQ6H 4RAVA 2BJMH 5DEFA 1HI6A 4DVRL 3PHQA 1ZEAH 5CSBA 3DSFL 5ISZB 1QFUL 2MNUA 1N8ZA 5L8LB 4FTVB 2QQQA 3S36X 4Z7UB 3UC0H 4AT6A 1AXIB 1MIML 3BH8A 5JDJA 1H15A 4Y4HD 1YQ2A 2GIYA 4OD3H 4OFPA 2UUDH 4YEEA 1CVRA 4U1GB 3SDDD 5LJYH 3G04B 3B9KD 3LZFL 5F3HA 1FPTL 1KELL 2HMIC 2E6PA 2GY7B 1MCPL 3VXRA 3V7MA 3QZWB 2BY2A 2C4FU 1B6UA 4JZOB 4ZO8A 5HHMA 4LQFL 4X98A 4YHLH 1UCBL 4ETYA 1T0NA 4JANB 1KTKE 3AC0A 5K9JH 4Y2OA 4PJCA 1WFOA 4FNLL 2DL2A 1GZQA 4EJ1C 3GIZH 5JOEA 1BJ1J 4HG4J 3IFPB 2ED9A 4E0RB 4P57A 3VXRD 2DJSA 2NY7L 3RPIB 3RRQA 3GRWL 5EZOH 5SV4A 4R97B 3A67L 4MSWA 2NY3C 4UIMB 5HHMD 5EA0L 4PB9L 4Z7UE 3LSOB 2LV4A 1CD1A 1NBVH 4NC1E 2HRLA 1HCVA 3IXAA 4LLQA 3QBTB 2KDGA 3HE7C 3ULVL 2W9DL 5HGHA 5DJ8B 3EW3B 2I24N 1ZA6A 4W6WB 4LIQH 1IJ9A 1MRFH 1JUFB 4LASL 4AEEA 4B53A 1WC7A 4TPRH 3TZVC 4I18B 3TCLB 1OQOA 2VH5L 3LRSB 1MCDA 4PJIE 3ARDB 5KSBF 2BSSA 1IM3B 1EHNA 5KSUA 4L9LA 1F6LL 4P46C 4MWFB 4QHKI 1BD2A 2QSVA 3HMWL 2HH0H 4UILL 2CMRH 5L88L 3Q1SL 4FQQB 1CLOL 4LSUL 3TN0B 5T3ZH 1T20B 3CH8A 3RWCA 1MJ7H 2A74B 5C0BB 3SKJH 4DKEH 1KN2H 3HPJA 2B2XL 2W91A 3UZEA 5HYSB 4JKPL 4JQVA 3TEUA 4RGND 4G8IA 3VGFA 1RZJC 5EUOF 3NACL 3MLXH 1BD2D 1FCCA 2XA8H 3QXVA 5E70A 1N0XL 1EDQA 5K59E 1N4XH 5D8JH 4YDVA 1I9EA 2QV2A 1J8KA 1XGTA 4FXKB 4JDVB 4PRAB 1QBML 1OY3B 4MHHG 3JZ7A 1A8JH 4PJXF 5GRZA 1DJSA 5HY9A 4S1RL 1BF2A 5EOCL 4M43L 5I17B 2DM7A 5HPOA 4JO3L 3BKYL 3LHPL 3OQ3B 4XBGB 1PD6A 5JPNA 3H9YA 1MFEL 2R39A 4OLUL 4MVBD 4L8BA 2J7LA 2DYPA 3KPSA 2AKRA 3MRLA 2NLJB 3TIEB 1LO3L 4PJDF 3QUZA 4PJAA 1OAXH 3GNMH 1UVQA 1U8KB 4FXGA 4ZS6C 3W39A 2O5YL 4NZUH 3FN3A 3RQ3A 3C6LC 4NC1C 3PP3K 1WJ3A 4UOW0 4GLRI 4OTXL 3AS1A 4G6AC 3QQ3A 3G5XB 2FIRT 1LNUA 4R0LA 3KPSD 3RY6A 1I9IL 2Q76A 3I85A 1A1MB 5JIKA 1XF1A 1TETH 4P59H 4XVTH 3MA7B 3QUZD 5EN2A 5H35A 1M05B 1JGLL 4EVNB 1ZVHA 1CK0L 4N90E 4WU5B 4U6HA 5IB4A 2HRPH 2EYRB 4YDIL 1R24A 5E4IA 3WDIA 3VW3H 3WIFA 43CAB 3ZHLA 4P5TC 2VLRA 5EWIH 1W0VB 5I1DB 3VXNA 3K2MC 3MR9B 1KUMA 4MA1B 4PGCA 4Z7NF 4NHUE 2DQIL 3FT3B 1H5BB 12E8L 2OL3H 2XFXA 5DRWB 3RAJH 5C08A 4XCYB 2F5AL 1FH5L 1B2WH 2NY2D 2GSIB 3M8OH 3MROB 1U8PB 3LKNB 1A1OB 3HPLB 2AJXH 3RWFA 2EDLA 1TTFA 4JHAL 1ND0B 5A40E 5I15L 5B38B 4PRIA 1NC2A 5GGQH 3QH3B 2VLRD 3ZLQC 1HXMB 4HDIB 3TVMC 2H41A 1YEKL 4LGRB 3TCXA 5ADOH 1ITBB 4IS6B 3DBXA 3T8XB 4I18C 2JELL 3RL2B 4QXGH 1FAKT 4HUMB 1NFDF 2EYSA 2P5WB 3K1DA 2W0FA 3RDTA 5C08D 2FHBA 5DUPL 2VITB 4I3SH 1EO8H 3MJ9L 3WS3A 4FFYH 1IKNA 2NNAA 5B39B 5EO9B 3L1OH 4JQIL 4M7LH 3UPAA 3PABB 4PRID 1NC2D 3TN0C 3IDUA 5B3NA 5IV2A 1J5OH 4R7NB 4YNYB 4JAMB 4QCIB 5HGDB 2P24B 4X99A 2HFEA 4NWTH 2H8PA 3BMVA 3VXQB 4DUVA 2X70A 2PKDA 4ZNEE 1ZLWK 2RR3A 5J06A 3BQUC 2X4PB 3WJJA 2MPAL 2AJYH 2J8OA 2JJWA 3OWEA 4XGZA 1IE5A 3CH1B 3ILPB 5IK3A 3ARWA 1U2HA 1Q1JL 4MA7H 2YA2A 3MNVB 1ACYL 1VEMA 3C09B 1F4XH 3C5ZD 1BZ9B 5DVLA 2V2TA 2ZUYA 3QRFM 1JL8A 4N9GB 1KG0A 5DHVA 35C8H 3FO9B 3S5LB 4KK9C 5DJCB 4PJFF 1SBBA 2FDBP 5IR1A 4JFDE 4PYHA 5DHYA 3STZB 2IPUG 1DN0A 2FX9H 2VKXA 5E1AB 2MKLC 5DK2A 4MJ6B 1ZV5A 2RHEA 4UT7H 5J6HA 3QIUA 3PDOA 1HE7A 4FFZL 1B0RA 1S5IL 1X5LA 3TO2B 5L2KB 3LS4L 1FL5B 1I3GH 2QQNH 5C8JA 4JCMA 1ORQB 4PJ9A 1KFAH 4C59B 5M95B 2KPNA 4XP6H 1NMCB 5IVNA 4J6RL 1QSVA 5DJXB 2ARJQ 4HWBA 4P5MB 1DQLH 4HZLA 2AGJL 5T1LA 2FGWL 4HT1H 5E2VH 3NCMA 4AL8L 3PUCA 4P4RB 5IUSA 3QIUD 4LSTL 4KRLB 2OCFD 2AXGA 1BLNA 3BSZH 1KLFA 5DK3A 4LVOC 5DD1H 4PJ9D 1TDQA 3UYRH 4IDJL 3N06B 4Y16A 2OK0L 4OZIB 5MHSE 1ZGLB 4QRPD 4IOIA 2Z8WC 3ZL4H 3JWOL 4PJXB 3VFOA 5KSBE 4UT6H 5D70H 1NEZB 5KVFH 1FNHA 4E42A 2CO7B 2PXYC 5T1LD 2BERA 5GRVK 5L2KE 1I8MB 1F2QA 5T5FL 2DAVA 4APQC 5E2UL 3GBMH 1B3JA 4NJ9L 4X9BA 1GC1C 2XRAL 3WUWG 4LSVH 5B21A 4EQ3A 1HHJB 4TNWK 5I8EB 2X05A 1AIFA 4Y16D 4NQSA 2V5TA 3SGKA 3WN5B 5E8DL 3IDJA 4GUPB 4N8VA 3VA6A 2R2BB 5J1SC 5EUOE 1BP3B 4PJEF 4F3FB 1NGPH 1HEZA 1HZHL 4H88H 4JRXB 1S7WB 5TFSH 3WV0A 1DVFC 3CDGB 1BOYA 3K1KC 4F33B 1X5IA 5GGVH 4HEME 4CVZA 4GQ9L 3FQXA 3S9DB 2OXGA 1G0XA 1S7SB 3D25B 3IDGA 1YMHB 3OKEB 4PJXE 5FGBA 2W9EL 5GRUL 1N3NB 4M02A 1PY9A 5L9DL 5B8CB 3ISWA 4IJ3B 1OQXA 5D7IF 5CJ5A 1GGIH 2XZAH 2WINB 3KNBA 1P6AB 4OQTL 4Z6AT 2RJMA 2D9CA 3KPPA 1U8OA 2DKSA 1ODAA 4NRYB 4PJDE 3RIFF 1MJ8H 4UDUB 2XT1B 4E41E 2FEDC 1CL7L 5IM7A 4D0BB 3DHJA 5CIPH 1PG7W 1ZHKB 1NDGA 3L3IB 4Y4FB 4DKAA 1EZVX 4K71C 4PUBH 4X5XB 4YLQT 2A83B 4WV1C 1CL7I 4JRXE 4P3DA 3ARGC 4NRZA 5M94B 1NCDH 4OGXH 4U6VL 5I66A 4I2XB 5TE6L 2CO6B 1F4WL 4CU6A 4OM1H 3KPMB 3CVIH 2NX5E 1ZGLP 1CLZH 4NCC1 4H5SB 3VXUB 1NFDB 1AQDB 3H3PH 4GMTL 4YHOH 2GW5A 4QNPF 2DM2A 3T1FB 2BSED 3FB5A 4GKNA 2W92A 3QR2A 1G84A 2VDPH 4HIEA 4FP8L 1NAKL 3CPLB 4RBPH 2EE9A 3K8KA 4KI5F 5IQ7H 2V9RA 2J5LB 5AUMA 3GSNH 4Z7NE 5IMMA 1PVHA 4BK5A 3HMXL 4TSCL 2BNRB 1TLKA 4K8RD 4X6BB 5IB2A 1JYXA 3VFWB 3MV9B 4LSPH 1KTDB 4BZ2H 2PYEE 3E2HC 3MRKB 2W65A 4LVEA 3BEWB 4WI3A 2UWEF 5EIQA 5F7EL 5HI4D 3RVTD 5BMFL 1BJMA 5JQ6L 1I8KB 3PWLB 1HYRC 2BJML 5IHLB 3O4OB 3V6ZA 5T33H 3IDNB 3CIQA 1J0ZA 4F58H 4WVRA 2D9QB 4Z78B 1N6QH 1FFOA 4KKAD 1KSRA 2J3SA 2JJSC 3CFJB 5IJKA 4RMRA 4Z7WB 1NFDE 4QXUH 5JLZB 3E6HA 2VISB 4LLYA 2VLJE 5CEZE 1KBGH 4PJFB 2Q86B 4EN3A 3BEVB 3RL1A 1I7ZB 1YY9D 2MTPA 4WHCA 2GITB 4YBLB 3MLWH 4EQ2A 3X3FH 3EGSA 1U8QB 1UM6H 1G6VK 4ZYKB 4HBQA 3TO4A 3K7UA 4KXZH 4HHAB 4PGZA 4H8WC 4YHLL 3C08L 3NZHH 3RWIA 4X4YB 2WIIA 4GRWB 1T6WA 5FF6B 3WSQH 4LHUA 3C5JA 4U6YB 2WV3A 1OB1A 4R4FL 4EN3D 1HK6A 4UQ3B 1BFSA 1QTYT 3BYTA 3IAQA 2PYFB 4HGWA 4QLRA 2R1XB 1F00I 2MSPA 4WU7A 3TO4D 3JV6A 3QDJB 1NBVL 1YUHB 1AGFA 1R0AH 3F12B 5EZJB 5F89B 3KWWB 5E99H 1CTNA 2MJWA 4LIQL 4LHUD 4IJ3C 2VC2H 4RNRA 3L5WA 2YPVH 4HMCA 4PREB 1YDPA 3SDCB 1MQ8A 2BOCB 4NQCA 5IOPA 2LU3A 4HIXL 5C0IA 4R2GC 4BYHA 3O8XB 5FDWB 1F5WA 4OCWL 3SO5A 1ZA3B 1NCTA 2HH0L 1EO7A 4XC1H 2CMRL 5CGMA 4X4XB 1DLHA 3EDKA 2XPGB 4B5EA 5T3ZL 3LMJH 1OP3H 1MJ7L 1P2CB 1I1YA 3SKJL 3FTGB 1KN2L 3HG1E 1P84K 4OF6A 4UOW1 3BWUC 43C9A 4HF5H 3MOAL 4M7ZB 5EZIH 3BIBX 2EDBA 4K3EL 1YPZE 3DO7A 2EIZA 4YAQB 4PJEB 4NQCD 1S7TB 1Q9WB 5KW9H 2P8MA 4NN7B 5FXCH 4LP5A 4PJ5D 2OL3A 1BBJB 5I74C 4RFEA 1N4XL 5D8JL 5I1EL 2IH3B 5IBLD 3DX8A 3AVEA 1JCKA 3B5TA 2OP4H 4H25B 4NNXA 3V5HA 1KPRB 3FOLB 3VXMA 2VERN 4R7DB 3JTTB 2A38A 2N7BA 4FA8A 1IRAY 4RFNC 1DUZA 4Z7VF 1A3RL 1Y6MR 3DMMB 2ICWB 3AAZB 1VGKB 4OV5A 4OZFA 2AQ2A 4H20H 2O5ZH 4WJ5B 1WEJH 3KPLA 3O4OC 4X6FB 5ICZA 4PJEE 1FNEA 3W0WD 4NZUL 3VXMD 5GZND 1RK1B 1CE6A 5ESQA 3AS0A 3MJ7B 2XKUA 4ENED 5FEBA 4M48L 1ZWIA 1YYMH 1HXYB 4P2QA 3MRIA 3R0NA 4G8GE 4D0CB 1EXUB 3N85L 2R0ZH 5C9KA 3WUZA 1T1WB 3FQNB 1TETL 4P59L 4XVTL 3N1FC 5JIPA 5J9PA 3REVB 4P2OA 5A16B 3K4AA 5D7IE 3THMH 4KRPB 2HRPL 2XY1A 3FN9A 3VW3L 3FHAA 5L8JB 1WV7T 3H3KA 2E8YA 3MRRA 4P2QD 1RIHL 4PP2A 5EWIL 1KXVC 4HS3A 4ALAH 1HH9B 5F1IB 4FQJL 1IC1A 4IIQB 4RDQF 1ZVSB 4Q0XH 4P9HC 5EBLA 5DTFA 2EIEA 2Q3ZA 4U33A 4MCZA 4HGKC 3GMPA 2MQCA 4KK5D 4P2CG 3RAJL 4P2OD 2UY7A 2A6DA 3EDFA 3M8OL 4RRPG 3X14B 2BSRB 4ODSH 2AJXL 4L4JA 1BVKA 2P8PA 2V5MA 1BHGA 4O5LH 4N0UB 4Y5XA 1QRNB 4UV4H 5GGQL 4QWWD 2ADGA 4UBDD 4PV9A 1ORSB 4ZFGH 1XEDA 4N1EA 3CFEA 5ADOL 4G6JL 3FFCB 5EBGA 1CZ8H 5TQ2H 4QNPE 2XWBB 4HK0A 1F8TH 5KANG 3WLWD 3L7EA 5DJDB 1D5MB 3G5ZB 4I3SL 1EO8L 4FFYL 3TH2T 3SDAB 5I1CH 1ZHBB 3L1OL 4JFPB 4FZEL 1BEYL 1I8LA 2NY5C 1J5OL 2FL5A 4A2MA 4W68A 1XGQA 1DANT 4NWTL 3GBLA 4MAYC 1JZ5A 5HBBA 1R3HA 3WHXA 3C60B 3DRTB 4TTDC 2UWEE 2AJYL 3DVFA 4P23C 3QZWG 5C0NC 5E0QA 3RNQA 2GTWA 1QRNE 4MA7L 5TPWH 2QADD 5FYKE 5DJ2B 4L9DA 3FFCE 1JPGA 1F4XL 5D1QB 2VDNH 1KLUB 35C8L 4EI6A 1U9KA 2MMXA 2VIRB 3VG9B 3NTCH 3VFMB 4BZ1L 3BP6B 4FN0A 4GRLA 1KJVA 4GRMA 4DTGH 3OX8B 4Y2DC 5H37H 1ZHNB 4AZ8A 2A0LC 5DVKA 1OW0A 4UT7L 4DOHB 5JDSA 2NY4D 3CLEL 2FJFA 3ARBC 4ONHA 1TJHH 1J1XL 3JVGC 1I3GL 2QQNL 4M1CC 3Q3GA 1XF2B 5FA4A 5AZEL 3BPNC 4U4BA 3Q6GH 3C8KB 5FOBA 4MJIA 5J3HD 4Q9CA 4GRLD 5FECB 3MRNB 1XIWB 1WFNA 3QXWA 4F8QA 5LGHH 4CMMA 1E6JH 1DQLL 4PDCE 1U92B 1OD7A 1FJ1B 1P1ZA 1SMAA 4HT1L 4W6YB 5E2VL 1KLGA 4BZYA 3HZKB 2EZ0D 3QIBB 5HYEA 2XIDA 1IM9B 2PW1B 1KXTB 3BSZL 4GJTB 1K3IA 3MUHL 4BH7B 5DD1L 1EA9C 3UYRL 4KRPC 2OYPA 4PRBA 4WTWA 5D1ZC 4MJID 5CWSB 3OKOB 1FP5A 1Q9KA 4UT6L 3BH9B 2AAVA 5D70L 1WITA 3ZKQD 3GGWB 4DOHE 3QRGH 5L8KB 4BFEA 1TQCB 3TBTB 2HKHH 3CVHB 4KRMB 5DJZB 4Z8FL 2YBRB 3K8LA 1UZ8B 3L7FB 5HHOE 3V2AR 3FQUB 3QUYC 3MNWB 3QUML 4LSVL 2IBZX 2VXSH 4RSVA 5IMLB 1D9KC 1OAUH 3LPGA 4OI7A 4ONOA 3B9DA 2EXWC 1UFUA 3STLA 1FVEA 4PR5A 4DW2L 4XNXH 2HJKA 5CMAA 3OAZH 1JJUA 1DCLA 3V5KB 3ZKXC 1NGPL 5FGCE 4H88L 5BVJB 1A6UH 1NAML 3BP7B 4JFXB 3QI9B 1WBZB 2OZ4A 1NDMB 1FN4A 1NGXA 3EOYG 3ZHDA 2EDOA 5ESAA 4P5KB 5GGVL 3KDMA 4LDEB 5E24E 1JWMB 4G9FB 4P49A 2M26A 4D9RE 4MCYB 3MREB 4X6DB 2NW3B 4XP4H 3LPWA 3UTTB 2BVPB 1HHIB 4WHTB 3EJYC 5F9JB 4Z7VE 4OF7A 1QD0A 3B5GA 5BRZE 4I4WB 4F2MA 3D39E 3U1SL 1A6PA 1MCBA 1I7RB 4NBZB 3D0LA 4A2LA 1MJ8L 1OPGH 1R3JA 3WYRA 1JZ8A 4NQVB 3PV7A 4JFOA 3OXSA 1LO5A 3FZUC 4PUBL 4QHLA 3VJ6A 2XA3A 1MI5B 4XHQA 4OGXL 1FZOB 5ICYA 1QSEA 5DDHA 4OM1L 5TE7H 1AHWB 3KXFB 4XXCC 1X4YA 5T3XH 3CVIL 4HKZA 2X1WL 4G9FE 4LMQE 2Q7YB 5IBUB 3H3PL 4YHOL 3VFRB 4POZD 1T1XA 4KGLA 2EYTB 4NO0A 2GK0B 2VDPL 2XXCB 1RUPH 2AV1A 1YEHH 3PL6A 3BGMB 5IQ7L 1LO4L 3AU1A 3P9LB 1R5IA 1JHLL 2H32A 5DJ6B 2DTMH 1INDH 1QSED 3GSNL 5HJ3B 4QYOB 4KDTC 1SY6H 1XIWC 4LSPL 1GL4B 4ZAKC 4BZ2L 3TESA 3RX5A 2Y07L 3OR6A 5DR5H 2CLVB 2PW2A 4NO0D 2Z8SA 4JZNB 4D3CL 5J8OA 1OF2B 2XWTA 1G7QA 5MENA 1MHPH 2BHZA 2DLHA 3LRGA 4GKZB 1BOGB 2Z4QA 1JK8B 3PL6D 3ZO0A 1AP2B 3IDMA 5IMOB 1I1AA 4RA0C 3OKMA 2OJEA 4XNUH 1HQ4A 2BXYA 4F58L 4I0CC 5T33L 3KXFE 2PO6A 4JDZB 2DLGA 1VACB 1MLCA 4XCNB 4QHNA 4QXUL 5D2LF 1TZIA 3PGCA 3S96A 1KBGL 5K33A 1MCQA 4DWHA 5IMKB 5MEND 4XAKD 4RZCB 3MLWL 3RWHA 3CFBB 1MFAH 1UM6L 3L5HA 4OF8A 3P4NB 1QSFE 1I1AD 5HDLA 2I5YH 3JWNC 4NQDA 5F7HA 1JFQL 5E5MA 3G9VA 2PO6D 3SE4C 4Y8DC 1FSKC 4M6AA 1KJ3H 3NZHL 3QA3A 2X7LB 2V7HA 3CFIC 2F74A 3GMLB 2X4NB 3E6FB 5I1KL 1E4JA 1B0GB 2F53E 3WSQL 4YR6B 4KXZI 1KIPA 2HVKB 3OG4B 1QBLH 3QP3A 1IT9H 1JWUA 4BK4A 4C56E 4I5BA 2EDRA 1JF5A 5BJTA 3O2DA 4HG4K 2RCSH 4WO4B 3NPZB 1BVLB 1F3RB 4O2EA 3VXSB 2HTLC 4OQ1A 3V7AE 2BC4A 3MV8A 3QDHA 3NH7H 5DLMH 4BUGA 4NQDD 4JRYE 3HC4H 4PRPA 3DX9A 1L0XA 2A73B 4YXLH 3NN8A 3WIHA 4Y4KB 4Q7DA 2HJLB 3RWDB 5E99L 5F6HJ 1TITA 3QNXB 2VC2L 2FBOJ 1H3PL 3BXNA 1EFXB 3GJEA 3GHBL 5TDPB 2YPVL 4ZXBB 2VL4A 2YD7A 2ITDA 3AMKA 5ACZA 5SX5H 3G6JB 2APFA 4HC1H 3FHQA 2R8SH 4KJPD 4GG8B 3H7LA 3MV8D 3AREC 3BE1L 3L3KB 2BVQB 4U1KB 4PRPD 1K8DA 2AK4A 2HWZH 2P42B 1U8HA 3VE0B 4XC1L 4CJ1A 4JGJA 5F88A 2DMCA 5AAWA 1S7UB 1F6AB 3LMJL 3QG6B 5IQ9A 4G3YH 3RGVA 1W0WA 2AABH 3FT4A 3BPOB 5C0JB 5DEFB 2D0GA 4HF5L 1NEZG 4LRIA 4WENB 5EOTA 4GG6F 4XRCA 3QUXB 3VXSE 3QFJD 1RJYB 3OMZA 1U8MB 1UXSB 3BH8B 2A77L 1RK0A 2AK4D 5IWLC 3ULSB 4PRNA 4XP1H 4LEOB 1BIHA 3IJYA 1AD9A 5MEPA 2OP4L 4FQLH 4HFWB 1H8NA 3K0WA 4F9PA 5A3IC 4X98B 3LQZA 3L5JA 4NC0B 4NKDA 1NGZB 2J8UF 3TA3C 4BSWB 4PJCB 5DURB 4N5UA 3FRUA 2DN7A 3GMRA 5JOFA 2YUZA 5E2JA 4LSRH 1A47A 3LKSB 1LK2B 2I60H 6FABL 3ULUF 1MELA 2X6MA 1WEJL 3L6FA 5DQDL 3ARVA 1RZJH 3QNZA 1RSFA 3CD4A 3CCHA 4OLYH 3V52H 2IFFH 4ORZC 5HGGS 2IGFH 3NZ8B 2B0SH 2Y7QA 1DDHB 3ES6B 3FB8B 2CDGA 3I3BA 2HP4A 4AEHH 5GGUA 4LLMA 1XCTA 5E8PB 1UQSB 4I0PC 3CX5J 1UGNA 2P7TA 2ZPKH 1U58A 2OI9B 4HUXA 3NFNA 5FYJD 4JG1H 3V5DA 1IKFH 5H94A 4N0CA 1UB6A 1CICA 3D18B 4FFWC 3GK8H 1P9MC 4D94A 4ALAL 1A2YA 4F15C 3DX7A 4Q0XL 2DQEH 1XZ0A 1LEIB 1F4HA 2CKBH 3B2UC 1AKJA 4G8IB 4TNWF 4HV8B 5JHDA 1I3RB 2AEWA 2LAGB 5JO5B 1NEUA 4ODSL 3HLAA 4Q2ZB 2OR7A 4N0CD 4YDVB 3GBNH 4UV4L 1KIQB 4HUKB 4C83B 3SKOB 1DBBL 5F9OL 1S9WA 4HS6A 4J2XA 4ZFGL 4X80H 1HILB 1P4LA 3BUTA 5C1MB 2NW2B 1DQQA 4QRSA 1EERB 5FKAA 5D2LB 1AKJD 5FO7A 5JHDD 3WUWA 1SEQL 1EZVY 5CS7A 3RKDD 2WM0A 1OTSD 4LVHB 1FZJB 5I1CL 4RAUA 4L8BB 3U30B 4KHTL 2DYPB 2AKRB 4MDJB 3HKFA 4PLKC 1CI5A 3L9RA 2IQAB 1A21A 5FO8B 5D7JC 2FIKA 4YO0B 5EIIA 5HVGB 5GS3A 4WFGD 5F1OB 4NZTH 3HE6C 3BRFA 1SM3L 2ICEA 3H7BB 4KMQA 1CXEA 4F7TB 3EFFA 5GGSB 3V6OA 3EYVA 3QUKB 4JM2D 2ARWA 3EYSH 4PY8I 4AMKH 2BNUA 4FFVD 5TPWL 2DBJA 4MD4B 2A6IB 4JFQB 4WFEE 5KS9A 1RMFL 2FEEL 4IEFB 3IGAA 3SO3B 3FQRA 4XNMA 3O3AB 3V4PH 1KIRB 1NUNB 1TVDA 3PWNA 5D2LE 1CBVH 5F1SA 5KTEH 1E4WH 1ZAGA 3O9WD 3SGJC 4QRTB 5IKCA 5EU4B 2NXYB 5DRZB 4E5XA 5BQ7B 4DTGL 3MYJB 4H1LB 4K2UH 2JB5L 5INDA 4XH2A 3IDYC 3SE8L 3VXNB 1J1OH 4PGCB 4AM0B 4S11A 1W0YT 3VXTA 1D5IH 4HUUA 1RHFA 5CJOH 1F58H 2Z0BA 4OZHA 1RU9L 2NMSA 4NRXA 3Q2CA 5E2TL 1IAIL 4OUUA 2XTLA 2Q1EA 5HSFA 4ZO9A 4OZ4A 1I1FB 3QDAA 3QYCA 3V9FA 4QXTB 5E6IC 3Q6GL 2OBGA 4WIQA 1YN6B 3CFCH 5C0GB 3EYQC 5F7DA 1LEGA 4MNQE 5J11C 3BOVA 1E6JL 3MXVL 4JFEB 1JYWA 5IW6B 3LPFA 4GKOA 1M7DA 2ZUTA 1C5BH 1X5YA 1TIUA 2SEBB 1YNTA 4YEFA 1IBGL 2EDXA 5D7KE 1WIPA 1L7TH 4OAWA 3RDTB 1KACB 2OI9C 5FB8A 3R8BB 4Y88A 3TJEH 1JYVA 3W11D 4Z0XA 3P0VL 1ZHLA 3BT2L 4DJMA 3SJVE 3GB7B 2UYLB 4WFFE 2HKHL 2FJGB 2FGZA 2I9LB 2DIAA 1BREA 1D3CA 2QQLL 5CD3B 1H3GA 5DD6B 1XR9B 4I1NB 2AJVH 4X7TA 2VXSL 3MLPA 5CD5D 1OAUL 2AQ1A 2IANB 4YDJA 4KKCD 2FD6H 1OTTD 4GG6E 3CMGA 5BO1H 4JRWA 4XNXL 1VFBB 1QOKA 2F58H 2Q6WB 1KYOJ 1AGCA 4IOSD 4JFEE 4G80A 5T3XD 3QEQA 2AXJA 3GZKA 4JPIA 1A6UL 4GS7C 5E8NA 2EIDA 4TN9A 4HIIA 3WLBB 5IR1B 1MOEA 1FZKB 4LVHC 4MYWB 3BW9A 2FATL 5LCVH 3RVVC 1SJVA 1IMHC 1A6ZA 2PTUA 2FO4A 4NIKB 2N7AA 3PDGA 5DK2B 3U48A 4PV8A 5IW1B 1G7IA 3GSXB 2J8UE 3INUL 2WUBH 3QEQD 4U1SB 5IB1A 2NYYD 1BM3H 3ZYJA 4X4MA 3CC5B 3TNNA 1FE8H 1A4KB 1GC1H 5EZLA 3R1GH 1SEBA 3ELAT 4NKIH 4OLZL 5IEKA 3WO4B 3ULUE 3QQ9C 3JV4B 4XI5D 2IANE 5I75B 1FZMA 4UNVA 3LEXB 2YPLE 3ZE1F 3R06B 3SY0A 4F7EB 5KZCD 4PJ8A 3PWVB 4DGYH 3SO3C 2XWJB 4XB8A 1NL0H 4WFHE 3O4LA 2N4IA 1Q9OB 2QBWA 4HWEH 1Z5LA 1T1ZA 5TE7L 4LCWD 3NFSH 5EU6E 4XWOD 2ZSVA 3VFOB 4JY4A 1Z9MA 4QGTA 1TPXB 2DMBA 3HNSH 3EO9H 5DVMA 1RJLB 5IF0B 1JTPA 4PJ8D 1UEMA 1ZSDA 1T03L 1YEHL 5KSAC 5IVZB 3BD3A 1EHXA 4ELMA 2VABA 1MCFA 4QRQA 3O4LD 1Z2KA 3P40A 1IAKA 5JZ7C 5I1LB 5GSRB 3WL9A 4KJYA 1INDL 5E7BA 4DQOL 2D7PA 3MFFA 2QSQA 1ES0B 1SY6L 4MJ5B 3WJLC 4KJWD 2AQ3A 1JBJA 5DR5L 2Z93B 3MBEC 4FQHB 1AR1D 4HX1B 3OKKA 1MHPL 1OSZA 3W5MA 1N5AA 2YEZA 3RPKA 4KAQH 3ZE2F 1DSFL 3MBXH 2R2EA 3F7VB 5C6WH 2XYCA 2OTWB 4ORGA 1MCLA 4J8RA 4BFGA 5CJ8A 2I07B 2EDNA 5IVXA 4OD1H 2NZ9D 4GMSH 2IFGA 5BS0B 5IBTH 1JHTB 3JWDC 5LKNA 5ANMA 1MFBL 3V4VL 1T83C 3BIAX 4D8PA 4L4TA 4PY7A 4KKBC 2GJ6A 1J18A 2JCCF 1KIUA 4UAOB 5J13B 3ULUC 5EULV 3W9EA 5C6TH 4XNZB 1P7KA 5DI8A 4P46A 4CVWA 4NJAH 1N2RB 5CZVH 3P73B 4TOYH 1UH4A 1QBLL 1XF3A 4KKLD 1IT9L 2Y5TB 2AXHA 1M7XA 3N0PB 4LCCA 4EXKA 3TWCH 3VFSA 3FAXA 1W72L 2RCSL 3MRQA 2G2RB 3UTPD 4QRUB 4HPOH 3U7WL 4L4TD 1U42A 1NFKA 2GJ6D 3NH7L 5DLML 3UP1A 1EHAA 3QHTC 2BFVL 1KTRL 3BJ91 4JHWH 3UBXB 4MAUL 4KROB 3FB5B 3DTXA 1CYGA 1LVEA 1NCWL 4ETQA 1E4KC 4HIEB 4X6CF 5IJVB 3CFDB 3UTSB 2BCKA 4JPVL 1J1PH 3MGOA 3G6AA 2F54B 3VFVB 4U0RB 4ZUUB 3DURA 1TZHB 1MUJB 1YNKL 3QB7C 3HRZB 5J56B 3KJ4C 1T4KB 3LEVH 5FKPB 4MX7A 4H8WH 4HC1L 4XWGH 2R8SL 4RRPA 3B9AA 3LB6D 5I0ZA 4EBQH 4KMTL 3MFGB 4M1GL 4PLJD 3X13B 1R5WB 3OAYK 2BNQE 5J1AA 4G3YL 2XG5A 1TXKA 2AABL 2CXGA 3H42H 1V05A 3V6ZB 1X6NA 3MCLL 1Z9SA 1O7SA 4JY5H 4RGOH 3T2OA 1FFOB 3W9DB 4X5LA 2DDQH 3MLTB 2WK2A 3SKMB 2LU4A 5ISZA 2R2CA 2CKBA 1UJ3C 4NBYB 4U6XB 4EI5B 5KJRH 4W81A 4FTVA 2Y6SD 1TPXC 4Z7UA 3FB7B 4PD4J 2FBJL 1BAFL 2DQHH 3B9EA 3KG5A 1JNHB 4FQXC 4YE4H 3EGSB 4FQLL 4R9HA 5CBEB 3TBVB 3TLRA 3G04A 3H9SB 4JKKA 2PN5A 3QZWA 4ZPTB 4KRNA 3RWIB 5ISZD 5IESH 5F7KC 1UA6H 4JZOA 1LMKA 4FTVD 3WNOA 3VMOA 4B41A 4JANA 4ZUSB 4LSRL 4Z18A 4EDWL 4Q9RH 2RGSA 4P5TA 2I60L 3GFUA 1CD8A 5SWZE 3C6SB 4U1LB 2VL5B 3IFPA 1RZJL 2EE2A 4PP1D 2D7MA 4E0RA 5DYOB 5HHPB 3RPIA 5I9QB 3CSGA 1FNSH 4OLYL 3V52L 2IFFL 1FL6B 5FUZH 4CVUA 2IGFL 1U6AL 5CEZH 3LSOA 3A6CH 4RDQG 3QG7H 4AEHL 1T2QH 1CXLA 2ZCHL 3MXWL 5DJ8A 5JXEC 3VDCA 1E6OH 1CFBA 1A6TB 3EO0B 3TVMA 1G7JB 2BK8A 1JUFA 2ZPKL 3F6IA 3H9SE 5C09E 4I18A 4PGBB 3E8UH 3TCLA 3L5IA 2E6JA 3LRSA 3ARDA 4LPYA 3I6KB 2EEBA 4JVWA 4RISL 1IKFL 1IM3A 3SPVB 3S88H 1N7ML 3NCYP 3NCYS 4MS8C 4MWFA 5JW4N 3GK8L 1MNUH 5IFAH 1PY4A 2XY2A 4FQQA 4JHBA 3EJZC 3TN0A 3TV3L 1T20A 3T0AA 5KANI 2CKBL 1NLDL 2A74A 5C0BA 1PKQB 3NGBB 3ZE1E 5DMGD 1G1CA 4PJGF 1A0QH 3U79A 1A9BB 3ARDD 4RFEB 4HJGB 4RMQA 5LVEA 1X7QB 3GBNL 1IGYB 2ZP0T 4YHZL 2ERJC 4YHYB 3P4OB 1DQDL 2R56L 1MREH 1LDSA 4PBWD 3TN0D 4U0RC 5C0BD 4FXKA 4JDVA 3MX0A 3S3PA 4PRAA 5CZXC 4M6MH 4L5FL 4KZEH 3Q5YA 3RUGF 1KOAA 1IGIL 1HNGA 1YEIL 2EDJA 1DFBL 4RGMC 3V7AG 5I17A 1T21B 2E5EA 5F3BB 1J8HB 4XBGA 4HCRH 3W5NA 2CPCA 5E9DB 4P9HH 2CK2A 4KDWA 1CXFA 2VUOA 3W2DH 2NLJA 3TIEA 4NHUA 1MHCA 2AVGA 3F62A 4KTEH 2NCMA 4KPHH 1KCRL 4NZTL 1VFAB 4XPAH 2ZUVA 5FYLL 3WBDA 1NLBH 5BCAA 4RFOL 1U8KA 1FGNH 3ZE2E 4ODUB 3K2UH 5HVFB 4N90D 4W4OC 4MQTB 5GQBA 3WFEH 4NO3B 3EYSL 4AMKL 2FZ3B 4YHNB 3EHBC 3G5XA 1NBQA 4NNPH 3V4PL 5JPMA 1GJIA 4LU5L 5A43C 1CBVL 2EC9T 1A1MA 5KTEL 4X6CB 2EDFA 5C0FB 3MA7A 4U1MB 4CMHB 1M05A 3DXAE 1OSPH 2JF1A 3MRGB 1WT5C 4EVNA 4WU5A 4D2NA 2JCCE 1J1OL 2EYRA 4S1SH 4EIZC 1EFQA 2EDQA 4D9LH 1YEDB 5I1DA 1F58L 1Y6KR 3MR9A 4OJFL 5LAXB 3O2VL 2PXYA 1R5VB 4OT1H 3FT3A 5HYQB 4L1HA 1H5BA 4ZNEA 1BVKB 1MY7A 5DRWA 5T1MB 3CFCL 4XCYA 1Z0MA 2H1PL 1IC5H 2GSIA 2B39A 1U8PA 3LKNA 3LS5L 1L9NA 1A1OA 3MROA 3HPLA 3QPQC 3GEWB 3S4SB 3WEXA 1ND0A 2NQCA 5B38A 4NUJB 3QH3A 4PJ7F 1HXMA 4HDIA 3ZSTA 3MRCA 3WNMA 4IS6A 4X6CE 3T8XA 3MMEB 4YIQB 3NOIA 3RL2A 1JYNA 3TJEL 4L8SB 4U3HA 3B4NA 2P5WA 4W70A 1HWGB 5MP6H 2VITA 2NY1B 1PQZB 1CGTA 1I85A 3J7HA 4BQ8A 5B39A 5EO9A 2FX8H 4R7NA 4YNYA 4JAMA 3RWJB 4QCIA 2P24A 3H6JA 3LEYL 3NGBC 3VXQA 1LO0L 2DQUH 2HT4C 2CGRL 5EORH 4OI9A 1IEHA 1HN1A 2AJVL 4LGSB 1CT8B 1OGAB 4HBCL 5DVNA 2X4PA 2P5WD 4OFIA 2GTWB 2FD6L 2Y4SA 2A6JB 5BO1L 4OCYH 3ILPA 4YHYC 2F58L 2P46B 1L8JA 4LFHG 3MNVA 5DO2D 4FG6C 1ROWA 4J3WA 3C9NB 4JR9H 1BZ9A 4WW1B 2HT3D 3ARXA 1NAMB 4N9GA 3OAUH 2P5EE 1GCFA 1KJVB 3FO9A 5D5MB 1ZLUK 3TJHC 3S5LA 5LCVL 3BPCB 5DJCA 2F19L 3STZA 4ESKA 4UNUA 5H2BB 1NJ9B 3U7YH 5E1AA 2P1YA 4MJ6A 4MNGE 5FA4B 4KK8C 5ITBH 1GC1L 1KNOB 4NNYB 3TO2A 5L2KA 1FL5A 3R1GL 3U36B 4NKIL 3U7AA 1OGAE 1ORQA 1L7IH 5CGYC 4YX2L 5LWYH 4JO4H 4I77H 1XT5A 4P3CH 3SBWC 5FYKH 4PJGB 1CDIA 3V95A 4X5WB 1CWVA 4UQ2A 2YA0A 5DJXA 3PXJA 5DZLA 4KVNH 2GTZA 5MHSD 5DJ0A 1U3HC 3QNYB 4OB5H 4P5MA 5DRXB 4K3JH 4AQOA 1FYTB 5CIPB 3ZTNH 1M6OB 1NL0L 2W38A 1F90H 4P4RA 1VPOH 4HWEL 1YMMB 3UO1H 3TT1H 1AO7E 3DECA 4CMHC 1ONQB 5L2KD 3NFSL 1A22B 5JORB 4YPGB 3DOSA 4JM4H 2G75B 1R3KA 3VDAA 3IF1B 4NWUH 3EO9L 4OZIA 4UINL 1ZGLA 2WWMC 2UZIH 4PJXA 5HXMA 4OSUL 5AYUH 3O6MH 4GW4B 1NEZA 3D0VB 2VN4A 3QAZC 1SJHB 1RUAL 5JNYB 2NY0B 1I8MA 3Q48A 2FCBA 2AK1H 3LKRB 4KTYA 4WWKB 1DQML 3STLB 2D7OA 3GSNB 4PJGE 4PJDA 1HHJA 4XCCH 5I8EA 3RZCB 3WCYA 4NFCA 2Z31B 3WN5A 1I4FB 4F37K 3MRMB 3TPKA 4GUPA 3UZQA 4WWID 2R2BA 5LGJB 4F3FA 3BN9C 4NZDA 2YZ8A 4JRXA 3SOBL 1S7WA 5GRXG 3CDGA 3HTLX 4P2RE 5JIHA 4IRJB 4MD5A 2JLLA 4F33A 3O3EB 4XPFH 7FABH 2NY1C 5CEXB 2VZ1A 3OJ2C 1S7SA 3D25A 5IBTL 3AB0B 3OKEA 4NCC2 1N59B 3S7GA 4XMLH 3RUGE 4NO5B 1N3NA 4JFHD 5B8CA 4XNYL 1E0OB 1JPSH 3WD5L 5D6CB 3WXVH 3JUZA 4JRXD 2WINA 2PCPB 3T77B 4TUOB 2DWDB 4FOMA 5C6TL 1CGUA 4NRYA 3TPUE 4UDUA 3EDDA 4J3UA 2E9BA 4NJAL 3LCYA 5CZVL 1HKLL 4TOYL 4D0BA 3P9WB 5FO9B 2ATKB 4PTUB 5DRNA 1ZHKA 3L3IA 2APWA 4L8DB 4Y4FA 2WBJC 4LPCA 2J12B 4X5XA 4Y1AB 2A83A 4LPXA 5DVOA 1CXKA 2WUCL 1VADB 1OLZA 1QA9B 3HC3H 5DDHB 1MLBB 1RUQH 1KB5H 3MUGB 4HKZB 4GXUN 4I2XA 1T04B 5J7CC 4OCLC 4H26B 4RIRB 3KPMA 4JHWL 3RVXD 4MXWH 3HZMB 4H5SA 3VXUA 1NFDA 1AQDA 2AV1B 3CVHH 4BM7A 5ILTH 1GXEA 5DC4B 2B5IC 4ZSOB 1J1PL 3T1FA 4HPYH 3O6FB 2VDKH 1EUUA 4Y4FD 5FHAH 3CPLA 3LEVL 4PJHB 3LDBB 4YQXH 4H8WL 2R0KL 4ODWB 5F97E 1OT2A 4M5YL 4MXVF 1MCOH 4MA3B 2BNRA 3OR6B 4X6BA 4M6NL 3VFWA 3MV9A 4MDIB 3VXUD 2DBLL 1KTDA 3H42L 2VB5A 3NA9H 4QT5B 5DT1H 4QO1A 3MRKA 4JGMA 1GYAA 3SQOL 5CEZD 1I9JL 3BEWA 4RGOL 3WNPA 4B0MM 8FABB 1UT9A 1MCHA 1I8KA 4PJ7E 4OLWL 3IDNA 1NUFA 5KJRL 4Z78A 3UROR 5D1XC 4Q9QH 3WNNA 3CFJA 2BNRD 3DV6B 4Z7WA 1PEZA 3DROB 2YUWA 3VWJB 5GS1C 2DQHL 3MV9D 4A6YH 3AROA 5JLZA 2VISA 4YE4L 2Q86A 4PJFA 5FCUH 4CBPA 3BEVA 1MJJB 1I7ZA 3MV7B 2GITA 3HFMH 3OL2A 5I2IA 2NY0C 1U8QA 3QCTL 4ZYKA 4NFDA 5JW5B 1UA6L 4HS8H 2LFGA 4KHXH 1QLRB 1IGMH 2D03H 3QDMB 3RTQB 4X4YA 5B4MC 1AC6A 5FF6A 2ESVB 2R0LL 3CDFA 4U6YA 3RX8A 4UQ3A 2IC2A 1PSKL 1NMBL 2R9HC 1G9MH 2PYFA 4TSBL 1G0DA 5D2NB 2R1XA 3G5VB 5L7XH 5E8OB 1KV3A 1YEEH 1KGCE 5FUZL 1MJUL 3IFLH 5TDOB 3QDJA 3A6CL 3VFUB 1YUHA 1KEMH 3FO1B 3GMQA 3BXNB 3QG7L 4Q6IB 5EBWA 5D7LE 3F12A 3GJEB 5EZJA 1URLA 4ODVL 5F89A 1E6OL 3KWWA 2ITDB 5FM5M 3F7YB 3MV7E 5IROC 3Q5TA 3CX5K 4PREA 2MCPL 5FK9B 4MQ7B 3SDCA 2FWOB 3MLZH 2BOCA 1ZT4B 2FHFA 32C2B 4JZJC 2G9HB 3L3JB 3L5XH 3A6BH 3O8XA 4JJ5B 3SE9L 3RGVB 2VQ1B 3QDME 3QDJD 4NQEB 1ZA3A 4HJ0C 4GAJH 1JZ3A 4X4XA 2XPGA 2ESVE 5TF1L 4XRCB 1OD9A 3FTGA 4O51B 4DVRH 5D2NE 5DK0B 5DMYA 1A0QL 3SDCD 3Q0HA 1EGJA 3V79C 4PJEA 1DQJB 2M2DA 3TBSA 1S7TA 1U8LB 1Q9WA 2H3NB 1KCLA 1S9KC 4DK3A 4UZGA 1MIMH 3O8XD 5ECJE 4NQXB 1AC0A 1BBJA 3I3EA 2JJTC 3E0GA 1MREL 3VRJB 2EO9A 2IH3A 2VO5A 5GGTH 4F7MB 3LZFH 1FPTH 1KELH 3DVNB 1QPXA 1GZPB 1MCPH 4H25A 2X4SB 3MRPB 1KPRA 3FOLA 3F7PC 4LQFH 3BKJH 2E6QA 4LARH 4R7DA 3JTTA 3VXRE 1JWSB 1F45A 1MHHB 2AJ3B 4HCRL 5C0ND 1B88A 4PJBB 4P9HL 2CDEB 1RUKH 3DMMA 5JA8B 3VFTB 3AAZA 2OR8A 4WNQB 1VGKA 1Y0LB 4TQEL 3W2DL 4XBPB 2ZUWA 4M7LT 4WJ5A 2JTDA 4KTEL 4IMKA 4DEPC 4KPHL 2NY7H 4XPAL 3B6SB 3AXLB 3JVGA 4M61B 1AJ7H 4Y5YB 3K2UL 2O61B 2WBKA 1RK1A 1ZLSH 4X9GA 3MJ7A 3LN9A 5HI5C 3QULB 4W6XB 1PFCA 1HXYA 1S78D 4LVNC 4D0CA 3DMMD 2A0LD 2J2ZA 1EXUA 3OJMB 3PP4L 4ZOBA 2CH8A 3FQNA 2VH5H 1A6AB 1I7UB 1OSPL 4X6EB 3UJJH 1CICB 3REVA 1EBPA 5A16A 5SWQB 2NY5L 3IU3B 3OKYA 2RQ8A 2BSTB 1K9TA 1ZTXL 3OJDB 4RGNE 4UILH 1A2YB 3MLRL 4S1SL 4GO6B 4D9LL 2EXYD 4YHIB 3EOBB 1XZ0B 3UBXG 5ETUB 1HH9A 3QEHB 5F1IA 4YHMH 4Y4HC 1CCZA 4OT1L 4IIQA 1ZVSA 3GMNB 4PRHB 3SDDC 4LLVB 3B9KC 1WZKA 1CDHA 3KLSA 2APTA 1IC5L 3RKPA 2C3VB 3X14A 2BSRA 2O5XH 5C2UB 4Q6IC 4KRPD 5F7UA 4KI5D 1D5BB 1ZANH 3MSPA 1QRNA 3T4AB 1CGWA 2BHYA 3QWOB 1QBMH 3FFCA 3WUWB 2JE8A 3RVUD 3B3IB 1GOGA 2XWBA 3SDYH 3U82B 4Y19E 3BRGC 3SEPA 5ALBL 5MP6L 4M43H 4LNRB 5DJDA 1D5MA 4JO3H 3G5ZA 2C4XA 5KSVB 3SDAA 1ZHBA 1ZLVK 4JFPA 2EDTA 1QRND 2ZSWB 1WGOA 3FFCD 1EEQA 1MCEA 2DQUL 5EORL 3KPSE 1JGDA 3C60A 3DRTA 3VGAC 5CHNB 4Y19B 4PJAE 5D9SB 4G42B 1FVCB 4OCYL 5CFHA 3SDAD 3QCVL 4N0YH 1PEWA 4AY0A 4X9IA 5DJ2A 2VDLL 1UWEL 4M9PA 3FO2A 1PG7H 4JR9L 4UUJB 5C07B 5D1QA 4V2CB 5EU3B 1JGLH 3BIKB 4G6ML 3OAUL 2CJUH 1KLUA 1B4JL 3I3DA 2OM5A 4Z9KB 3BZDA 3C60D 1XCQB 2VIRA 1CXIA 4XH2B 4IHOB 5CBAB 1J05B 4UIKL 2IAMB 4MGXA 4M93C 3KYAA 4PGEB 3VFMA 3X3GL 4RGNC 3BP6A 3LY6A 1JTOA 3OX8A 4F7CB 4ZMAT 1KJ2L 1VENA 1ZHNA 4L9LC 5DJAB 4HAFA 3B8SA 3IJHB 3BAEH 3OKDB 3FZUD 4JDTL 1OM3H 5ITBL 2IADB 3QJFA 3E3QE 5D1QD 3BPLC 4Y5YC 1XF2A 2ADIB 2F5AH 1FH5H 5F7DB 3PP3H 3U0WL 4JO4L 1XGUB 4I77L 4P3CL 3VI3F 5LWYL 5FYKL 3HR5B 3C8KA 4JHAH 5F7WC 2NPLX 4NSKB 4JQVC 5FECA 4KVNL 5DZNA 2L7JA 3MRNA 1JNNL 1XIWA 5C08E 5C0AB 4XPGL 2BMKB 2V2XB 1AXSB 1CS6A 3DV4B 4GBXB 1U92A 4PRIE 3NIDF 1VB9A 3ILQC 4MVBC 1LE5B 5C07E 3T09A 5FB8B 3UO1L 3TT1L 4WDIA 3QIBA 5DQ9B 1IM9A 4K7PH 2PW1A 4JM4L 4BH7A 3MJ9H 1YY8B 3BHBB 4NWUL 4JQIH 1G7PB 3GSUB 2QSCH 4S2SB 5C0EA 3CSPA 3OKOA 1XIWD 2UZIL 3ALXA 5AYUL 3BH9A 3O6ML 5K9KB 3GGWA 4CN1A 2V5SA 5IB3B 4LL9A 3HC0B 4J3TA 3TBTA 3CVHA 1CG9B 1SQ2N 4X7TB 3F5WB 5DJZA 1D6VL 2G60H 2IALB 1HDMB 2YBRA 1UZ8A 3QIBD 2AK1L 1IM9D 3L7FA 5E6YA 3FQUA 4N9OB 3TP4A 3QUZC 1G7LB 3MNWA 5IMLA 1PZUB 4XCCL 4G5ZH 1MCIA 1Q1JH 5C0AE 5ENWB 1ACYH 4NKOB 3DHMA 2Q8AH 4KH2A 3QWQB 4OIIL 2H9GB 3PGDB 4DGVL 3E1F1 1F13A 1T0PB 3CZFB 3BP7A 3QI9A 1WBZA 4R0LC 1D5ZB 1NDMA 5FYKU 4XPFL 4P5KA 3U4EB 1C7TA 1JWMA 4G9FA 5DFVD 4HLJA 4MCYA 3MREA 4X6DA 5IB1B 4OBSA 1UM4H 2V17H 2NW3A 5FGSA 1IGFH 3X17A 3UTTA 2BVPA 1HHIA 5F8QC 2YD5A 4YUEH 1ZLWH 3F7RA 4WHTA 5EZLB 3WXVL 3E3QC 5F9JA 3QI9D 4C4KO 3WFDL 1FFRA 4GAGH 1IARB 1RVFH 4I4WA 4NN5B 1IFHH 5IT2L 4YDKH 1I7RA 3QIWB 4J6RH 4ZNCD 3SY0B 2ITCB 3BD4A 1CGXA 4AJ0A 3MRBB 4G9FD 5GJSH 4NQVA 2AGJH 2Y06H 5I6XC 1QPPA 3P30H 4QRPE 2FGWH 3N1GC 3UTTD 4WI9A 5CZKA 4JKMA 2J6EL 5B3JF 1RUQL 1MI5A 1KB5L 1RZ8B 1W72B 4WUUB 1FZOA 4XB7A 1UZ6F 1AHWA 3KXFA 4IDJH 3JWDH 3VGDA 1P4IH 2X4TB 3JWOH 1AGEB 3BDYH 2Q7YA 4LF3B 3QXUA 3VFRA 1CDBA 4POYA 4ZS7L 5I1IH 2EYTA 1N26A 4HPYL 2GK0A 3S4SG 2VDKL 3I02A 5T5NF 5FHAL 4PLOB 3ULUH 1G9NC 4YQXL 5GXBB 5K9OB 1MI5D 3BGMA 2IJ0C 3ZKSD 5E2UH 3C5ZC 3FN0H 1QSFA 3B83A 4P9MH 2XRAH 5DJ6A 2GI7A 4IM8A 3KXFD 4CKVX 5HJ3A 4QYOA 5GGRB 3WJJC 1FFNA 4ODXB 4L3EB 1NC4B 3KAAA 1KPUB 3NA9L 4GBXC 5DT1L 1CFVH 2CLVA 1OTUD 3VRLF 1HZHH 4JZNA 4WRLA 1OF2A 3T0VA 5E03A 3RHWK 4GKZA 1BOGA 1JK8A 4QHMB 4WUUE 1AP2A 1CIDA 3BESR 3GDBA 5IMOA 3UX9B 5CINH 4QY8B 2NY3B 2EH8H 5A3ID 4JDZA 1A64A 3HE7B 1VACA 2WQ8A 5ANMB 4PD4K 2YXFA 4XCNA 2P8LB 5FHBL 2ZG3A 2DQDH 4A6YL 3T0EB 3BI9X 5FCUL 5IMKA 1L9MA 2XG4A 3HFML 4M7KH 3TZVB 4RZCA 1NUDA 2E9JA 3CFBA 4F9LA 3MGTA 2EIBA 3P4NA 3QIUC 5GGTA 2CD0A 4HS8L 3IDXL 3MJ6A 1A7OH 4KJQD 4P46B 4XPBH 1K5NB 4KHXL 2QTEA 2D03L 5AG9A 2HVJB 4PJ9C 4L3EE 2X7LA 3WFZA 3GMLA 2X4NA 3E6FA 1MCWW 1B0GA 1P9MA 4YR6A 2HVKA 5HD8D 1XFPA 4PS4L 5DF0A 2CLRB 2VXTH 4L4VB 4U6VH 1LP9F 3T3PF 4WO4A 5DA0B 1FAIH 1GOHA 5L7XL 1F4WH 5E6ZA 5I30H 3VXSA 3HNVH 3IFLL 5F7YC 1B9ZA 1EJOH 3R8QA 3GRWA 1RI8A 2HKFH 1KEML 2A73A 1JP5A 4M8VA 4Y4KA 2YA1A 3T0EE 2HJLA 3RWDA 1BWMA 4X7SH 3QNXA 3D69B 1NAKH 5D6DA 5CUSL 1F42A 4MX7B 1EFXA 3DNKA 4FFEX 5TDPA 4ZXBA 4ACPA 5J57B 1D6EB 4WO4D 3EO1B 3G6JA 3MLZL 1AQKH 1M71A 3PF2A 1C12B 3HMXH 4TSCH 3VXSD 1EK3A 3JBG7 1BZ7B 1Q0XH 4GG8A 4MNHB 3STBA 3L5XL 3L3KA 1RJZB 2BVQA 4U1KA 1OAQH 4D0DB 4GAJL 3VE0A 1GGCL 3PE9A 5E00B 3UJIH 4Y4KD 3VI3E 2GUOB 1S7UA 1F6AA 3QG6A 3KLHC 3ULVD 4YFLI 1WBYA 2C1OB 5C0JA 1EFXD 1NMAH 3KR3H 4L4VE 5C71A 5DS8B 4ZXBD 3U46B 2LTQC 1BVZA 5EU7E 2CKBB 3QUXA 4RWYH 1HYSD 1J0IA 3NIDE 3C6LB 4JY6B 1RJYA 1U8MA 1UXSA 1RQ5A 3QO1A 3O6LH 3ULSA 3MGAA 5GGTL 5ITFB 4LEOA 5FGBC 1HQRB 3O3UN 3IFNH 4XAWL 4TRPL 4HFWA 4PJIB 4HJJH 4JPKL 5BZDB 1E4XL 4NT6B 2ZG1A 3MV01 3QUXD 4R90L 3BKJL 4LARL 5EDXA 2HLFD 3C08H 3M45A 4OGZA 1CQYA 1NGZA 3OZ9H 5HDOA 1A7NH 4BSWA 2ZKHH 4FQIH 4P5TB 2EKJA 1RUKL 4HIJB 3UAJD 4R4FH 3P2TA 3LKSA 4Y8AA 3IU4H 4XX1E 5J4MA 1LK2A 4MZ3A 2DIJA 4R4ND 2DMKA 3BZ4B 1AJ7L 2VQUA 2E9IA 4OLXL 3LN4B 1T2JA 3D9AH 3UTQA 1JVKA 2H2SC 4DAGH 4HFUH 1ZLSL 2RBLA 3QPXH 1SJEB 3DWTA 3NZ8A 1CFSB 5DURD 5L2JB 2YPKB 4K8RC 4CDHA 3T0EC 1DDHA 4Q6YA 1TENA 1FCGA 3ES6A 3FB8A 3TVMB 1U8JB 4ZPVB 1GHFH 1T6VN 5E8PA 1UQSA 3AY4A 3O45B 5KVDH 3RVTC 4UDTB 1T89A 2PETA 3GIVB 3UJJL 4HIXH 1CN4A 2OI9A 4OCWH 4QOKB 4NQCE 4KKAC 4QHKJ 3D18A 4X7CC 3EYQD 2QKIB 2WP3T 4PJ5E 4YHML 4X8JB 3MOAH 5D4QA 3UYPA 4Z7QF 3MUY1 4K3EH 1LEIA 1YY9C 4M5ZH 2JK5B 5EU7C 5MEQB 3BQUB 1CIUA 3IRZA 4HV8A 3F6LA 4MA8H 3VMPA 4EKXA 1LQVA 1I3RA 2A1WH 4OF3A 5FYLE 4F37F 5JO5A 1KEGH 5B3JE 2O5XL 4Q2ZA 5F21B 2GJJA 4BKLB 1UXWB 1T22B 5I1EH 3BWAB 1MFCL 1UZ6E 1ZANL 1KIQA 4C83A 3FO0H 3SKOA 1J0KA 3EYFA 1HILA 2C7UB 3LV3B 4XVSH 1WCQA 2NW2A 4EN3C 1BQUA 1A4JB 3B2VL 3SDYL 3RI5K 1N64L 3MRJA 5D2LA 4TULH 1AY1L 2DLTA 3LH2H 3C2AH 1PKOA 1LD9B 1MF2H 4QOKE 3W0WE 4WI2A 1U8IB 3ZZ1A 1A3RH 1FZJA 5M7QA 3VGHA 4LSSH 1X4XA 1MQKH 4MDJA 3MJ9A 2NZIA 4NHUB 1MHCB 2IQAA 2DOCA 5FO8A 3MPCA 5DJYB 4DZBB 2DLEA 4X83A 4YO0A 5IFJB 5LQBH 3GI9H 3VRLE 4UT9H 3IVKB 3MYZA 1QR4A 1L6ZA 3BKMH 3H7BA 4XC3H 4F7TA 1LP9B 1KENL 4M48H 5GGSA 4N0YL 3QUKA 3N85H 2DYPD 5JPMB 4MD4A 3NIGF 2A6IA 4JFQA 3U0TB 4EUPB 4LLAA 3WS6C 4P2QE 2F8XC 1PG7L 3ZT7A 4HSQA 3O3AA 1B90A 1KIRA 2PTVA 2CJUL 2YWYA 5F96L 2D7NA 4LVOB 1OT1A 3DRQB 4KKNA 4QRTA 5EU4A 3HZYB 5F93C 4RQQB 5DRZA 4G7YL 5BQ7A 1D5XB 3MLUH 3QQ9D 3MYJA 3PXHA 1RV6X 4H1LA 4M03A 3EFDH 1RIHH 3QXTA 2AEPL 1OGTB 4FABL 4FQJH 3GJFH 4AM0A 2PXYB 2Y25A 3I6GB 3BAEL 1FNAA 1FG2B 4HKJB 1OM3L 5DD0H 3BRDA 1E28B 4NYLA 4C58B 4APQB 2ICCA 1I1FA 4QXTA 3WEXB 1J87A 2CUMA 2IH1B 2NXYD 1LP9E 1YN6A 3T3PE 5C0GA 1BQLH 3GSWB 1ACZA 2PNDA 1MCSA 5LBSH 1ZE3C 1VDGA 4G6JH 3PGFH 3MRCB 4JFEA 4N0FB 5IW6A 4RMSA 1T7VA 1DVFB 5MEOB 2YR3A 4KGJA 2J4WL 4IBLT 1FBIH 2SEBA 3HI1B 4WUKL 3BUYB 3WFHB 1NPUA 5HYJB 4K7PL 1CVSC 3O0RH 4LKCB 1IQDA 4WEMB 3RVWD 1S9VB 4JFDB 5C0DB 4C54A 2QSCL 4FZEH 1O0VA 1M7IB 1BEYH 4UV7L 3RU8H 3DUSB 1LK3H 4JB9H 3GB7A 2UYLA 3VWKB 4JFED 1T83A 2FJGA 2I9LA 5AAMA 2G60L 5GS2H 3RDTD 5CD3A 4H0IA 5DD6A 3ZKMC 1JPFB 1XR9A 3L95B 2X4UB 4O02H 5DGRA 2Z35B 3LAFA 3LN5B 1WFTA 5I0DA 2IANA 4BJLA 2GK2A 4LGPB 4G5ZL 4PIRF 2Z9TA 1WIOA 3IS1X 2WWKO 1JF1B 3FJTA 2Q8AL 1C1EH 1H9VA 1VFBA 4K71B 2Q6WA 1L0YA 4WV1B 2VZ3A 5GGSY 3ARGB 5EFIB 3PHOB 4X7EC 4MD0B 1CDYA 3KYKH 3U0PB 1IC4L 4O2CB 5A2FA 2R0WH 5HYJE 4P4KB 3FT2A 1JF6A 1U3ZA 4BQ9A 3WLBA 4BZ1H 1BBDH 3HUJF 1FZKA 4KK5C 1JMXA 5GHWL 5D71H 2IAND 4P2OC 5FOJA 2RFXB 5KSBB 1UM4L 2V17L 1IGFL 5IW1A 3PWUB 3W81A 3GSXA 1KN4H 3BFOA 4YUEL 3M1BB 3CLEH 3NMEA 4QWWC 4U1SA 1J1XH 4J3XA 4UBDC 1SBSL 3CC5A 3NFPB 5L0QB 4WFHD 5AZEH 1A4KA 4LPWA 1NANI 1TNMA 4GAGL 1RVFL 4ZTOH 1IFHL 4YDKL 3BZEB 3DIFB 4JLRB 3SN6N 4UQ2B 3WLWC 3JV4A 1CLYL 2GTZB 1XMWA 4OQTA 3P3YA 5DJ0B 3QCUL 2KL6A 4BQCA 5GJSL 3E2HB 1FL3B 3LEXA 5CLWA 1YPZF 2Y06L 1WWWX 3U4BL 5EUOB 3DO3A 2C26A 3P30L 3R06A 1T5XB 1MCKA 4F7EA 2VNCA 1Y18B 5DEZA 1WFUA 4Y5XC 3PWVA 5H37G 2XWJA 1XF4B 1Q9OA 1R3KB 2XQYK 2FSEB 3TFKA 5JTWA 3JWDL 1P4IL 4F57L 3LOWA 3OKLB 3EIFA 5I71C 3BDYL 1UJTA 4V3EB 5I1IL 1RJLA 1RJCA 1JI1A 1KT2B 5IF0A 1IAMA 4HUVB 3VFPB 3I6LD 2D0FA 1KCGC 4Z8FH 1I8LC 5IVZA 3ULUL 1HOCB 3KYOB 3GHEH 4ODTH 3LD8C 2IMNA 2R15A 3FN0L 1WICA 5I1LA 4P9ML 5GSRA 1A6VH 1G7HB 3QUMH 5K9QI 4PJDB 4E41B 4Z7QE 3TFKD 1S5HB 4LOUD 1ES0A 4MJ5A 4TVPL 4DW2H 3CXHK 3HMXA 2P44B 5I73C 1CFVL 1EAJA 1DANU 2CDFB 2Z93A 5C92A 4N1CA 4FQHA 2XKSA 3GSVA 1NAMH 4HX1A 2GEEA 4MD5B 2OMNA 1S7VB 3F7VA 4ODBD 5CINL 1YN7B 4GAFB 2OTWA 2EH8L 2ZCKH 2NX5B 3WDHA 5JW3H 3C5SB 2I07A 3L3GA 4OFVA 5E5UB 2HJFB 4WY7H 2IQ9L 2DQDL 2ZOLB 2DQJH 1EV2E 5BS0A 5GRVL 1JHTA 2CIKB 3EDEA 3VWKC 4X9HA 5FA3B 5JXEA 4ZFFB 1H8SA 4M7KL 5C9JB 1OW0C 4K23H 3EOAB 1D7FA 3U1SH 4TUJB 2Z92B 1AE6L 1F3DH 2EZ0C 3JV0A 4R2GB 1A7OL 4U1NB 2F5BL 4XPBL 4HKBA 1SMOA 3HCVB 3KLAB 2NXZB 3UPRB 4XVUC 2PYEB 5DRNB 4OM0L 1T1YB 2ED7A 1N2RA 3P73A 5BS0D 1HINL 2Y5TA 1RFDH 3OKNB 5JXED 2VXTL 4YBQD 1JRHH 2G2RA 4P4KC 1FAIL 4QRUA 3NIGE 4NOBA 3IRPX 5I30L 3HNVL 3HI6L 1EJOL 4HH8A 5D96C 2HKFL 1EVUA 1QSEE 1YJDC 5I74B 3UBXA 3HB3D 3HZVB 2VLJB 3PV6B 2E7MA 2W0PA 5IJVA 4WI7A 4X7SL 3CFDA 3UTSA 5EBMA 1QBBA 1BMGA 1SYSB 3EJZD 1LO4H 2C3HA 2F54A 2C3WA 2QQKH 4N68A 5ERWB 4ZUUA 3VFVA 4EEEA 5L0QC 2R1WB 4XP5H 1TZHA 1MUJA 1G6RL 3HRZA 1JHLH 3I9GL 1AQKL 1T4KA 5FKPA 2OR9H 1FRGH 1TJIH 1Q0XL 1MCWM 2AERT 1BFTA 2UVEA 1Q8MA 4JM2F 4L8CB 4RFNB 1OAQL 1J12A 2QJDA 2DD8L 3X13A 4K3HA 1JZ7A 2Y07H 1R5WA 3UJIL 1WWBX 4KROD 1C5DB 4D3CH 4CW1B 2Y9RT 1N5YH 1RZFL 2C1PB 3UTSD 3L3HB 2GSGB 4M8QB 1QFPA 1ZVYA 1NMAL 3KR3L 2D31B 2F54D 5MENE 4XAKE 4OGAC 3W9DA 4IDLA 4RWYL 3MLTA 3BP5B 5JR1H 3SKMA 3GSRB 1OP5K 1HH6B 4EI5A 4U6XA 4I9WD 2UY6A 3O6LL 5AWNH 3L3OB 3FB7A 4HW6A 3HUJB 1HWHB 1EX0A 1JNHA 4CNIB 5I2IB 3LVEA 3IFNL 1RHHB 2Z91B 5CBEA 5FCSH 1JHKL 5T3ZD 4PLNC 1NGYB 4HJJL 3TBVA 1Q0YH 2X9YA 5GSVB 3H9SA 1JFQH 3NABL 3MLYL 4ZPTA 3SE3A 3OZ9L 1A7NL 4EI5D 4IMLB 4L3CB 2ZKHL 1WZLA 4FQIL 2BRRH 5I1KH 4NQDE 5E8EA 1XGPB 1TFHA 2CIIB 1UADC 2VAAB 4UTBL 4ZUSA 1I75A 5HVHB 3HG1B 3IU4L 4POZC 4OZHF 2X41A 2WZPD 1P7QB 3B8YA 4XHJD 5CAYB 1FO0L 1YPZB 5IHUL 1H3VA 2HT2C 3C6SA 4U1LA 5DWUH 2VL5A 8CGTA 1FLTX 2HYMA 3H9SD 4LDLB 3D9AL 5DYOA 5HHPA 4DAGL 4KFZC 5I8OH 3GMQB 4HFUL 4LAJH 1FL6A 5EBWB 2X42A 3QPXL 3UBXI 2OTUB 5I8CB 2JKXA 2VLKB 5ALCL 3KLDA 1DBML 4PRPE 1H3PH 3QHZL 3HUJE 3ET9F 5MI0B 3GHBH 1GHFL 4XNQB 2CXKA 4OLVH 1QBAA 1A6TA 4K3GA 5KVDL 3EO0A 1G7JA 4U0QB 3NIFF 4HWUA 3BE1H 3PL6C 4N8VG 4PGBA 1JV5A 3H8NA 1AD0B 3ZKND 3I6KA 2NXZC 3QFJE 1JGVH 3SPVA 1KF9B 5IHZB 4BH8B 1BJ1H 2BVEA 2AK4E 5KN5B 2WLZA 1EVTC 4MAYB 2E9WA 4MQXD 4M5ZL 1JN6B 1PKQA 3TBSB 4MA8L 2A1WL 4P23B 2VZUA 1KEGL 5C2BH 1MFNA 2R69H 2A77H 1I1AC 1A9BA 2J88H 1MCNA 5GIRB 2I27N 4HJGA 2VLKE 1X7QA 2PO6C 4G8GB 2W07A 1IGYA 3FO0L 5EC2B 3C8HA 3P4OA 2VXVL 4CGTA 4XVSL 4ONGL 1VFUA 2CQVA 3H9HB 1TTGA 2IBGA 1T0MB 3EYOB 1V5JA 4LLUB 4LKXB 4TULL 3ZTJH 5D7IB 2PTTB 3LH2L 3C2AL 1FNLA 1MF2L 4Y2DB 2CRMA 2X5PA 1T21A 4LSSL 5F3BA 1J8HA 4G59A 1MQKL 5E9DA 6FABH 4MXQC 5E08L 3GJFK 5DQDH 3ARBB 3O81A 4LEXH 3LIZH 5GS0L 3T4YB 3OB0H 5LQBL 3GI9L 1RIVL 3BPNB 1XGRB 4UT9L 1VFAA 1YEJH 1KC5H 3BKML 4XC3L 4G6FB 3M07A 1ADQL 4ODUA 4KJPC 3SBWA 3HR6A 5FYJE 1GH7A 4NO3A 4TYUA 1TQBB 1J8HD 1YEFL 3FL7A 2FZ3A 1P6FA 4YHNA 1QHPA 3HNTL 5E9DD 4H0HB 5TDNB 3TBWB 2P48B 4BSVB 1OCWL 4ONFH 3CDCA 4I48B 3ZHKA 4X6CA 1RZ7H 5C0FA 4U1MA 5D1ZB 3MRGA 3MLUL 5HVWA 4YC2C 1WIUA 3EFDL 1Q38A 3AM8C 3UTZB 1IEBB 5HVHC 3NCEB 1ZT7B 1KJ2B 4ELMF 2GAZB 1YEDA 3OPZH 5DD0L 4YK4C 3H3BC 5LAXA 1ITCA 3G08B 4FRWA 3KS0J 1TZGH 1R5VA 1K4DB 4Z95H 3CFKB 3KPOA 2UWEB 4OZGF 5HYQA 4FMFA 3QUYB 1UWGH 1MFDH 4BSJA 1D9KB 4I13B 5J0BA 3S35L 5T1MA 4HGMA 5JHDE 1BQLL 4M4PA 2HFTA 3RHWF 1DBBH 1I9RH 3QEGH 5F9OH 4PRDB 3IXTB 3S4SA 5LBSL 3FRPA 5MI0C 3ZKXB 3PGFL 4NUJA 2H6PB 1FBIL 3BGFC 2XN9B 5TF0A 5HTSA 4XX1G 1SEQH 1UM5H 3O0RL 5E2WH 2R23B 2V6HA 3MMEA 4YIQA 4L8SA 4F9PC 5BV7L 4IRSB 3VD4A 3ARTA 3MRDB 4KHTH 4ERSH 1FV1B 1PQZA 4NM4H 3DYMA 3RU8L 3OB8A 2NY6B 1LK3L 3U9UB 3N50A 2FYYB 3PHSA 4JB9L 4NPYB 1JPTH 3N1MC 4XCEB 3RWJA 1MCJA 4MNGA 1JGDB 3BN9D 4NUGH 4OV6F 2A6KB 4NKMB 1HHGB 4CN4A 1K3ZA 4BFIB 1SM3H 2ILLA 1LILA 1BX2B 4O02L 1CT8A 1HHKB 1OGAA 3T65B 3D2UB 3PNWB 4XMPH 4HXAH 4G8FB 2A6JA 2NY1D 2ZNWA 3QUMA 1C1EL 5AZ2H 1RMFH 4URTB 4U2ZA 4RX4A 3FO2B 3V6OE 2BY3A 4NZJA 1UWXK 1LQSR 3ROOB 1CFQB 3A0OA 2VWEE 3KYKL 2XN9E 2FJHB 2R0WL 5I16A 3C9NA 4WW1A 2V5YA 1NAMA 1CGYA 1BBDL 5I76B 4AH2B 5D5MA 2JB5H 1OGAD 2Y72A 4NBXB 1B0WA 1DBJH 5D71L 3SE8H 3EKCA 3BPCA 4FQPA 5BXFB 5JXAL 1PGRB 4FQCH 5H2BA 1T7XA 3PWJB 1RY7B 4N0CC 1NJ9A 1KN4L 4RX4D 2Q3AA 3QJFB 3BDXA 2CRYA 2NTFB 1RU9H 2KKQA 5E2TH 1IAIH 3DSNA 1FNFA 1UG9A 5HHOB 4NNYA 1KNOA 1X44A 1IGCL 3L3DB 3O3DB 1AR2A 3RWEB 4ZTOL 3U36A 4OZHE 1U93B 2ICES 4ZAKB 5CJBA 4YHPB 4PJGA 5T5NG 1OTSC 4ZUVA 3RKDC 3VFGH 4X5WA 1TQBC 4FS0A 3MXVH 1JNLH 3RWGB 1U2CA 3QNYA 5FGCB 4FHBD 1KCSH 5DRXA 1A14L 1EEYB 5ESVB 3MLVH 3PWPB 1FYTA 4WDIB 5CIPA 4M7JH 1M6OA 1IBGH 2VZSA 4NHCH 1YMMA 4XCFL 3PG2A 1Q72H 1ONQA 1KB5B 3MOBH 5JORA 4NO2B 4OZFG 4YPGA 3Q6FB 4YGVB 4QTIH 2DQFB 5C0EB 4AK1A 3EUUA 2G75A 3NIFE 3P0VH 3BT2H 3IF1A 2ZCLL 3MQIA 1EMTH 4UU9A 1QFOA 4JM2C 3UMTA 2N1KA 4GW4A 4S1DD 3D0VA 3PQYB 4Z7VB 1FYTD 3GHEL 2QQLH 1NSNH 4ODTL 3ARRA 5BRZB 3D39B 4ISVB 1SJHA 1A6VL 1YMMD 5JNYA 1WQVT 1FSKB 3LKRA 1R6VA 4TTGA 3CX2A 4WWKA 3O9WC 4JO2L 3X11B 4XZUB 4BUHA 4GW1B 3GSNA 1WVZA 1VFMA 3RZCA 1AI1H 4XXDB 1V8HA 1QRKA 2Z31A 3IYLW 1VEOA 1NCNA 4CADA 3V6OC 1I4FA 1MWAL 3MRMA 4K55A 1IL1B 3PWPE 5LGJA 3GM0A 5HYFA 2DJUA 2VWEC 2M1KA 4N8PA 3QEQE 3CMOH 3EDJA 4LDOB 3QXAB 5IP4A 2ZCKL 4IRJA 2NY0D 2CK0H 5JW3L 1CR9L 4IRSC 2FATH 3O3EA 4WWKD 3T0WA 4OF0A 4WY7L 4Y5VC 5CEXA 1DL7L 3G5YB 4KC3B 2DQJL 3QXDB 5B22A 1RULL 3RZCD 2K3TA 2NY6C 3INUH 5EC1B 2Z31D 1N59A 5GGVY 3ERYA 4NO5A 1G9NH 4A6YB 3PQYE 4DZ8B 3TBYB 5ID1B 5I18H 5DMIL 4K23L 2OQJB 3FMGH 5D6CA 3I2CH 1LO2H 4EUPG 3ABZA 3FCTB 4OLZH 3K80A 5C3TA 4PFEA 3JTCA 1S9YB 2P47B 4PB0H 3AREB 4X4ME 4DN3H 2PCPA 3T77A 4IRJD 3QQ4B 4TUOA 4QF1B 2DWDA 3ARFB 4LCWE 3TYGH 2DLFH 4OZGB 1EO5A 2EDKA 1EJ6A 3BP4B 5I1JH 2JIXB 2IWGA 2IMMA 4BA8A 2FH6A 5FO9A 2M8XA 2ATKA 4PTUA 1QUNA 1RFDL 4L8DA 1CDGA 4Y1AA 1JRHL 1Q9LB 1VADA 1QA9A 4GXUM 1MLBA 4GW5B 4G7VH 3MUGA 3O4LE 2X4OB 1T04A 4J4PA 1TVHB 4H26A 1EEUA 3VGEA 4RIRA 3RJDA 5CD5C 3VD7A 3I02B 3KYMB 3ZE0F 3HZMA 4L29B 4KKCC 2J1KA 1OTTC 5F44A 1T03H 3RI5F 4ZSOA 1MRCH 2ZOKB 3O6FA 2VDRH 1WCBB 2QQKL 4Y1AD 4JQXA 4XP5L 1YQVH 1DUYB 1QSFB 4DQOH 4PJHA 4ODWA 2OR9L 1FRGL 1TJIL 3QFDB 4ELME 1FFNB 3TA3B 2G5BB 2BDNL 3D85B 4JFZH 2VDQL 1A6WL 4J4PD 4MA3A 1VKXB 4R6UA 2F53B 4J23A 4OZGE 1V3LA 2YC1B 4MDIA 4HWBH 5BZWB 1N5YL 1WISA 2VLMD 4ELKB 4C56B 4QT5A 3AGVA 1DSFH 3HAEB 3O6FD 2QSTA 8FABA 1Q94B 2NYYC 3DUUB 2FX7H 4JRYB 5JR1L 3GSOB 2AI0L 3SKUD 2UV3A 3ZT5A 4UMGA 2DB8A 3DV6A 5AWNL 3DROA 3VWJA 4KI1A 5HGBB 1KB9K 5EUKB 1MFBH 3V4VH 2CRIA 5EO0B 2BVOA 4I0PB 1QG3A 1KCVL 3MGTB 3UDWA 1MJJA 1QR1B 3MV7A 1Q0YL 5DUBB 3V0VB 1XGYH 2YRLA 2E27L 3UTPE 3P0GB 2DQCL 4L4TE 2OS7A 5JW5A 2Q8BL 2DF3A 2BRRL 1QLRA 4XWOC 3QDMA 3RTQA 1P5UA 3VWJD 3NBNA 4F15B 4K9EL 1W72H 4HUNB 2HFFB 2NR6D 2ESVA 2WANA 3U7WH 1MEXH 3MACH 4PJ8C 5DWUL 1AGDB 5T1DL 3MV7D 3IKKA 5D2NA 5IVOA 2HN7B 3G5VA 1MAMH 1NGQL 1SYVB 2BFVH 2YKLH 5E8OA 2HTKD 5C7XL 5I8OL 3TYFB 3V6FB 4MAUH 1FDLH 5TDOA 1NCWH 3GMMB 5K93A 1NBZB 1QP1A 3MZTA 3VFUA 3NPSC 3FO1A 3QDMD 4JPVH 4Q6IA 2VDML 3RTQD 1Z9OA 2F9BT 4KJWC 2YXMA 4OLVL 3I50H 2ESVD 1YNKH 3DETD 1AR1C 3F7YA 1M71B 3VXOB 1KPVB 5FM4A 2MQ0A 5FK9A 4KMTH 4MQ7A 4M1GH 2FWOA 3KPTA 1X5KA 3T2PA 3H9ZA 4OFYA 4DUWA 1ZT4A 2D7TL 3ARFC 1JGVL 32C2A 2G9HA 1IQWH 3L3JA 4JJ5A 2VQ1A 4NQEA 1T66D 4ZFZB 1WBYB 1RZGB 3G6DL 4MHHI 5E7FA 2NZ9C 3MCLH 4Q58C 5D7JB 2X4RA 3HN3A 1MRDH 1C16B 4X4ZA 1UKTA 1WLHA 1CDUA 4J7RA 5F9DC 3VH8B 4QKXB 4O51A 3HE6B 2HLAB 3OB0K 3QT2A 5DK0A 1DLFH 4ZDHB 3PIQB 4RCAA 2R69L 3CLFL 4P2YA 5JUEL 5C2BL 1DQJA 2J88L 1GGTA 3QO1B 4OFYD 4K8RH 1U8LA 2H3NA 4YZFF 1JZ4A 3P77B 1MAKA 2FBJH 1BAFH 2D2OA 3QJHB 5ISZE 2X44D 4NQXA 3RGVD 4JREC 4NQED 3UJTL 4FTVE 4KK6D 1CLCA 3VRJA 4OIAA 3V8CA 5HDQH 2RAMA 4F7MA 2PF6A 4KKLC 3DVNA 1GZPA 3OHXB 5FV2A 5ID0B 2X4SA 1F6FB 3MRPA 3AFLA 1X5XA 4DVBA 2X9WA 3OAYH 1YEGH 3VRIB 3O11B 4ZFOL 4R3SB 3IDYB 1GOFA 1JWSA 4EDWH 1MHHA 2AJ3A 5ICXB 1L6XA 4PJBA 2CDEA 5LXGH 5JA9A 2R2HB 3VFTA 4WNQA 4LEXL 3SDXF 3LIZL 1Y0LA 2Y1VA 4XBPA 5E94B 4RMUA 1YECL 3UTQB 4LCCC 4NN6C 5E6IB 1YEJL 3B6SA 3AXLA 5IGXH 1KC5L 4M61A 5FV1L 4TNVK 4Y5YA 4N5EC 3DVGB 3GSQB 4NP4H 1U6AH 4F80A 2O61A 1R3LB 3CUPB 3LB6C 5J11B 5EIVA 5L6YH 3DPBA 1CE1H 4WI8A 2ZCHH 3MXWH 4PLJC 5SWSB 4OCXH 5JHLH 3QULA 5DA4A 3LQAC 4NGHL 1WWCA 3LKPB 4P0DA 1TJGL 4ONFL 1J7VR 1V3KA 3BD5A 5BOZG 2YD9A 4XTRD 4MVBA 4DN4H 1RZ7L 1A6AA 4KZDH 1I7UA 4O4YH 4RISH 4X6EA 3S37H 4ZTPH 4PGDB 2H2PC 1N7MH 3BMWA 2A9ML 5SWQA 2IPTL 4OZIF 3IU3A 1HHHB 2BSTA 5TE4H 4ZOEA 5KOVC 3OJDA 3OSKA