5IB5A

Crystal structure of hla-b*27:09 complexed with the self-peptide pvipr and copper
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
total genus 73
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib5A01
3HI1B 4YDKL 2BNRE 3HE6C 2IWGA 3JV5A 4NM8H 3U46B 4P2RB 4ZTPH 2R39A 4YEEA 1U8MB 5DHVB 3MLXL 2DQIL 1YEIL 3OZ9H 1KIRA 3STLB 4ODVH 3R1GH 1XR8A 5CZXD 3N1FC 4X7DC 1UXSB 1X6NA 4HS3B 3V6BR 5IEKA 2F8VA 1ACZA 3MUGB 1RZJC 5I8OH 3SDXA 1MHCA 3VXNB 1CZ8L 4A6YA 4R90H 2CPCA 2I26N 1HSAA 4JQXA 3RUGE 2AJXH 5DJXA 4ZSOE 2PW1B 1FIGH 1A6ZA 2J8UF 1IAOB 2BY1A 3GSVA 5CP7A 4J8RA 2VLKD 3WCYA 3LRGA 5CJOH 5CGYC 4LLYA 2P24A 5B3JF 4HBQA 2ORBH 3ZDYF 4KK9D 3DHMA 4HK0A 5F1SA 1WWWX 4PJFB 3I50L 2FZ3A 1JNHA 3DGGA 3RJDA 1ROWA 5CKAA 2O5ZL 5HGAB 1ZT1A 4ODTH 4Y5XA 3PWLB 5GRWA 4UUJB 3FFDB 1S3KL 1HHKA 1BP3B 3U0TB 1H8NA 5FDYA 2IPTH 1I8KA 1CFNA 4K71B 4TUJA 1BOYA 2IGFL 3CDCA 3CSYA 4AG4L 1HH6B 4O58H 4YDLB 4LRIC 4XCEB 1IC4L 4EXPX 2HTKC 1UYWH 3E3QA 1NCWL 1YYMH 4E41B 5DUBA 5TQ0H 3ARPA 3KPRB 2AI0L 1AKJB 2JCCA 1N4XL 1T4KB 4WWKA 3UP1A 4QHKJ 3PIQB 5KSBB 3UJTH 1YEDB 3N9GH 2X05A 4KKLC 1F02I 2EDHA 4L8CA 4XAKD 3Q6GL 3ULVE 4XPAH 1LWRA 3FFCD 3OKLA 3QNYA 4M1DL 3BESR 4RAVA 3MRQA 4BFIA 1KG0B 2YRZA 1F13A 4ZPVA 4G8EA 4P49A 4GXUN 4E0RB 2VKXA 2IADA 1ORQB 4HWUA 5CEZD 2E9JA 5FO7A 3VI3E 3IDJB 4FXLA 3CSBA 5IW6A 1BJ1J 4L9LA 1JYXA 4PJCA 5DK2B 2DM2A 5ERWB 4L8BA 5E95B 1K2DA 2VMFA 2GSGA 3O2DL 4UV4L 4BFEA 3KPNA 1FO0B 1MCWM 3QISA 4UZGA 3HTLX 3EOTH 3HS0B 2NLJA 3OWEA 3FB5B 3DJ9A 4WI2A 2NY2C 2OS7A 3G04A 3B9AA 4NHUB 1JPTH 1E6JH 3AREA 4KXZH 2G9HB 3FOMA 4P5TC 1TTUA 1LK3L 1OW0A 5A16A 3JVGC 3RPIB 3NZHH 1IGFL 4JREB 4POZD 2DQJH 3QEHB 3C60D 1DBJL 1NL0H 2VB5A 5D7LB 4DN3H 4LF3B 1FPTH 1GGCH 4ODUB 3MRNA 4FXKA 1XFPA 5JA8B 2RCSH 2ADJA 4ZFGL 2BCKB 3Q1SH 4G6JH 3DMMA 4MAYA 3FJTA 4QRTA 1HSBA 5HI3D 2EDEA 2ICEA 4PJ8D 4XTRD 1ZLWH 1AP2A 2W9DH 1DEEA 2DMKA 5J1SC 4YPGB 4Y5XC 3KJ4B 4GMTH 3ARGC 3QIUD 1IBGL 4JAMB 5I1EL 3MOAL 3ULVL 1REIA 1D5IL 5IB4A 3ZTJG 5I8KH 1JGVL 5LCVH 1NC4A 1MNUH 3QZWA 2EDLA 4YXHL 1T1XB 1HHIB 1ODAA 4U1IA 5IJKA 3UJIL 5AG8A 1HIMH 1I9JL 4FQLH 4PP2B 5EA0H 2B1AH 1S8DB 1FSKC 1J1PL 2VYRE 5I74C 5CLWA 3E3QC 3VXPA 2XACC 2LU4A 3HB3D 1S78D 3MOBL 3QUZB 2YK1L 5E6ZA 5JW5B 4OLXL 4HAFA 1PSKH 4RFEB 1ORSB 4OF7A 1U58A 4MHHI 1IGCH 1P69B 3TO2A 2C9AA 4JPKH 1WICA 4YHIB 5M95B 4UOW1 1U3HD 4GAGL 1YEJH 1EFXA 1R6VA 5FUZL 2G75A 2AABL 1T6WA 1MIEH 4BZ2L 3U9PH 2AK4D 4DGYL 5DMGC 5JA9A 1T7ZA 1RZFH 3UROR 2N4IA 1PD6A 4NC1E 1GGTA 1IEAB 2VDMH 2DIAA 3VFPB 1YNKH 3B6SA 1KB9J 3DO7A 1KIRB 4XWGH 3WEXB 1AO7A 5ANME 2HKHH 1XR8B 3FQRA 2BSRA 3QP3A 2C1OA 1OW0C 4POYA 1KCVL 5IEKB 3ARFC 3SDXB 3HZKA 1MHCB 4TOYL 35C8L 4A6YB 1RHFA 4D2NA 5CBAA 3K3QA 3HMXA 3VD7A 4PJXF 1HSAB 2IALA 2XZAL 5DJXB 2QSCH 3NBNA 1A6ZB 4GFTB 4M4RA 1N0XH 1I7ZA 5CP7B 4J8RB 3MV8D 3DVNA 1U8HA 3BIAX 2VDRL 2EYRB 4P4KC 3V52L 5HHXH 3SE4C 2R0WH 1WZ1L 1IT9H 3HNVH 4FOMA 1CTOA 4LLYB 1BFSA 2P24B 1AI1H 3RDTA 1MHPL 1RJLA 4AEIH 5CZKA 3TO4A 5I1AA 4LHJB 3TCLA 2BSSA 4WUKH 4NT6A 1OL0A 2FZ3B 3U79A 4OCYL 5JHDD 3DGGB 3LAFA 3QXAA 4LSPH 1ZT1B 3IFPA 5KJRL 5SWZA 1HHKB 1QTYT 2DLEA 2W38A 5I9QB 1I8KB 2GSIA 4IRJC 4JVUA 2WQRA 2WWKT 4X5WA 4TUJB 3MQIA 3MRRA 3JWDC 3CSYB 3D39D 1AY1L 1GRWA 1KIUA 2D31A 1HYRC 1KJ2A 5DD0L 3MLUL 4L3EA 1PJ9A 3CMGA 5JMRA 5DUBB 3W9DB 2JCCB 4K7PL 3TYFA 2P49B 3GGWB 3KLAA 4WWKB 1WIOA 5KZCB 4NQDB 1T89C 4HC1L 1XH3A 3QIWA 3RGVA 4L8CB 1W8OA 3NABL 3QR2A 4ZODA 2IQ9H 4JM2D 3QNYB 3OKLB 1JGDB 5I18L 2W60A 1E6OH 4MXWL 4RAVB 1FDLL 3MRQB 4IS6A 4BFIB 2YZ1A 2A9NL 4ZPVB 4H8WH 2IADB 2IG2H 4IMKC 5FO7B 5HHOA 1P7QD 5HDQL 5IW6B 1GC1H 4L9LB 4W4NA 4PJCB 4QOKA 4F7MA 4L8BB 1K2DB 2QBWA 1EHNA 2GSGB 4TPRH 5GS3A 3KPNB 1RJCA 1YPZE 2NLJB 5JOPD 2YR3A 4XB7A 3G04B 1X7QA 5L8LB 4LARH 2UWEF 5IBLD 3AREB 3FOMB 3ZL4H 3SO3B 5A16B 3C5JA 2MWCA 1UCTA 3MFGB 3I3DA 3MRNB 3QWOA 2IH3B 3HE7D 3TO4C 3MLTA 2ADJB 2ZG3A 3FO2B 3VWKC 1TLKA 3DMMB 2XTJE 4MAYB 1JHKH 1HSBB 4RDQG 3PQYE 4DUWA 1I8MA 3ZTNH 2PYEA 5IQ9A 4G6ML 4K8RL 4MJ6A 5IVNA 1AP2B 3RZCA 1DANT 4Q9BA 4ERSH 1DEEB 4FQPA 4JRYE 4OZHE 2OMNA 4JY4A 5GISL 2VXUH 1Q9LA 2R23A 3K8MA 3L3GA 1I1FA 4R7DB 1RUAH 5IB4B 4UQ3A 3GSOB 3G5XA 3QZWB 4UTBH 3GSQA 2E7LA 5C6TH 1NUGA 2J7LA 2QQQA 3WLWD 4U1IB 2NZ9C 4KZEL 5BZDA 5DFVD 4FHBD 1OGAA 4YXLH 1BHGA 3VXPB 1XGYL 4YHOH 3QG6B 4JO4L 4PLOB 2VUYA 6CGTA 3VGGA 4HKZA 5LBSL 2O93L 1KOAA 4OD3H 1J8HA 3VMOA 5D70H 1LO5A 1AXTH 4XVTH 3WBDA 3UYRL 1U58B 3QIWC 3VXME 1DFBH 3TO2B 1AGCA 3KWWA 5IFHH 1Z3GH 3RZWA 4JHWL 2V2XA 3SGDH 3MRBA 4CAGA 3U30C 3MLRH 3WNOA 4HIXL 1EFXB 2G75B 3MGAA 5HHPB 5KG9B 2KUTA 4KRPB 2YA0A 2D0FA 4QHUA 4XI5D 1R0AH 4KJWC 4KAQL 3HRPA 5D5MF 1OAQL 5GIRA 4HF5L 4LASH 2VN7A 2EDBA 3OPZL 4WIQA 4OSUH 2V9TA 3B6SB 3UTPD 3DO7B 3LN4B 1AO7B 3FRPA 1NAMB 3FQRB 2BSRB 3KJ6L 2HG5A 5F88A 1KEGH 2C1OB 1V3LA 1A7RL 1MPAL 5ALCL 4N0CA 3S4SA 3C8HA 3F7PC 3HZKB 3OKOB 3NFSH 2FBOJ 5CBAB 5TPWL 3VG9B 2IALB 4GSDH 4OUOA 3MGTA 4L4JA 4RRPG 5J12B 2X4UA 1I7ZB 1FVDA 4WI5A 2NR6D 1H3PL 3DVNB 1U8HB 1GZPA 3BXNA 3HC4H 3ZKXB 3KHOA 2VKWA 3IDGA 3L5XL 4X9BA 4XP9L 5DC0A 3RZCC 2Q8AH 1P84J 5C2UB 2B2XL 5F7HA 3S36H 2WP3O 4WI7A 5FHBH 3RDTB 1RJLB 4ONFL 3LS4H 4Y5VB 5I1AB 3EO9L 5MP6H 4BK4A 5EG6C 1NGQH 4NT6B 1TJGH 3QXAB 2ARJQ 1G7HA 2C3GA 4WCYL 5E2TH 4HLZG 4UV7L 5SWZB 3ZE0E 4XBPB 1YEGH 1NCAH 3GJFH 2Y07H 1DBKH 1PG7X 2GSIB 5JMOC 1I9IL 2NY2D 2XWJA 2F15A 4KMTL 1CDCA 1LK2A 2X89A 4X5WB 4CJ0A 3MRRB 3GI8H 3TZVC 2RGSA 3MUY1 4IRZH 1JNLH 2D31B 2EXWC 1RUKH 5E08H 3FN9A 4Z5RA 2V2TA 1KJ2B 3MREA 5HI4C 4U0QB 4TTDC 2D0GA 4XBGB 2VN4A 2D4FA 3VXRD 1CDYA 1RIHH 4PRBB 3TYFB 1MCSA 2QQKL 4HWNA 2PR4H 5AYUH 1XH3B 3QIWB 3RGVB 3BJ91 4C4KT 4LLMA 1F2QA 4IIQA 4F58L 3WKML 2W60B 4CL7A 1QOKA 3VD3A 1HHGA 4RFOH 3ARGD 1CLYH 2OTWA 2ESVE 1FFOA 3O6FD 5HHOB 1P1ZB 2KQNA 2Y06L 4QOKB 5CKGA 4F7MB 1U93B 1J1XH 5ICZA 2Q8BH 3T2OA 2P44B 4PRDA 1MRCL 3V6ZA 2ZUYA 2B4CH 5CHNA 3ZMRA 1X7QB 2V6HA 4HWBA 1RZGA 4RMRA 4TULL 4JQVC 2IFGA 1N0LA 1YMHA 1N5AA 4MJ5A 3C5JB 3JUZA 1MSPA 5CAYB 4N8CL 4KK6C 1OTSC 3BI9X 3QIBA 4ODXA 1A1NA 4Q6IA 3QWOB 3I6GA 4HIHA 1CI5A 1XGUB 1MFCL 4Z0XA 3MLTB 3LMJL 1NFDA 2E27L 4FN0A 3HZVA 5J4MA 4J3UA 5GJSL 1I8MB 1LO4H 2PYEB 3SQOL 3E8UH 1ZA3A 1BD2D 1F3JA 4JY4B 2GJZA 3NFNA 3O2DA 4U49A 1Q9LB 2R23B 3H9SD 2ZOLA 3L3GB 1I1FB 4UQ3B 4QNPE 3MLSH 3BZ4B 2YXMA 1UA6L 5BV7C 5EBWA 3GSQB 5CUSL 3KPLA 3QEQA 4O51A 1RURH 5J11C 2X4PA 1VDGA 2WBJC 5BZDB 5ETUA 4EJ1C 1OGAB 4GLRH 4X4ME 2GFBB 4ZFZA 4WTWA 4N5EC 4WI8A 1DANU 5D7SH 1DQLH 5E6IA 1J8HB 2J4WH 4PS4L 1Q38A 3GKZA 1JZ6A 4H0GA 1LO5B 4YUEH 1YQVL 4WTZA 4BSJA 2CUIA 4X5XB 2H32H 1AGCB 2FRGP 3KWWB 3H0TA 4IIQC 3EOAA 4NBZB 4P2OB 4DCQA 1EJ6A 1FL3A 3FKUS 3I85A 3KYMB 3MRBB 5HVFB 2R9HC 2IBBA 4YDVA 1TIUA 5EIQA 5DRWA 2J5LB 1JK8A 3CX2A 4MS8C 4BK5A 1UM6L 4POUB 4QHUB 1EFQA 1X5JA 4N9GA 4APQD 4PJBA 1IGMH 5GIRB 1G6VK 1G9ML 3UZEA 1MCPH 1HN1A 1V3KA 1TZIB 4K2UH 4J6RH 3L1OL 1C5CH 1HQ4B 4S0TD 1P2CA 1L7TL 1RZKC 2F74A 3RGHA 3N1QC 1ZAGA 3VE0B 4Z7UF 5F88B 2HG5B 5CMAA 2OI9A 4N1CA 5EUOF 5KTEH 1TITA 1K3IA 3S4SB 4XVSH 2NNAB 3GMRA 4X80H 5I1HL 3W5NA 4TNWK 3F58H 3QIBC 2L0DA 3QO1A 3INUL 1OQOA 2XYCA 4QRQA 3GK8L 1O0VA 2VDKH 1GOGA 3MGTB 5HGDA 3VFUA 1GZPB 1JNNH 1NDGA 3UYOD 5K9OA 2ENSA 2Q87A 4OZIF 1Q8MA 1V7ML 1OARL 5EBGA 4AM0A 1G6RL 3BKMH 5L8KB 3JTSA 5KSUA 5GS0C 2APXA 4DVRH 3EZ8A 5IT2H 1A14L 3IF1A 3RL2A 4M7JL 5DJYB 1G7HB 4MWFA 5DRXA 1B6DA 5HYEA 4Z7QF 4XAKE 3T0ED 1HWHB 4CRPA 3R8QA 3T0XA 4FNLL 1EO7A 3FFCE 3UTTD 1ZXQA 4M6NL 2IAND 2XWJB 5EU3A 1LK2B 1SY6L 1NH6A 1QLEH 4DKDC 2OR8A 2H2PC 4ZDHA 4KGJA 3QB7C 3ZKSD 2YD2A 4Z5RB 3IFNH 2W9LA 2V2TB 2YEZA 4XPFH 4XPBL 1WAAE 2BOBB 4N0UE 1L7IH 3GHBL 1T21A 5LQBL 3VWKD 4U1GB 4LLMB 1I8LA 1BZ7A 1XF1A 4X6DA 4IIQB 4ELMA 5B39G 3BDXA 4XCNA 2HP4A 5E8DH 2XXCB 5IB2A 1HHGB 1FNEA 4ENED 2EDJA 1QACA 2OTWB 4LPWA 1FFOB 5E8EA 3DBXA 4LSQL 3FQWA 3LQMA 1S9WA 1OM3L 5KS9E 2OI9C 5ICZB 1D9KA 5FCUH 5F6IB 3OB0H 4GG6E 4PRDB 4PG9A 4JN1L 3V6ZB 4D9QD 3QBTB 1TJIL 4OUUA 1T7WA 5CHNB 5C92A 2VXTH 3ZKQD 5GGSY 1MAKA 5HHME 1RZGB 1VFMA 2H1PL 4PJDE 5TFSL 2R29H 4HC1A 1IEHA 4Y19A 1RZ7L 3U0WL 3ARBA 5T5NF 4WI6A 4KJYA 4OLWL 3QIBB 4ODXB 4KQ3H 5DGRA 1A1NB 1MQKH 1J1OH 1QSFD 4Q6IB 2AS5M 3I6GB 4MXQA 4HIHB 3QJFB 1QFOA 1CLZH 3WS3A 1NFDB 3S35H 3HZVB 1E4XL 1FYTD 5HYSG 1DBML 3FN0L 4Y4HA 2GTZA 4IJ3C 1F3JB 3U6RA 4YQXH 2GJZB 2OXGA 3NFNB 1QNZH 2ZOLB 4NRZA 3BEVA 4PJHE 2EICA 1CDBA 1CVRA 2GQHA 1QSVA 3L5WA 4M4PA 1JP5A 3LEYH 2R0KH 2D7NA 1QLRA 4CN6A 3KPLB 3QEQB 3ZKNC 2W0FB 1Z9SA 5ETUB 4MA8H 3MLWH 4ZFZB 1F8TH 2EKSA 5SWSE 3LEXA 4RAUA 4X6CF 4C56A 4ZTOH 5I19L 5F8RC 2LU7A 4AJ0A 4G7VL 5E6IB 1CD9B 4LLVA 3C6SA 3ZE2E 4J23A 3EOAB 4DCQB 4NUJA 4LBEA 1FL3B 2XWBA 3QT2A 4FP8L 1K6QH 3QFJD 5EZIL 4YDVB 5IHUL 3M17A 5DRWB 5F21B 3L7FA 3G6JF 4ZNCD 3LQZA 4UIMB 5E2VL 3MA9H 4N9GB 3SKUD 5DFTA 3MUJA 3O8XD 1RIUH 4PJBB 1D9KC 5L2KD 5F7EH 2P5WD 4GRLA 3C8KA 5CSGA 2A6KA 4ZS7L 1P2CB 4P2QD 5DUPH 2BK8A 4M7KL 2F74B 4UNUA 5DQDH 1A9EA 2IFFH 4JHAH 1F4YH 4NWUH 2OJZH 5C08D 5CMAB 1YPZA 3F62A 1E4KC 5D2NC 5T1KB 3ARBC 1F5WA 2FR4A 3MXVL 2WY3A 1CL7L 3GMRB 3F65A 2J8UE 1MCCA 3QO1B 2HRLA 4OB5L 1EO8L 2XNAA 4MXQC 5C0BD 1KIPA 3NOIA 4RMTA 5HGDB 3VFUB 1FV1A 1UCBH 1ZSDA 2VDOH 4LAQL 5K9OB 5B3JE 4N0YL 1AXSA 3ZDYE 3EFFA 9CGTA 1EV2E 4FQQA 2UYLA 3T2NL 2IPTL 4G8IA 4MDJA 4AM0B 5J6GA 4D9LL 3PQYA 5EH1A 4P59L 5KSUB 3G6DH 1EHAA 4JZNA 3AAZA 4JRYA 2LTQB 3F7VA 4MWFB 5DRXB 3QPXL 3I6LE 4P57A 3WIHH 1YDPA 1F6FB 1NANI 2E7BA 2CRMA 1U42A 2PKDA 2V2WA 3BKCL 5CILL 5EU3B 1RAMA 3NA4A 4XP5H 1NMCC 1ZLWK 1OT2A 1ZLSH 5DZLA 3WFDL 5FGBA 5HYJA 3E2HA 4KK6D 3O0RL 3QRGL 5H35B 3LPWA 1MCBA 1T21B 1RY7B 3S34L 3BN3B 4C58B 1D5BB 3DGCR 3RVWD 3FB7B 2J6EH 1BZ7B 4U6HB 3TIEA 4XCNB 2NY5H 5IB2B 4R4FH 1JPTL 2AVGA 5E8EB 4NO3B 1VKXA 1GGBL 3DBXB 3FQWB 3LH2H 2W0PA 1S9WB 4AQ1B 5KSAA 1OD7A 4EI5C 1W0WB 4QKXB 3FAXA 4HG4J 2ITCA 4YBQD 1E4JA 4PG9B 1F6LL 2RCSL 1QUNA 2X9XA 3SN6N 3NAAH 5D7JA 2UUDK 1NBYA 4XNUH 1RUPH 5CGTA 5EBLB 4Y19B 4F15C 4CVUA 1H3WM 5GS1A 3MRJA 4KJYB 4OD1L 1AGFA 4XNYL 5C09D 5CEZH 4HPYH 1T1YB 2BY3A 5TQ2L 4ZAKA 3WS3B 5E5MA 2P42B 4BQCA 3PXHA 4K3JL 1EPFA 5L88L 4Y4HB 4M7LL 1HDMB 1HIML 2GTZB 4TYUA 5IVXF 4MZ2A 4U1MA 1S5IH 3U6RB 1KFAL 4YDJA 2BX5A 2XWTB 3RHWF 1HCFX 2EE3A 4S1RL 4HUMB 3G08A 4NRZB 3BEVB 3DYMA 3OKDA 5IVZA 5KVGL 2YUXA 3DIFA 1K4CA 1IC7L 1IAKA 5D72L 4JFOA 5GGVL 1QLRB 3DXAE 5DA0B 1JRHL 2R1WA 2DB8A 3NCFB 2ENYA 1JZ2A 4HMCA 3EBAA 3PP4H 2NTFA 3JTTA 4RGNC 2EKSB 1EO5A 5IFJA 3LEXB 4IDLA 1UH4A 4RAUB 1G7LA 3E2HC 4C56B 2VSDA 3LDBC 3L5JA 4WFEE 1Q72H 1OAUH 1VESA 2YA1A 2I5YH 3C6SB 3BZFA 5E5UB 2BSTB 4MNQA 4KKBD 3THML 1FBIH 4NUJB 4LBEB 2ZPKH 4LK4A 3TYGL 4TVPL 2VDQH 4P99A 4L8SC 4X6FA 2DLTA 3M17B 3MJGX 5GZNC 5BRZD 5I71C 4UT9H 3G9AB 3L7FB 4JM4H 2ADFH 5BS0D 3LQZB 1U8OA 3QULA 4AIXA 1S9VA 5MENA 1WZLA 4G9FA 2ESVA 4GRLB 2JELL 3MACH 5TE7H 3IRZA 3PUCA 5FYLD 1OSZA 3TJHA 4YK4B 1A9EB 4KUZL 4Q74A 1YPZB 2XRAH 2R8SH 3R0MA 2H2PD 1N59A 1AI1L 4PJXE 1FH5H 5DT1H 3VXSA 4PTTA 4IM8A 2C3VA 3OAZH 2XNAB 1P5UA 5EOCL 1KIPB 2CJUH 3L7EA 4PPTA 5F97E 4N1EA 4LPTA 1ZSDB 3TV3L 5BO1L 1AXSB 1EGJH 2FD6H 3EFFB 2VE6A 1F00I 4FQQB 2UYLB 4CUCA 3P9MB 4MDJB 5J6GB 3PQYB 5L6YH 1OTTC 1X5XA 1OP9A 1A22B 4JZNB 4PJFF 1PKQA 3AAZB 4WUUA 2PW2A 4JRYB 4WHCA 4Z77A 3F7VB 1G9NC 3RY5A 3DROA 3DX8A 4NZDA 3GBMH 3TJEL 5D1QA 5ID1B 1X5HA 4L4TE 4HCRL 1JTTA 3QHZH 4P57B 3SHSA 4DZBA 1ZA6A 4LSDA 1YDPB 3JWOL 1FFPA 4LPXA 1ZKAA 1QFHA 4FTVA 1D6VH 2V2WB 3BP6A 3OKEA 3SKJH 2BY0A 3HN3A 4OM0H 1J0JA 2F19L 5H37H 3QDJA 4NZUL 4X4MA 4OAWA 4ORZC 5EO1A 3MJ6A 3WIFA 4JB9L 3EDJA 4RGNB 1CDGA 3E2HB 3DV6A 3S37L 3P73A 4WW2A 5J6HB 5FF6A 3VD5A 5KSBF 3JV0A 1AGBA 1VFAA 4IRSD 1G6RA 1GC1L 1F4WL 3FL7A 3BP7A 2F54D 1N6UA 5BXFA 3ARYA 2NXZB 3TIEB 1ZTXL 4O2CA 3C09C 4WFGD 5I8CB 1FL5B 1KJ3L 3VMPA 4F9PA 1OD9A 2C7UA 1A2YA 3BKYL 4LIQL 2OSLA 4YAQA 4EBQL 4PIRF 3SDAA 1I1AD 3PV7A 3TJHC 1VKXB 2EYSA 5JNYA 3PGFL 4TRPL 5KSAB 3BE1H 2NY4B 4XP1H 2CK0L 3RKDC 4QHNB 4QRSA 1LO2H 3DVGA 2NW3A 5IM7A 3VFRA 3ESVF 2ITCB 4LEXL 4I77H 4JVWA 2UWEE 3ZKND 4MLSA 1NEZG 3V9FA 3WMSA 1DBAH 3TCXA 1BX2A 5D7JB 3O41A 2VDNL 4MVBC 1NBYB 4PR5B 4LCCC 4NZRH 1DUZA 5GS1B 3MRJB 3O6LH 3ZKMD 4ZFFA 1DVFD 1AGFB 1JGUH 1RUAL 4R7NA 5JLZA 1WC7A 1MAMH 4ALAL 1ZWIA 3IDXH 3T2PA 1QRNA 3HG1D 4ZAKB 5E5MB 4NNPH 1IGIH 4MGXA 5CZVL 5HD8C 1A64A 4PJ5D 3DRQA 2A9ML 3P0GB 2JB5L 4HJ0D 1LE9B 4WY7L 1JZ4A 2NX5E 4R0LA 1RK0B 3G08B 2PXYD 2DRUA 2P7TA 3MJ9H 5A2KH 4QRPA 3OKDB 5IVZB 3DIFB 1K4CB 3KPSA 5IQ7H 3IS1X 4LCWE 1N7ML 4JY5H 2CGRH 1KPVA 4HEME 1IAKB 4JFOB 4WO4A 1HYSD 1RFDH 2R1WB 4NC0B 3W11C 3WFEL 4U3XA 2NTFB 4KZDL 1LQSR 3JTTB 2CXGA 4K7PX 4X7EC 5IFJB 1NMBH 1T22B 1G7LB 1U92B 3OAYK 4I0PA 2OMBA 4WW2C 4AQOA 5E4EB 1RU9H 4ZUTA 3T77A 4F33A 3BZFB 1IM3B 4ETYA 4LASL 2EDNA 1IQDA 3QCVH 3FO1A 4RZCA 3C5ZA 2PNDA 4UTAL 4M61B 4X6FB 4F9PC 1F58H 1DLFH 2I25N 4J2XA 1QPXA 4QTHB 5F7KC 4Z7NF 4F3FA 4HMEA 3BKJL 5T1DL 4QHKI 5D5ME 1KXVC 1U8OB 1B88A 4R97B 3QULB 2AV1A 1T83A 1S9VB 3TBWA 4G9FB 4Y4FD 2ESVB 1BIIA 3LVEA 3ROLA 3PF2A 3FT2A 1BQHB 2YN5A 1OSZB 4DKEH 2FB4L 2EDYA 3EFDH 3SJVD 1ETZA 4ONHB 4ODSH 4C55A 4G6FD 2Z91A 1HEZA 2G60L 1UWEH 3WFBL 1N59B 3SDXF 1LQVA 4F7CA 5HHMA 3BMVA 4PTTB 3MV9E 4RRPA 3KYKH 1OPGL 1P7KA 2C3VB 3U4BH 5D4QA 3N06B 3L7EB 2HRPH 3ARTA 5TGBA 5I1GL 1YEGL 2OR9L 1YECL 2VE6B 4I2XE 5DQJA 4NKMA 3O3DA 1BOGB 3E0GA 3V7MA 4OF6A 3GIVA 3QQNA 1EZVY 1PKQB 2QQNH 1S7WA 4G8GD 5JW4R 2PW2B 5EORL 3U4EA 1VB9A 3DX8B 4UAOB 5D1QB 3NIFF 5GSRA 4DZBB 1ZA6B 1RIHL 3CU7A 4BELD 1ZGLP 2EDWA 3V7AG 4FTVB 5C8JA 3OKEB 2DQHH 1FE8H 2BVYA 3UZVB 3VI4F 5IGXL 4HKBA 2G2RA 1RULL 3U7YL 4EOWL 4OAWB 5IROC 5SWSA 5EO1B 3SOBL 3WIFB 2YWZA 3MJ8A 1EEQA 1MHEB 4FQJH 4LSTH 5T3XD 5B4MC 1S9XB 4HK3J 2XT1B 3ERYA 3DV6B 2JCCF 2V9RA 4OF3A 3P73B 4WW2B 5FF6B 4U7KA 1VFAB 1G6RB 3MV11 3CFCH 3BP7B 3SGKC 1J1XL 3F6LA 5JO5B 3HAEB 4FFWD 4L1DA 1NCUA 3EYSH 3FAWA 5M7QA 3TH3T 2X4QA 4NO0A 4LSSL 4O2CB 1T83C 3QPQD 2AJVH 3QQ9D 4XX1G 3TF7C 3AU1B 1ONQA 2C7UB 1A2YB 2VLJE 2AJYH 2OSLB 4YAQB 2UZYB 2WUCH 2Z31B 2XQBH 4WHYH 3SDAB 1QSFE 3KPRD 1AKJD 4PJCF 3RVXD 1LEIA 2EYSB 5JNYB 3C08H 3HPLA 1TTGA 1YEKH 5IM7B 2NW3B 3DVGB 4LLQA 3ULUL 1FYTE 1Q9OA 2GUOB 2R0LH 3HA0A 4M8VA 3S3JA 2Y25A 3EYUH 2OLDA 5ESAB 2N1KA 3DI3B 4Y2DA 1BX2B 4YHPA 3MODH 5EDXA 4OCSL 3IFLH 4XMKL 3LB6D 1KJMB 1TNNA 3B4NA 1DUZB 3FMGH 2FEEI 4HS8H 4ZFFB 1PKOA 2DI8A 3PXJA 5KAQF 4XZUA 3T3MF 4R4ND 4R7NB 1WC7B 4H20H 1ZWIB 1ZGLM 1HHJA 5KVEH 5F7WC 5C7XL 1RHHB 5GZND 5K93A 4X9HA 1QBAA 2APWA 2OQJA 5LWYL 2E6PA 2CKBL 4LOUD 4Y7MA 4Z7WE 2FJFA 3CCHA 4Z0BL 3QWRD 3KYOA 1JFQH 4R0LB 4JCMA 2YPVL 4P9HH 5H94A 2P7TB 4QRPB 4XC1L 2R4RH 1CG9A 5HGBB 2ERJB 4WO4B 4JKKA 4R6UA 4U1HA 3WJJC 5EOQH 2CIIA 1I7TA 4IEFB 5LGHH 2ZUQC 4LDLB 5GGTL 5IHBA 5IBTL 4FQHA 1K5NA 4J3VA 3GSNH 3SBWC 3C9NA 4I0PB 2A6IA 4ZUTB 3T77B 4MA7H 5LVEA 2NTSP 2DQTH 2Z93A 3UTSD 5C08E 4JFZH 4ZO9A 4MJ4A 1IQDB 3OSKA 1CGTA 3C5ZB 5B21A 2IAMA 2FX8L 3QJHA 2FH6A 1ZS8A 4UT6L 1R3LB 1QKZH 3QUZD 2ZUVA 2AV1B 1U9KA 4TQEH 3TBWB 1YN6A 2VXVH 1KN2H 1BIIB 1U91A 5ILTL 4GAJH 3ROLB 1GPOH 5C0FA 3FT2B 1WBZA 4Z7UE 5EUOE 1A8JH 2GJ6A 1ETZB 3MRHB 1XT5A 4GG6B 2Z91B 1HEZB 25C8H 2CO6B 4FFVD 1JPSL 3PDOA 5HHMB 4F7CB 1BBJA 1KB5L 5D8JH 1NCNA 5EO9B 5AZ2H 1P7KB 4M6OL 3NFPA 5DD3H 8FABA 4OZIE 2BSED 5B38G 1C7SA 5HHVH 2LE9A 4JG0L 5DQJB 4NKMB 4NKDA 1KPRA 3O3DB 4S0UC 2LAAA 4YXKL 3EUUA 1I85A 5HVHB 1DQJA 1S7WB 3UBXG 3V6OA 3U4EB 4Z7QE 5FFLA 1BQUA 1JMZA 3BRDA 3WFZA 5E00A 1CK0H 2IPUG 5DHYA 2NW2A 5T1LA 1C7TA 1J11A 3KVQA 4Y5YA 5GSRB 2A6DA 4FFYL 1L7IL 1CICA 3U36A 4Y16D 1MJ8L 5C8JB 3WDHA 5IG7A 1PLGL 4HKBB 2G2RB 2X10A 5F44A 3CUPA 1FNFA 1YJDH 4FZ8H 5SWSB 4P3CH 2F53A 3MJ8B 5FV1L 4QGTA 2W07A 1O7VA 5GQBA 4QRUA 2ZUUA 5TDPB 2IEPA 3S3PA 4HZLA 1INQA 1XAUA 5TF1H 3A6BH 2BOCA 1RIVH 3ORJA 4PJ9A 4NQUA 5B39A 3L9RB 5F96H 3ZHLA 4HW6A 3GKWH 5H2BA 3U83A 1HKLH 2X4QB 4BSVA 1B4JH 5H37G 4GQPH 2MFNA 4JKWA 2M8XA 4OCLC 5DC4B 2VXTL 3NGBB 5GRJH 1V5JA 3BJLA 5EIVA 5KVFL 5C6PB 1TENA 1PW3A 3GJEA 5DD1H 1SJVA 1LEIB 2R0ZH 2E9WA 4WWKD 3HPLB 4LSVL 5KZCD 2CLZA 1QVOA 3FB8A 4MA1B 4NQDD 4G5ZL 3V4VL 1KGCE 4PB0L 1Q9OB 1IZKA 3CLEL 3TA3C 2ZCKH 3AVEA 3W0WA 4QTIL 4XPHL 4EN3A 2J88L 4Y2DB 1CR9L 3LEVH 5JW3H 2EH8H 1UWGL 4YHPB 4KC3B 4GBXA 5FV2A 5CLTA 3LD8B 3TN0C 3IDYC 5EC1A 4JJ5A 4WTXA 3WNMA 4XNXH 1QNZL 3F7YA 1FNGA 4ODHL 1JF5A 2UVFA 3BDYL 4OV6F 2AXFA 3EIFA 4XCYA 1T3FB 5CIPB 3D18A 3CK0H 5HYSA 3C6LC 1HHJB 4WU7A 3PDDA 2OQJB 2QHRL 1KYOJ 4HSQA 5I16A 3ZYJA 1W2KT 4DEPB 2FJFB 2Y7QA 3CCHB 4ONOA 5I1IH 5CP3H 1CE1H 3KYOB 4Y5YC 1C1EH 1MCDA 1XF2A 5H94B 4NN5C 4CMHB 1CLCA 1UENA 3EZJB 1RMFL 4UBDD 3WNLA 1KBGL 2R4SH 3LHPH 1CG9B 5TE6H 3HC0B 4ZXBC 1NLDL 4JFQA 1F4XL 4U1HB 5C0AA 2CIIB 3T4YA 1I7TB 4LPCA 2YD8A 1MFBH 4X6CE 3KR3H 3TFKA 4UINH 4FQHB 1K5NB 4M43L 1OCWL 4I8DA 3C9NB 1RZIA 2Q76A 5IB1A 4TSCH 5AZEH 5KVDH 2A6IB 3CFBA 4HBCL 5T1MA 3K2MC 2Z93B 3H42L 4OCNC 2FX9H 5JZ7D 3IAGC 5DJ6A 5IMKB 1EUUA 3S3SA 1AD0A 3QUXA 1CDIA 3GSUB 3QCTL 2HJFA 3CXDL 2IAMB 1DBBH 3G6JE 4JHAL 3NPSC 4KXZI 3WD5H 3QHFH 1DN2A 4M5YH 1PZUB 1ZS8B 3BH8A 4MMZC 5M94B 2DQCH 4XNMA 1P7HL 1I9RL 4L3CA 4OLYL 1IFHH 4PD4J 1FCCA 3IVKA 1G1CA 2UV3A 1A5FL 1MF2L 1U91B 1LE5A 5C0FB 4FABH 1YQ2A 2FGWH 4DZ8A 1WBZB 4H8WC 2XIDA 2F5BH 3EYFA 2GJ6B 1A7PH 3L6FA 1EFXD 1GC1C 1PY4A 4RX4D 4DVBB 2P4AB 4HQQL 5HXMA 3PDOB 4A2LA 1X5LA 2BNUA 1MELA 4ZUSB 1BBJB 3OR6A 3SDCA 4MHHG 3NFPB 4HUUA 1ZANL 5ADOH 4PUBH 1KCKA 8FABB 2FGZA 5D1XA 4G6AD 1IGTA 2F5AH 1NAKH 1AO7D 3DURA 7FABL 4X7FC 4NKDB 1KPRB 1Z9MA 1FAKT 3ZDZF 3PDGA 1WLHA 1TQBC 2XN9A 5JQHC 2W9EL 4YHML 1Y6KR 1DQJB 3SDDC 1GGIH 2DJ4A 1R5WA 5E00B 4PTUA 3ZDXF 5DHYB 2NW2B 2F54E 5T1LB 3VH8G 2HN7A 4XP4H 4Y5YB 2A6DB 5JR1L 1CICB 3U36B 2GEEA 2IMNA 3VGDA 1B0WA 1BVKA 4JFEE 3RVUD 2P8LA 4HWZA 4S1DC 2J6EL 5IG7B 1BREA 3CUPB 1RUQH 3LKOA 1OAXH 3DETC 3FOLA 2F53B 2H8PA 3RJQB 1BZ9B 3SDYH 4X7SH 3GBLA 4QRUB 5ESQA 4HZLB 3RWGA 1INQB 3CGTA 5HBBA 3P2TA 2BOCB 4PJ9B 12E8L 3X3GH 5H2BB 1L4IA 1CE6A 3KDMA 3WL9A 3PP3H 1NGZB 4PLKC 4G3YL 1SJHA 3AMKA 4WI4A 3NPSB 3K1DA 2V7HA 4UIKL 3UZQA 2Y5EA 3ILQC 3VD4A 2XA8H 1TXKA 4UT7H 3W39A 3UMTA 2B7DT 2F58L 3HG1E 5E03A 5TJWK 2CLZB 1QVOB 3FB8B 4OV5A 3BP4A 3MLZH 15C8L 3PGDA 4X5LA 4PJ5E 3E6FB 5MEPA 3ZHDA 5C0RH 5KW9H 4RMUA 3B8YA 2QEJA 3W0WB 4EN3B 1Q0YL 4PRHA 3SDCC 5F7DA 4JFFE 5EU6D 3BISA 4ZD3H 2CK2A 1RUMH 4GBXB 3OKMA 5E8PB 4WHYG 5D1XC 4V2BA 5ESVB 5F3HA 4HJJH 4JJ5B 1IC5H 3CDFA 4FQXC 4XC3L 2QQLH 3X11A 5F7NC 4XXCC 3F7YB 1FNGB 4QOKD 4GXUM 1TETH 1NLBL 2AXFB 1FQ9C 4YHNA 5CINL 3D18B 4KVNH 2B8OT 5HYSB 1NFDF 2PETA 3HRZA 5IVXE 5DWUH 2EC9U 4KKCD 2CDGA 4WU7B 1QPPA 5GRYA 2YKLL 3DARA 3N85L 4BZ1L 4YE4H 5E2WH 2VWEC 3ELAT 1ZK9A 2Y7QB 2OL3H 4H1LA 3GMQA 4BQ6A 5C9KA 1XF2B 3BPLC 1A21A 4IOFD 4HKXA 4R26H 3VWJA 2R1XA 4U31A 4NZTL 2DQFA 1ZLVH 1QA9A 4JFQB 5E8NA 5C0AB 4EQ3A 3T4YB 5FO9A 1URLA 4MJIA 3CFDA 1T6VN 1FFNA 1MI5A 3MBXL 1RZIB 3GNMH 1WGOA 5IB1B 4PLJC 1J87A 2EECA 3CFBB 4LVEA 5T1MB 1ES0A 3BZDA 4EDXA 5DI8A 1M4KA 4Y4KC 4OJFL 3GSXA 4KTEH 2CKBA 2I9TA 1AD0B 3QUXB 4KY1L 4NC1C 1AHWA 3CSPA 3ECBA 1B90A 5IFAL 2HJFB 2NY1C 1P4BL 3D85A 1ZVSA 2QSVA 1JHLH 4NGHL 3X13A 1DSFL 1N26A 4P23C 4AEFA 2NXYC 3BH8B 2PO6A 3PL6A 4KK8D 4XNMB 2EH7H 4P2RE 3BPNB 2WLZA 4L3CB 4JGUA 1R3HA 1MRFH 3IVKB 4PJBF 2ZOKA 4LRNL 4C54A 1MFEH 1DQMH 1MREH 4LCIL 5F72S 1LE5B 5GGTA 2EZ0C 3MMEB 4DZ8B 4P2OD 4F8QA 3HNTL 5ALBH 4MQXC 1GYAA 3EYFB 3IFOB 3L6FB 2HLFC 4I18C 1I3VA 2AKRB 3WSQH 1HZHH 4NPYA 2CUMA 2DM7A 1V7NL 2YD7A 4XBEL 4ZFOL 2BNUB 2DIBA 2LFGA 4Y1AA 4HUKB 4RBPK 3OR6B 1LO3H 2LAGB 1VSCA 4NHCL 2B4CC 1YNTA 4HUUB 2NY7H 4NN7B 4WHDA 5IW1A 3WIIH 5D1XB 1IGTB 1KXTB 3NH7L 4DN4L 5ACMA 4CN1A 1FORH 3HC3L 2J1KA 3DSFH 3MNVA 3DURB 1QBML 4BFBD 5C0IA 4OZGA 4PJFE 1NSNL 4N0CD 5MEOA 4X8JA 2XN9B 5FYLH 4KUCD 4Z7WA 1TZHA 5DJ0A 5EZOH 4J1UA 1KCRL 1R5WB 2NX5B 4PTUB 1ACYH 4ZS6D 3RX7A 4R9HA 3AGVA 5DEFA 1FNSH 1ZGLA 4X7TA 2HN7B 1X5FA 3EO1A 1B2WL 3SGDI 1QBLL 3NIDF 1WUNT 3RU8H 1NBZA 1A7QL 3L95A 4KROC 3ES6A 1KB5A 3CVHL 2ZG2A 3NA9L 5KOMC 1BVKB 5K9JL 3KXFA 4HWZB 2DN7A 1G7QA 1NGPH 4E41E 2C26A 3DV4A 3KPRE 3LKOB 3CFJA 4G6KH 3FOLB 4U6TA 3LQAL 2VOTA 4PRIE 5KSBE 3A67L 4OZFH 1ZT4A 5ESQB 3RWGB 4ESKA 1UFUA 2AJSH 5F9OL 4DFHA 1U8KB 4YFLI 3QYCA 2YWYA 3VFOB 5C70A 2X1OA 4X6DF 2X89D 4GW5A 4ELMF 4GMSL 3VFMB 1KN4H 3T3PF 3KDMB 1LO0H 4I3SH 3PGCA 4UOW0 3WL9B 4JR9H 3IB4A 1SJHB 5CJQL 5BQ7A 4HGWA 1JGEA 4V2CB 1NBQA 3QAZB 3EO0A 3O9WA 4JZJA 3D25A 3W39B 1HXYA 3H3BC 1M7IA 4ZXBD 2X1QA 3WLBA 3BP4B 3RX8A 1KYOK 5DRNA 3PGDB 2CRZA 3K8KA 2X4RB 5MEPB 5E9DA 4U1KA 1OP5K 3UTOA 2P45B 5FIEA 1VPOL 2AW2A 4PRHB 4ZUVA 3QWQB 5F7DB 3WNKA 1JZ8A 1J5OH 2MKWA 4K7FB 4LKXA 1J0HA 3AUVA 2A77H 3CVIH 5D7LE 1YY9D 3RAJH 3X11B 3MV9B 5J3HC 1Z6JT 3BPCA 3ARDA 4MQ7B 4YHNB 2AGJH 3ETBF 3UPCA 3HRZB 2CDGB 1X5IA 5DJAA 1BGXH 2MQ0A 4O4YL 3LKQA 2VLRA 4P9MH 3UXFA 4OI8A 1UACH 4QYOA 4H1LB 3S98A 4P3DA 1E28A 1XGQA 3MTRA 1OT1A 4J4PC 3WXVH 3KPOB 4FG6D 4HKXB 4P4RA 2R1XB 3VWJB 1KIQA 1KTRL 3TVMA 5JOFA 2AQ2A 3IXAA 2NCMA 1QA9B 2XFXA 2MCPH 5E8NB 1MLCA 2FSEA 1X6LA 4JPIA 5FO9B 1A6VH 3G5YB 3IU4H 4NNXA 3OJDA 1LDPH 3I9GH 4PD4K 5INCB 3CFDB 2CR6A 1FFNB 5EOTA 4MAUH 1MI5B 2ZUWA 1SBSL 3FTGB 3Q5TA 4FQ2L 2EC8A 1ES0B 2MTPA 3RTQB 2DQGH 1MHHA 4QXGH 2IMMA 4PY7A 4WJ5A 4JN2B 1RZJL 4LU5L 3GSXB 5LG1A 2CKBB 3L3KA 3QEQD 2I9TB 3F8UB 1AHWB 1NCDL 4U1JA 4WU5A 4Z7NE 3D85B 1ZVSB 2KZWA 3X13B 2CRYA 4JO1L 2WZPD 1MCOH 2KZ1B 3HI5L 1DN0A 1XIWA 2PO6B 2DQEH 3PL6B 1ITCA 4U1NA 1I3RA 4C59B 4JKMA 3O3AA 1INEL 5E6ID 1R3HB 5I73B 4PP1C 2X4OA 1J0ZA 2VLJB 2EEAA 3PNWA 3WXWH 2OCFD 4YBHA 3VFVA 3KLHC 1MAJA 2XZQH 3QEGH 5C07A 1BF8A 4K3EH 5DO2D 2VDLH 5GGRA 1INDL 1IKFL 1YPZF 3SDXE 4MD0A 3ULVD 1BQLL 1C5DA 4NPYB 1BAFL 2I24N 4KJQC 4WFFE 3SE3A 3OKKA 1I3GH 2HT4C 3LIZL 4RGMC 4Y1AB 3P30L 4L5FH 1N6QH 2J2ZA 4FQIH 5TE4H 1NCBL 5FAAA 4U3CA 1VCAA 4L8DA 1NBVH 5ACZB 1BEYH 2VR4A 3S88L 4XPGH 3MNVB 3TWCH 4GLRI 5C0IB 2BVTA 1OSPH 4OZGB 1UADC 5T1KD 2I60H 5MEOB 4X8JB 1MWAL 2H45A 1H5BC 2AEQH 4MB3A 4Z7WB 1TZHB 5DJ0B 4J1UB 3ILQD 4IDJL 4OFKA 1I1RA 4H0IA 3QH3A 5F8QC 5JHLL 5FO8A 5DEFB 3V95A 2HWZH 3EO1B 4JDTL 1QFWH 3VI4E 1NBZB 1JIBA 3L95B 4YPJA 3ES6B 1KB5B 4OQTL 3KXFB 3RPKA 3EYSL 5F3BA 4XP6L 1JI1A 1C5BL 3E3QE 1G7QB 4DW2H 3DV4B 3CFJB 2GYSA 1ADQL 3WIHA 4DTGL 1ZT4B 2DQDL 3EJZD 4LSRH 1B0GA 1NMAL 2HFGL 5FYKU 3RNQA 4XWOC 4DQOL 4UB0L 3D9AH 3K8LA 1OTUC 3IXTA 4OT1H 4QXUL 1CD1B 1K4DA 3O11A 3SKOA 2JE8A 4XVUD 4OCRL 3CX5J 5C3TA 2M1KA 3MYZA 2X44D 4GQ9L 3WS6C 5BQ7B 1MJUH 1LGVA 4HGWB 1JGEB 3EO0B 3O9WB 4JZJB 4ONGL 3D25B 2V17H 1HXYB 1M7IB 3WFCH 2J6EA 3WLBB 1OHQA 4O9HH 4UNTA 3EHBC 5T3XH 2VDPL 1YMME 5FUCE 4PJGA 2GT9A 4U1KB 3KS0H 4BSWA 1BM3L 5KVEL 1PX4A 5L7XL 4JO3H 4ZUVB 5IBUG 1N5YH 2Y36H 1NEUA 5F1OB 1EEUA 1YYLL 5J56B 4LKXB 2C1PA 1TVHA 5J7CC 3S97C 3MCLL 3T3ME 4D0CA 3F6IA 1U6AL 1BVZA 1ZT7A 1SBBA 3ARDB 1WFNA 3K2UL 5FA4A 2NY1D 3GRWH 3IKCA 1KCSL 5DJAB 5EU7C 4YNYA 4P23D 3MYJB 3LKQB 1FL6B 1T5XA 2A1WH 2VLRB 4FQ1H 3QDME 2ZJSH 3FB6A 2BFVH 1E28B 1XGQB 5AAWA 5I1JH 4TNVF 3B43A 5D2LA 3CD4A 5ITBL 3L3DA 4P4RB 2J12B 3CC5A 2QTEA 3RP1A 3TVMB 3T2QA 3IXAB 4OCXH 5CZXC 3ISWA 1MLCB 2FSEB 4LDEB 1GIGL 4JPIB 2YZ8A 4NNXB 3OJDB 1LD9B 5D1ZA 4JFEA 3FCTA 5EOTB 4RGOH 1FO0H 3MROB 1T03L 1T04A 2BERA 3QDGE 1I4FA 2YXFA 4W6WB 1UKTA 1SJEA 2PCPA 3PV6B 3Q3GA 1MHHB 2VISA 4WJ5B 4RMQA 1A3LL 4GAJL 3C60A 2IBGA 3L3KB 5CCKL 1UH2A 1YEEH 2ZCHH 4DAGL 1WBXA 3FO9A 4U1JB 5ADPH 2QKIA 2CDEB 3WN5C 1U8JA 1FGVL 1S7VA 3SGJA 4KK9C 4CKVX 1DN0B 4NJ9L 4C56D 1XIWB 3F5WA 4U1NB 1I3RB 4OKDA 5GJTH 3O3AB 5I1KL 4I5BA 1MRDH 1JHTB 2X4OB 1KTKE 1PZ5A 1UB5A 3QIUA 2NY5C 4LHQB 3O2WL 4K8RD 3PJSA 4NKOA 5GGRB 3QCUH 4Z7OF 5JTWA 1M1SA 4D3CH 1S9KC 2AEPH 1C5DB 4XHQA 2AV7A 3R06A 1LILA 2AK1L 2C4FT 4X6BA 3P9LB 4KMLB 3C87A 4CVWA 3TT1H 1G0XA 2X70A 3L5HA 3OKKB 2DD8H 4LMQE 1X4YA 4JFFA 2BXZA 2P5EA 3HLAA 2A83A 3VFGH 3S6CA 4Z8FH 4GRLD 1JF1A 4GKNA 1DL7L 5B38A 3B3IA 3EYQD 1CBVL 4JDZA 3JWDL 1A47A 1N64L 4OIIL 5A2FA 4UDUA 4F7TA 2AJ3A 4L8DB 5C0EA 1CGSL 3V79C 5T5FH 3GSRA 3M1BA 1U8IA 1U3HA 3LKPA 5IR1A 3CH1A 3UBXA 2N7AA 1ITBB 1JN6A 5SWZE 4CDGC 5JW4N 2AQ1A 2AK4A 1CF8L 3O6KL 3QH3B 5FO8B 1EGJA 4KDVA 2DLGA 4JRXE 4JCLA 4ZFOA 4M7ZC 1UQSA 5JXEC 1RIVL 3MFFB 3WUWA 2XTJD 1JNJA 4L3EE 4X6CB 1XCTA 3PQYD 5F3BB 3K7UA 1BFVH 3HNSL 4M7LT 4JRYD 4OLZH 4POZC 1S7XA 5GRJL 1TQCB 4HFUL 4WW2F 1FZMA 1PAMA 2YD4A 2DI7A 4XVJL 1B0GB 1T1ZA 5DDHB 4A6YH 2GY5A 3OGOE 2J3SA 2K7PA 1U0QA 1HHHA 3FO0H 5HI3C 3IXTB 4QY8A 4AL8H 1K4DB 4PJ8C 2ARWA 4XTRC 1Y6MR 3SKOB 5AWNL 1SYSA 5HHOE 1JCKA 3QIUC 4QOKE 3ILPA 4RWYH 1J10A 1NCTA 3QQ4A 4JO2L 4OZFG 5GGQH 5GGUA 3VXUA 3CVHA 3VXMD 2EIBA 4JG1H 2NXZD 2GT9B 4E5XA 2MQCA 5GXBB 5E6YA 4N5UA 2R56H 1P6FA 1IGYA 2NY0B 3HB3C 1S78C 3D39A 2M2DA 2C1PB 1TVHB 2AJUL 2CD0A 4OGYH 4D0CB 4S2SA 2D7TL 3B2UD 3FHAA 5KSAD 2NY4D 1ZT7B 4OKVA 1U3HC 4HGKC 4LSUH 5GHWH 2PYEE 5FA4B 3IKCB 1Q1JH 4KDTA 4PJEA 4HWEL 1U2HA 3L3OA 3T1WA 5D7JD 4JM2A 1T5XB 1UB6A 5J89A 1A9BA 3RI5K 3C2AH 3FB6B 5JDSA 2EIZA 1HCVA 2ZKHL 5D2LB 4Z95L 3L3DB 2E7LE 3BRFA 4FFZL 5DMKA 3CC5B 4LLAA 5AZEL 2DBLH 4OGXH 4YHKH 1P7QA 3G6AA 5C86A 3H9ZA 1OGAE 1RSFA 2CUHA 2JB6A 4OTXH 1H3UA 4XNZB 2WNGA 4B0MM 4YLQT 5FYJL 3B9KB 1G7MA 4DK3A 5D1ZB 3NCJL 4JFEB 4KJQD 1A6UL 1DBBL 1J8HE 3FCTB 4DGVH 3JV6A 1FVEA 1J18A 3BPOC 5ENWB 5JUEH 4M1CD 3QXTA 4WEMB 1I4FB 2ZG1A 4JZOA 4PRIA 2PCPB 5F9AC 3DYOA 3Q3GB 3QHTC 4K3DH 2VISB 4M62L 3OHXA 1JGLH 3QEUA 1CFTB 4NJAH 3C60B 4F9LA 4A2MA 2I07A 1U8JB 4YHYC 1S7VB 5A2JH 2WWMC 3HE7A 4EI6A 2SEBA 5HYQA 1KF9B 3M45A 2DWDA 5C9JA 3GMPA 3F5WB 1EX0A 2K7QA 4X83A 4LQFL 4I5BB 3VXOA 4HGMA 2VQUA 1B0RA 3HE6A 5T3ZL 1PZ5B 4ETQA 3NIGE 2BY2A 3NTCL 4U2ZA 5DMIL 3V4UH 3PJSB 4NKOB 1Z9OA 2EDTA 2N7BA 2R69H 3PWJA 5AUMA 4LPVA 4K7PY 2AV7B 3R06B 2W65B 4X6BB 2X70B 4JFFB 2BJMH 5E99H 3P0VH 2FWOA 2P5EB 3HLAB 5T33L 2A83B 1HQRA 1J0YA 1N3NA 2ESVD 4OF8A 3VU2A 1JF1B 4GKNB 5B38B 2DLHA 3B3IB 2JJTC 4YWGH 4KDTC 3QG7L 4TSBL 3EOBA 1O5DT 4UDUB 4F7TB 2AJ3B 3BMWA 2UZIH 1B6UA 5C0EB 3ZDZE 4JM2C 5BW7A 3HMWH 4MQTB 5EU5A 3GSRB 1F3DH 1U8IB 3LKPB 5I1DB 5IR1B 3CH1B 2C4FU 4C83A 3UBXB 4LNVA 1JN6B 3ZDXE 4I3RL 4NWTH 3VH8A 2X4NA 5HYFA 3CAFA 5FXCH 5IB5A 2FATH 3SDYL 2QADC 2ADGA 3L3JA 4K9EH 3L3IA 4ZFOB 1GHFH 1UQSB 2ICWI 2X1XR 4O00A 3UJJH 3FT4A 3CX5K 3SGEH 3BQUD 1JZ7A 3WUWB 4YDIL 3BN9D 5IBLC 3OR7A 2AP2A 2E7CA 5D71L 4MX7A 3SE8L 4RSVA 1ZLUK 4M3KB 4YC2B 4LRIA 4KKAD 1NAMH 4NO5A 4X99A 4AZ8A 2VITA 3DECA 1S7XB 4O02H 2KPNA 2DQUL 2EDFA 4F8TA 1FZMB 5D1QD 4F57L 2F9BT 1T1ZB 3OF6A 1FFQA 3DUUA 3HFML 1BJ8A 1KT2A 1MWAA 2WIIA 3HMXH 1WFTA 5F9WC 4Q9QH 3IDUA 1HHHB 3SPVA 5CD5D 4QY8B 5I75C 4DGIH 1VACA 4GKSA 4NRYA 4KJPD 1IQWH 4EUPB 4LFHD 1EZVX 6FABL 3I6KB 5I8EB 3UBXI 4MD5A 1KUMA 3KYNB 3ILPB 1T7VA 4NQCE 3WO3B 3QQ4B 4BJLA 3VXUB 3CVHB 4OQTA 1IC5L 2YMXL 4BA8A 2FBJL 1RPQA 1X5ZA 5C2BL 5LJYH 2DTMH 3WLWC 5F1NA 1NCCH 3V0WL 4GXVH 1UWXK 5DFVC 1NKRA 3ET9F 1ADQA 1KC5H 4E5XB 3X3FH 1IGYB 3D2UD 5BV7L 3D39B 3NACH 1CGUA 2Z31D 5C0GA 4P5TA 3JVGA 3LZFL 4S2SB 5BW7C 1NFDE 1KJ2H 4FRWA 4OKVB 4RFNC 1X5AA 4N8VG 2ITDA 4PJEB 4PBWD 3RIFF 1MLBA 3L3OB 5E2JA 5DA4A 4XI5C 5FGCB 1X4XA 4G7YL 1UB6B 4HFWA 1LEKA 5I1LB 5JDSB 2EIZB 4H88H 3UTQA 3H3PL 1T0MB 3AY4C 3QEQE 3A6CL 3ARGA 5DMKB 1ZEAH 2XQYK 3REWA 1DP0A 5L0QB 1P7QB 3D69A 2OZ4L 1GAFL 1NUNB 5L9DH 2JB6B 1Q0XH 4NM4H 2VERN 4RIRA 4PB9L 4W6XB 5I1CL 1G7MB 1A1OB 1WCQA 4LP5A 4NKIH 1OAZL 3TNMB 3JV6B 4R2GB 1FVEB 1WEJH 1RZKL 2V5TA 4S1QH 1YNLL 4HWBL 3EW3B 2LU3A 1MY5A 4JZOB 3BZEA 1IKNC 2NR6C 4PRIB 1TCRA 3RVTC 3T0AA 3OHXB 1DQML 3QEUB 4WO4D 2D2OA 2VZUA 1IM9B 4XH2A 4XCCL 2I07B 3BSZL 4DKFH 4R4BA 3SE9L 3HE7B 4EI6B 2SEBB 5HYQB 3P11H 2DWDB 5C9JB 3GMPB 4PJBE 3WSQL 1EMTL 5I75B 4I0PD 4PGBA 4OFDA 2VL4A 3VXOB 1BD2A 4RWHA 1YY8B 1B0RB 3HE6B 4MDIA 3CMOH 4ETQB 3H9SA 1TNMA 1F3RB 2VAJA 4EDWL 2CLVB 1KEMH 5I30H 1ZHLA 3Q0HA 5GS0L 5MI0C 5GS2D 5JXED 2ZUXA 3C5ZD 5AUMB 4XAWH 2BNQA 1YMMA 2WV3A 4Q7DA 5IIEA 4AMKH 5FKPA 4I9WD 2VXQH 5I66A 1BFTA 2CKNA 3QUYD 3V8CA 3ARFA 3BIBX 5FYLL 2FWOB 2P43B 1TZGL 1Y18A 1MFNA 5DYOB 2BRRH 3LV3A 1N3NB 4HXBL 5JIIA 4RQQA 2EDQA 2QLVB 1H3GA 4XMLH 1IAIH 3EOBB 4I4WA 3PHSA 5LXGL 1P4IH 1VGKA 1QFUL 1FZKB 4P4KA 4BKLA 4M48L 3SE4A 3QI9C 1A3RH 5EU5B 5D93C 2MMXA 3RWEB 2W91A 1RVFL 4L29A 3Q6FA 2XY1A 5HHMD 3U7AA 2HFFB 3O6FC 4ZOBA 4PDCE 3AS3A 3QDMA 4WDIA 3B83A 1A7OL 1CFVH 3VH8B 1A0QL 2X4NB 2YS4A 3NIDE 4KHTH 1SEBA 3B5HA 1QSEA 2ADGB 3L3JB 3P4NA 3L3IB 2GIYA 1UT9A 2VABA 1XEDA 3FT4B 4P9HC 1VFBA 4RA0C 3VW3H 2HAZA 3OR7B 4JPVH 1F6AA 1KENH 4IRJA 2CMRL 4MX7B 4OLUL 1YEHL 2DM3A 2O26U 3PG2A 1SM3L 3VDBA 1OP3H 5DLML 3MJ7A 4NO5B 2VITB 3FQUA 1FP5A 3QDGA 1E4WH 5AEAA 3HZYA 2HKFH 1VGEL 4X6DE 1KT2B 1MWAB 4ELME 2WIIB 4YX2L 4DOHB 3T3PE 1T89A 1EJOL 3SPVB 2XZCL 1FGNH 1CGVA 1VACB 2VXSL 4GKSB 4NRYB 5DR5L 5D96C 4GRWH 2DJSA 5JXAH 5SWSD 2FO4A 4MD5B 4YDKH 1J7VR 4L1HA 2E7MA 4IMKA 2Q7NA 4HIJA 4XPTL 2WLYA 3MLXH 4TUKL 5F1NB 5DVNA 1TVDA 4KVCL 1YEIH 3T0EA 5ELIA 2FLBT 3UTTA 5CSZA 2IANA 3O4LE 1FVCA 2NY2B 4Y19E 1JZ3A 5GRUH 1CZ8H 1GJIA 1FAIL 4UILL 3I3BA 1FN4A 4P5TB 3GSVB 1OGTA 4X7CC 2R2BA 3PHQA 4JDVA 4QRRA 1H15A 1BLNA 3PWVA 1F2XK 1XGPA 5E7BA 2ITDB 3GUTA 1KSRA 2WWMD 5D6DC 4HK0B 3VWKA 1N8ZA 4HPOL 1MLBB 5I17A 4Y2DD 4N1HB 3FZUD 3I9GL 1LEKB 1JNHB 4APQC 1QYGL 3I50H 5D93B 1JPST 3UTQB 4Y5XB 2O5ZH 2JIXD 3ARGB 3REWB 3WHE1 1P9MA 4YHZL 3WDJA 1QFWM 3D69B 4XRCA 1S3KH 1CFNB 1V8HA 3RWCA 4P5MA 4JRXA 1FG2A 4RIRB 3DX7A 4C56E 1H8SA 4QXTA 2IGFH 2RR3A 5A3ID 4J3TA 4AG4H 2C3HA 4ZUWA 5EFIA 4OCMC 4P46D 1IC4H 1FSKB 2UZXB 1EUTA 3BGMA 5I74B 4GUPA 4PV8A 1R3KA 1NCWH 1OWWA 1I8IA 1NGXA 2E6JA 3BZEB 1FIEA 2AI0H 1TCRB 4JFDE 1N4XH 2Y1VA 4LHUA 5DD6A 1YJDC 3I6LD 3QEGL 3Q6GH 3S7GA 2DDQL 2DICA 2DYPA 3K0WA 2NMSA 4G8EB 4M1DH 3BD3A 2WM0A 4M1GL 2VZOA 1QRKA 4PGBB 3WUZA 4BFGA 1F3DJ 1IVLA 2V9QA 4LLUA 4MDIB 3T0EC 5GRXG 3H9SB 2QADD 1YC7A 4UV4H 4LCYA 4YHLL 5MHSE 2IAMD 1ZHNA 2BNQB 4LNRA 5KAQG 1YMMB 3MO1A 5IIEB 2P8MA 4QWWD 3QXWA 5FKPB 4X98A 2X42A 5SV4A 1FCGA 2DLFL 2I60L 3ARFB 1HI6A 5F7MC 1LK3H 1CXLA 1Y18B 3STBA 1CXIA 3LV3B 4RQQB 4FXKB 1DBJH 2HT2C 2YD6A 4Y89A 4JFYA 4YFLF 3U1SL 3LN5A 3MGOA 4XCFL 1Q94A 4CVZA 1PYWA 1GGUA 4QRTB 1AE6L 1VGKB 4P4KB 4BKLB 1QFWL 4ZFGH 2ICEB 3A0OA 3WDIA 4AYFA 3DPBA 2O5XL 2VIRA 4L29B 3Q6FB 4QEGA 4ENEC 1P9MC 4FZEL 5L8JB 3QDMB 4GAYA 4WDIB 3TH2T 1A6WL 4F7PA 1IBGH 4TVPD 1NC4B 3MOAH 5I1EH 3ULVH 5EWIL 1D5IH 1PX3A 2Y9RT 1JGVH 1MFAL 1SEBB 1QSEB 2WUBH 5GZOD 3P4NB 1MFDL 4YXHH 2P5WA 1FYHB 5EPMA 5I0ZA 5B8CC 4P2QA 2DKUA 32C2A 5ABDE 1VFBB 3UJIH 2A2QT 1I9JH 3KPPA 3D9AL 1RJYA 1F6AB 4IRJB 1J1PH 3K46A 1XZ0A 5HYJE 4RGNE 3TZVA 5DS8A 2VLLA 4PGCA 3MOBH 2YK1H 4OLXH 1IEBA 3FQUB 2VJXA 3QDGB 4LVNC 1TPXC 5T1LD 5C0BA 3FN3A 1CXHA 3B2VL 1CICD 2VZ3A 3DXAD 3QXDA 4GAGH 5F6HJ 5FUZH 1MH5A 1P53A 5JQ6H 2AABH 2Z9TA 4BZ2H 3V5HA 1CLOH 3C5SA 2FO4B 2F53D 1MJ7L 1OAYL 2AXGA 4DGYH 4WFED 1WZKA 4U6VL 3IS0X 2P1YA 4HIJB 1OAKL 4JFPA 4R8WH 4NOFA 3CLFL 3WNNA 4PJ9D 5FHAL 3UTTB 5CSZB 5DMJB 1KCVH 2IANB 1FVCB 1S5HA 1GXEA 5ISZA 3HPJA 4TOYH 35C8H 1A6AA 2VH5L 2OBGA 4FQ1L 1FN4B 4JQVA 2XZAH 5I6XC 1OGTB 4ZO6A 2R2BB 5JIHA 3RVTD 5HHQA 1U95A 3P77A 3W82A 4QRRB 1H15B 1BLNB 2VDRH 3PWVB 3V52H 1AQKL 3TNNA 1UJ3C 1WZ1H 4RMSA 2H41A 2Q20A 3GUTB 3O3EA 3DOSA 4Q2ZA 4EN3D 3TO4B 3VWKB 5I17B 1N8ZB 1MHPH 2KL6A 1T66D 3TCLB 2BSSB 4Z76A 4KTDL 4WGWB 4RGOL 4GS7C 3ULUF 3O8XC 4NQEA 5J13C 3IFPB 2FO1A 4OCYH 3HKFA 2W0KA 5KJRH 3LRSA 2DI9A 4TNVK 4HUXA 3MCG1 4XRCB 4DWHA 3UPRA 5BCAA 4OCWH 5FYKE 5BVPL 4WNQA 1AJ7H 3VJ6A 3RWCB 2OR7A 4P5MB 4JRXB 2ATKA 4OGAD 3LCYA 3EAKA 4QXTB 2B0SL 1HK6A 2WBJA 1OY3B 5CGMA 4ZUWB 3MRCA 5EFIB 1AY1H 1WIPA 4L3EB 2VZTA 5FUOL 3BGMB 3SQBA 4GUPB 5DRZA 4N5EA 4PV8B 4MNQE 1T2QL 3MLUH 5DD0H 4Q0XL 3O2VL 3I84A 1R3KB 3KLAB 4NBXB 4AEHL 4K7PH 3VFSA 4LHUB 5DD6B 3NVQA 1EIBA 4L4TD 3UEZA 4HC1H 5LGJA 3QI9D 5C09A 1X44A 3NABH 4IS6B 3RFZC 2DYPB 3TFKD 5I18H 3U30B 5BMFL 4MXWH 1FDLH 1NDMA 1GVIA 1MCIA 2A9NH 3P0YL 5DJ8A 1J0IA 5MENE 4D9RE 4G9FE 3DUSA 2EEDA 5I2IA 4MS8A 3OL2A 5DURB 2OZ4A 4EEEA 2YD1A 2AEWA 4LLUB 5HDQH 4NQCA 3JTCA 4HEPG 1U8QA 4HULB 4TSAL 4Z7OE 3UCRA 3QUXD 4PRNA 4LCYB 3LS5L 3GFUA 2Y5TA 3MSPA 3ZZ1A 1ZHNB 3UO1H 1G9NL 3VXSE 3MO1B 1QSZA 2P8MB 3J8F7 5T5FL 3JZ7A 4X98B 4XGZA 4BQ9A 4OF5A 4OIAA 5FYKL 1HI6B 3U7WH 4NN6C 1DQDL 1DR9A 4WFHE 3IGAA 4JPWL 1AR2A 4JFYB 3LN5B 2UY6A 3MGOB 1EXUA 3RVWC 4CVZB 1PYWB 5E8OA 4X9FA 2NYYD 3V0AC 1CXEA 4HDIA 2EYTA 3N0PB 3I2CL 5IQ9B 3F7RA 2B5IC 4OZGF 4MJ6B 3RZCB 1PKQE 2VIRB 1D7FA 1DQTA 4WUUE 4N9OB 4G6MH 4K8RH 4NUGL 3LKNA 2GI7A 5BRZA 2MKLC 4Z7WF 1RD6A 4N0FA 3H6JA 4GAYB 5GISH 4F7PB 5BS0A 2OP4H 3G5XB 3OMZA 1PG7L 1CTNA 4GS7B 3BGFC 3M8OL 4FTVE 4KRNA 5LGKA 4YBQC 5EPMB 2A6JA 5HJ3A 2Z35A 4P2QB 32C2B 2FL5A 2X1PA 3QDJE 4V1DA 3KPPB 1RJYB 4PGDA 3MUHL 2EEBA 3T8XA 4HKZB 1XGYH 5DUML 5DZOA 3TZVB 4JO4H 2VLLB 1KB9K 5LBSH 3ALWA 3TIDA 2NX5D 4Y8DC 1FLRL 3UYRH 1LHZA 1DCLA 4B41A 2V2XB 4LCWD 1BBDH 1P5VA 1SEQL 4JHWH 2ZCLL 1EHLL 4KWUA 1M7DA 3IDIA 1MH5B 4LVHC 5GGVY 4HXAL 3V5HB 3C5SB 4OZFA 4KAQH 2AXGB 1WJ3A 3H7BA 4Y88A 2M26A 1OAQH 4HF5H 3N1PC 1YC8A 4JFPB 3OPZH 4PG2A 2CDFA 1AGDA 5HTSA 5A2LH 2FHBA 2LV4A 5IBUB 3KJ6H 3QNXA 1KNOA 1MPAH 1A7RH 5ALCH 5E2UL 5IP4A 5EZLA 2Q7YA 5ISZB 1QHOA 3V4PL 1A6AB 1CU4L 1O7SA 2BMKA 5D7IA 5TPWH 2X4UB 2E6QA 1FVDB 1WIUA 3ESUF 4KKBC 3BXNB 1QRNE 1GOFA 5HHQB 3P77B 3IDGB 2FEEL 3TNNB 4S11A 3L5XH 1M6OA 4XP9H 4IRSA 3O3EB 2B2XH 4Q2ZB 1MIML 5IHLB 1XR9A 4NP4L 5K9QG 4Z76B 4QRPE 3W5MA 1PFCA 2DAVA 1C16A 4NQEB 3KPSE 1JI2A 2YSSA 3MV9D 5J1AA 2XKNA 3LRSB 4WCYH 2IF7A 1I1AA 4UV7H 1AR1D 3UPRB 2VLMD 4WNQB 4ISVA 3VJ6B 5BV7B 3LKSA 1TMCA 2ATKB 2Z8WC 4N90E 3ZT7A 1FRGL 4GG8A 1I9IH 4KMTH 5J11B 2YPLA 2WBJB 3MRCB 3MREB 2Q86A 3UC0H 1B3JA 1CFQA 1AFVL 3ULUD 4HT1H 2APFA 5IJVA 3VWJD 1IL1A 2HT2D 5SX5K 2BVEA 3VFSB 1OB1A 2QQKH 3MBEC 4WV1C 5LGJB 5CJ8A 4I9WE 4GW4A 2BDNL 2LVCA 2YHGA 2G5RA 3WKMH 4F58H 1NDMB 5CJXC 2VZ1A 1MI5D 5DJ8B 4L4VA 3DUSB 3Q5YA 5I2IB 4PG2C 5K9KA 2ARJA 4FQCL 2ZWLT 1G1YA 4NQCB 3RTQD 2FHFA 4EKXA 2Y06H 1U8QB 4XT1C 3O45A 3ZE1F 4J3XA 2H9GA 5F93C 2WP3T 2MHAA 1F4AA 4PRNB 4I13B 1S7QA 1II4E 2OTPA 5E0QA 5AAMA 5IKCA 5F1KC 2Y5TB 1MRCH 5IESL 1L9NA 1ED3A 1YMHB 4D94A 1N5AB 2PO6D 3PL6D 1E4KA 3O4LA 4XGZB 2A38A 5D2NA 4G43A 1FFRA 4MJ5B 4TULH 1BJ1H 3G5VA 5E94A 2VLJD 1J86A 1F90L 3GBNL 2BHYA 4N8CH 3MRLA 4IRSC 2FCBA 3IGAB 1EXUB 1XGTA 4Z0XB 4O5LL 4OM1L 5BZWA 3TPKA 5DD5L 5E8OB 1MFCH 4HDIB 3LMJH 2EXYD 2E27H 2VRAA 1ZA3B 1LMKA 5GJSH 4GOSA 5C0CA 1YEFL 1NC2A 3SQOH 3LKNB 4KI5F 4Q9RL 2MPAL 3QXUA 4N0FB 4M6ML 1I1AC 1BF2A 5BS0B 4N68A 2FJHA 3TT3L 3GB7A 4XMPL 5EBWB 4JY6A 4AT6A 3O81A 1UA6H 4O51B 2X4PB 5KN5A 5E24E 5CUSH 43C9A 3RWDA 1WCBA 2A6JB 5HJ3B 2HH0H 2Z35B 2FL5B 4V1DB 4Q9QL 4GAFB 3GI9L 3SJVA 2FEDD 3GO1L 4PGDB 5IW3A 3D3VE 3T8XB 1WT5A 4OFVA 3TIDB 4PS4H 1A6TA 3ZKMC 1DVFC 4NM8L 1XF3A 2NY6C 1YQVH 1QQDA 3H0TB 1EK3A 4ZTPL 4JFDA 3OZ9L 4ODVL 3R1GL 5IMMA 2H2SD 1M7DB 3VG0H 1JK8B 4U1LA 3MZGB 3OTTA 1J9CT 4HJ0C 3TP4A 4HS3A 5I8OL 2YN3A 4MJ2A 1UM6H 2D7PA 3EDEA 2PXYC 4R90L 5D7KD 3VXNA 2AJXL 1P84K 3BW9A 3L5IA 1G9MH 4G8GA 1FIGL 5E1AA 4PRPE 3L1OH 3SCMD 1HYSC 1L7TH 2BP3A 2CDFB 5EN2A 1IAOA 3LOWA 4EI5A 2OI9B 5CJOL 3HR5A 4PJGF 2BC4A 3QNXB 5K33A 1KNOB 2ORBL 2CLRA 2ED7A 5HPOA 5I1HH 4QRQB 2P46B 4HD9A 2Z8VC 2BMKB 3INUH 3NCYP 2DF3A 3GK8H 3O9WD 4ODTL 1IAIM 1NDGB 4N8VA 2DBJA 5JIPA 3DX6A 1M6OB 4IRSB 1V7MH 5L9DL 3JTSB 5J8OA 2YBRA 3F12A 1OARH 4O58L 1XR9B 3RIFK 3BO8A 2WIMA 3ARSA 1HH6A 2JJSA 4XCEA 4IJ3B 2WINA 1UVQA 3HAEH 1C16B 3IF1B 3RL2B 1A14H 4Y4FC 1UYWL 5D2LF 3MRIA 1YYML 2DLIA 2XKNB 2GAZA 4M7JH 1HILA 5TQ0L 4KRLB 1I1AB 3S5LG 1AKJA 3UJTL 3N9GL 1GOHA 1H3XA 4FNLH 4ISVB 4M6NH 1QLFA 4GG8B 1AH1A 3RVVD 4XPAL 3ARVA 4ZDHB 1SY6H 2YPLB 1WT5C 2VLRD 3AS0A 2ED9A 2Q86B 1PBYA 2YEZB 4HV8A 3P3YA 1CFQB 3RKPA 3CU1A 4U2YA 4XPBH 5IJVB 1IL1B 5HDLA 3TBSA 3IDJA 3QFDA 3TVMD 4Z7VA 1R5VA 4CVXA 1EH9A 3RWHA 5E7FA 3CMOL 5LQBH 5DK2A 5EB9A 4X6DB 5DJZA 4ELMB 3BT2H 3EOTL 4GW4B 1R24A 3MZTA 1JJUA 3LPGA 2QJDA 4L8SA 4XAWL 2RIKA 1EA9C 1FNEB 1E6JL 2EIEA 2A0LD 4L4VB 4NHUA 5K9KB 2ARJB 3NZHL 3NCCB 4KMQA 4LSQH 2DQJL 4BM7A 5HDBE 1NL0L 1D9KB 3O45B 2GJ6E 1OM3H 2H9GB 1FPTL 1GGCL 3BHBA 4DN3L 2AXJA 2MHAB 2HMIC 4LF3A 1S7QB 5IKCB 2O61A 4OUUB 3Q1SL 4G6JL 1V3MA 4JN1H 1TJIH 2HT3D 2HLAA 1S7SA 1XIWD 4TVPE 2W9DL 3O4LB 5D2NB 3ARBB 3G5VB 4GMTL 1RZ7H 1MVUA 5E94B 1L0QA 2CQVA 5GPRA 2FHCA 4OLWH 3MRLB 5I8KL 5LCVL 1ZV5A 1MNUL 3VGFA 1XGTB 3UTSA 5BZWB 4FFWC 1KGCD 4XNQA 3MLVH 1T1XA 2JJSC 5EA0L 4FQLL 1E4XH 1LP9A 1J12A 3QQ9C 2B1AL 3QPQC 5C0CB 1DBMH 3FN0H 3V6OE 1NC2B 2YPKA 3RY6C 4JPVL 2HTLD 5GS2H 3TESA 1L6XA 5CEXA 3L5WB 2FJHB 1PSKL 3RVXC 3UTZA 4JY6B 4RFEA 1IGCL 4AT6B 2Y6SD 4KKNA 1CIDA 4JPKL 2Z4QA 5KN5B 3RWDB 1WCBB 3Q48A 3BAEH 2FIRT 3MV7A 4YHIA 1YEJL 3EYVA 2F53E 1FGNL 1MIEL 4XHJD 3UAJD 4KI5D 4LLVB 3U9PL 3LB6C 5I19H 1NMCB 2WWKO 4G7VH 3CFKA 1A6TB 1U3ZA 4K94H 1XF3B 1RZFL 4KK5D 4ZNEE 1QQDB 4U05A 4R4NC 2ZZUT 1I7RA 2XWBB 5SV3A 1EEYA 4JFDB 2VDML 1YNKL 4FP8H 3T09A 1IEAA 1J0KA 4XWGL 2HKHL 5IMMB 1U41A 1W0VA 3VFPA 5EZIH 4U1LB 5IHUH 3WEXA 4BZYA 3BX7C 4LOUC 4W6YB 3FHQA 1UXWA 2EDDA 2MOVA 4KDWA 2CR3A 4JREC 5E2VH 5GRUL 3C8KB 2A6KB 3BW9B 2QSCL 3BYYA 4G8GB 5E1AB 1TDQA 1N0XL 4HIEA 4ZS7H 4LVOC 5TH2A 5CBEA 4M7KH 5EN2B 5HHXL 5C0ND 3W0WE 4EI5B 2R0WL 3CXHJ 3K4AA 1IT9L 3HNVL 2VUOA 4HLZH 4NCDA 2EYRA 3HR5B 4Y8AA 4RA3A 2BC4B 2FR4B 4RMVA 2CLRB 4Y16A 1D5XA 4AEIL 5HGHA 3UYPA 2YRPA 3BP5A 3MXVH 1CL7H 3KJ4C 4WUKL 4OB5H 4MVBA 1JWUA 1EO8H 4LDOB 1FV1B 5HVGB 1UZ6F 4LSPL 4F15B 4LCCA 4ZQKA 1QFWI 2XG4A 4N8VB 1H8OA 4LIQE 3DX6B 3MBED 4MXVF 4OBSA 4LAQH 5DVLA 4N0YH 4JGMA 4G8IB 4PJEF 3T2NH 4QHLA 3TPUA 2YBRB 1OF2A 3F12B 4O2EA 3DTXA 4JM2F 4D9LH 2NY0D 4P59H 3QUZC 3BO8B 2WINB 1UVQB 2YA2A 4FS0A 3MRIB 5C0AE 2GAZB 1HILB 5MERA 2VC2H 3QPXH 1M71A 3W9DA 3GGWA 1EERB 3QSKB 1QLFB 3O6MH 4NQDA 2OXHA 5CILH 3BKCH 4FFVC 2IQ9L 4QGYA 1E6OL 3CFEA 2R2HA 1JGDA 5HYJB 4H8WL 4S1SH 2IG2L 4HV8B 3TC9A 3LDBB 3WFDH 4J3OC 4H5SA 5L2JA 2CO7B 3O0RH 1QR4A 3TBSB 3QRGH 3IETA 4W68A 3KLDA 3QFDB 4NKQB 4Z7VB 5HI5D 4RISH 1R5VB 4CVXB 5TDOA 3RWHB 3S34H 4TPRL 5GSVA 4CJ1A 3X12A 5DJZB 1BVLA 3B9KD 1R24B 1CGWA 2NY3D 5D1ZD 4JFED 2MSPA 4L8SB 5F9DC 3DVIA 4LARL 1W0YT 2DOCA 3U9UA 3W2DH 5CIPH 5I71B 3ZL4L 4JQXC 2OYPA 1GGBH 1DTUA 3BHBB 3U2SA 4OFYD 4Y16C 1RK1A 4F7EA 2O61B 1BECA 1KLFA 4LVOB 1DJSA 2IH3A 1JHKL 3FO2A 3ZTNL 2HLAB 1S7SB 4ERSL 3B5GA 5LAXA 2VXUL 3E1F1 1MVUB 3BDBA 2NY6D 4HMDA 4OD1H 5FA3A 4R7DA 1SQ2N 4UTBL 4XNYH 3UTSB 4PY8J 5I9QC 5F7UA 4P0DA 3GSOA 2WUBL 5C6TL 4LKCA 4NFCA 5TQ2H 4XNQB 2XN9E 4MMXC 3ZSSA 1LP9B 4K3JH 4YXLL 4Z9KB 5L88H 4M7LH 4U1MB 3PWPA 4YDJB 2YPKB 5KANI 2VWEE 5CS7A 4YHOL 2PTTA 4JFFD 1GSMA 2RB8A 1KFAH 2P5ED 4OD3L 3QG6A 2QHLA 5CEXB 3MRMA 4S1RH 4NYLA 5D70L 1AXTL 4XVTL 1PQZA 4WWKC 5KVGH 1QP1A 3UTZB 3BEWA 1DFBL 1WBYA 3HZMA 2WAHA 1IC7H 2Z4QB 5D72H 1WV7T 5GGVH 1Z3GL 4PGZA 5IFHL 4P5KA 1JRHH 1ND0A 3FT3A 3RIAK 3MV7B 3MLRL 4ZMAT 4WRLA 2VZSA 2EE2A 3D87B 1MY7A 3EYVB 4X4YA 4OFIA 4RX4A 2PYFA 5JQ6L 5HHPA 5KG9A 4LPUA 1R0AL 5IROA 2UUDH 1CLOL 2QSQA 3CFKB 4L9LC 4MNQB 5JPMA 3MRKA 3IRPX 3THMH 1I7RB 1EEYB 2X7LA 3GJFK 5EU4A 4OSUL 4R8WL 3TYGH 3F7QA 4TVPH 1W0VB 3SGKA 1KEGL 3LN4A 1NAMA 3AREC 5FUCC 1BQHG 3T1FA 3SO3C 4C4KO 3ZYIA 1UXWB 3C09B 3BD5A 3NFSL 5MENB 2VTFA 4JHZA 4UBDC 3OKOA 4ZOCA 3TF7A 4GSDL 2JELH 2V5SA 2Y4SA 4HIEB 5GGRY 5TH2B 1MCLA 5CBEB 3HC4L 1E27A 3EDDA 3DMMC 4PRHE 4MAYC 4ZUUA 1L6ZA 4G42A 4KUZH 2Q8AL 5BOZG 3EGSA 3QQ3A 3R0NA 2QL1A 3S36L 1OLZA 1MCNA 1T2XA 5FHBL 4Y16B 1D5XB 3KPQA 1JV5A 2GY7B 5HGHB 3VXSB 2WMPA 3BP5B 3AROA 3LS4L 5MP6L 3IKKA 1NGQL 4Y5VA 4P2RD 3RX5A 1TJGL 1JWUB 1A7NH 2VLME 5EOCH 3VXUD 4PGJA 5JZ7C 1AIFA 5E2TL 4LCCB 4ZQKB 4YO0A 2GITA 2N56A 3G9VA 4HH8A 5IJKC 1NCAL 5FM8A 3TV3H 5BO1H 2V5MA 5DK0A 2Y07L 4OCWL 1DBKL 3MUZ1 4XBPA 1AJ7L 4QHLB 3TPUB 8CGTA 3NCYS 1OF2B 3MR9A 3GI8L 4O2EB 3ULUE 3DTXB 3STZA 4IRZL 1JNLL 4WUUB 1RUKL 5E08L 4Z77B 3DROB 1Z2KA 2A74A 2H3NA 2VR5A 4LFHG 3WFHA 5MERB 4DK6A 3TJEH 4XBGA 1M71B 2L7JA 4HCRH 1FFPB 2HMID 4B5EA 1NJ9A 2PR4L 3MRFA 4PREA 4MJIE 4PRBA 5AYUL 3JWOH 3BP6B 1MUJA 1BFOA 4HKJA 1MI5E 1I1CA 3GDBA 3WJJA 1ERNA 2W92A 3QDJB 1UEMA 4KRPC 3CFEB 4K9EC 2LABA 2F19H 2R2HB 4M3JA 4NZUH 2RHEA 3DVFA 3HAEG 3D3VA 4RFOL 4HS6A 4JB9H 4HG4K 5EU6A 3SBWA 1CLYL 2X41A 4H5SB 5L2JB 3S37H 3LSOA 1AGBB 3K4ZA 4LL9A 4G6AC 1X5YA 3EDKA 3IETB 4CU8A 5TDOB 1P1ZA 5BXFB 1F4WH 5GSVB 2Q8BL 3WE6A 1U93A 2DTSA 3X12B 1UKSA 4AK1A 1BVLB 1LNUA 4NQTA 3RL1A 1ZTXH 2B4CL 2JJWA 4ZOEA 3UO1L 3U9UB 3VRLF 1G7IA 4R2GD 3EJYC 3R8BB 2UVEA 1KJ3H 3VG9C 1H3TA 4E41D 3BKYH 4LIQH 4EBQH 5J12C 3U7WL 3WV0A 1JMXA 4PRID 5GRZA 3PGFH 4QRSB 4TRPH 3ZKXC 3VFRB 4PRPA 2CK0H 3U2SB 1T2JA 1RK1B 4LEXH 3H9YA 4F7EB 1IM9D 3RVUC 3RDTC 2EIDA 2ICCA 1XGUA 4Y1AE 2X5PA 3O41B 4Y5VC 1LO4L 3E8UL 2VDNH 1G9EA 5LAXB 1V05A 3HE6D 4QT5A 2OP4L 3MLSL 5JLZB 5FA3B 4UMGA 5JDJA 1QRNB 3BZ4A 4EIGB 5DJDA 1NUDA 4OZGE 4ALAH 2X2YA 1RURL 4LKCB 3AMLA 3TH4T 4PJ7E 2COQA 1IZJA 2ICWJ 3DRQB 5CZVH 3JWNC 1IGJA 3PWPB 3MRPA 2X4TA 1MCRA 2A9MH